Citrus Sinensis ID: 009168

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-
MDSTTETLQHHALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSKEEAEEDAKQIEELAFAAANQHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDSKLKELHINKEE
cccccccccccccEEEEccccHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccccccccc
ccccccccccccEEEEEccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccHcccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHcHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccccEEEccccccEHHHHHHHHHHHHHcccccEEEccccEcHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHcccccHccEEEccccc
MDSTTETLQHHAlsvklwppsqsTRLMLVQRMTknlttpsifsrkygllskEEAEEDAKQIEELAFAAANQhyekepdgdgsssVQIYAKESSKLMLEVIKrgprtkedGEEMIAEKATAAsqtvfdisggqrgfIEEEEAKLllgpltepgnsytricfsnksfglgasrvAAPILRLIKDqltevdlsdfiagrpeEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFhnnmtgdeGAVAISEIVkhspaledfrcsstrigAEGGIALAKALGqcthlkkldlrdnmFGVEAGVALsevlpafpdlTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAvnkpglkmlningnfipdegIDEVKEILKHSLdvlgpldendpegedyddgaeeddaDIRNDLDSKLKELHINKEE
mdsttetlqhhalsvklwppsqSTRLMLVQRMtknlttpsifsrKYGLLSKEEAEEDAKQIEELAFAAANQHYekepdgdgssSVQIYAKESSKLMLEVIKRgprtkedgEEMIAEkataasqtvfdISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDsklkelhinkee
MDSTTETLQHHALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSkeeaeedakqieeLAFAAANQHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYlnledegaealagalkeCAPSLEVLDLAGNDITakaasslaacialkQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENdpegedyddgaeeddadIRNDLDSKLKELHINKEE
****************LW*******LMLVQRM********IF**********************************************************************************VFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVL*****************************************
**************************MLVQRMTKNLTTPSIFSRKYG*********DAKQIEELAFAAAN*H**********SSVQIYAKESSKLMLEVIK***************KATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDSKLKELHINKE*
***********ALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLL*********KQIEELAFAAANQH************VQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDSKLKELHINKEE
**********HALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSKEEAEEDAKQIEELAFAAANQHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTK**GEEMIAEKATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDSKLKELHI****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTTETLQHHALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSxxxxxxxxxxxxxxxxxxxxxHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDSKLKELHINKEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query541 2.2.26 [Sep-21-2011]
Q9LE82535 RAN GTPase-activating pro yes no 0.922 0.932 0.685 0.0
Q9M651545 RAN GTPase-activating pro no no 0.911 0.904 0.655 0.0
C3VPR61915 Protein NLRC5 OS=Mus musc yes no 0.486 0.137 0.304 1e-23
Q5DU561064 Protein NLRC3 OS=Mus musc no no 0.463 0.235 0.338 1e-21
Q7RTR21065 Protein NLRC3 OS=Homo sap yes no 0.463 0.235 0.334 3e-20
O13066 580 Ran GTPase-activating pro N/A no 0.504 0.470 0.326 4e-20
Q0VAA2488 Uncharacterized protein C no no 0.467 0.518 0.300 2e-18
A0JPI9479 Uncharacterized protein C no no 0.447 0.505 0.277 2e-15
Q9VIW3 596 Ran GTPase-activating pro yes no 0.552 0.501 0.268 3e-15
Q86WI31866 Protein NLRC5 OS=Homo sap no no 0.480 0.139 0.278 1e-14
>sp|Q9LE82|RAGP1_ARATH RAN GTPase-activating protein 1 OS=Arabidopsis thaliana GN=RANGAP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/506 (68%), Positives = 421/506 (83%), Gaps = 7/506 (1%)

Query: 1   MDSTTETLQHHALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSKEEAEEDAKQ 60
           MD + +T Q+  LSVK+WPPS+STRLMLV+RMTKN+TTPSIFSRKYGLLS EEAE+DAK+
Sbjct: 1   MDHSAKTTQNRVLSVKMWPPSKSTRLMLVERMTKNITTPSIFSRKYGLLSVEEAEQDAKR 60

Query: 61  IEELAFAAANQHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATA 120
           IE+LAFA AN+H++ EPDGDG+S+V +YAKESSKLML+VIKRGP+ + + E       + 
Sbjct: 61  IEDLAFATANKHFQNEPDGDGTSAVHVYAKESSKLMLDVIKRGPQEESEVE------VSK 114

Query: 121 ASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLI 180
                FDISGG R FIEEEEA+ LL PL +P NSYT+I FSN+SFG  A++ AA +L  I
Sbjct: 115 DGDVFFDISGGSRAFIEEEEARDLLRPLADPRNSYTKIRFSNRSFGSEAAKFAASVLSSI 174

Query: 181 KDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLK 240
           KDQLTEVDLSDF+AGRPE EALEV+NMFSSALEGS+LRYLNLS NALGEKG+RAF +L+ 
Sbjct: 175 KDQLTEVDLSDFVAGRPEAEALEVMNMFSSALEGSKLRYLNLSDNALGEKGIRAFASLIN 234

Query: 241 SQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPA 300
           SQ++LEEL+LMNDGISE+AA+A+ EL+PST+K++VL FHNNMTGDEGA AI+EIV+  P+
Sbjct: 235 SQHDLEELYLMNDGISEDAARAVRELLPSTDKIRVLQFHNNMTGDEGATAIAEIVRECPS 294

Query: 301 LEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEV 360
           LEDFRCSSTRIG+EGG+ALA+AL  C+HLKKLDLRDNMFGVE G+AL++ L     LTE+
Sbjct: 295 LEDFRCSSTRIGSEGGVALAEALEHCSHLKKLDLRDNMFGVEGGIALAKTLSVLTHLTEI 354

Query: 361 YLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLA 420
           Y+SYLNLEDEG EAL+ AL + APSLEVL+LAGNDIT K+  +LAACIA KQ L KLNL+
Sbjct: 355 YMSYLNLEDEGTEALSEALLKSAPSLEVLELAGNDITVKSTGNLAACIASKQSLAKLNLS 414

Query: 421 ENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNF 480
           ENEL+DEG ILI K++ EGH QL+E+DLSTN ++RAGAR LAQ  V K   K+LNINGNF
Sbjct: 415 ENELKDEGTILIAKAV-EGHDQLVEVDLSTNMIRRAGARALAQTVVKKNTFKLLNINGNF 473

Query: 481 IPDEGIDEVKEILKHSLDVLGPLDEN 506
           I +EGIDEV ++ K  LD L PLD+N
Sbjct: 474 ISEEGIDEVNDMFKDCLDKLVPLDDN 499
GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M651|RAGP2_ARATH RAN GTPase-activating protein 2 OS=Arabidopsis thaliana GN=RANGAP2 PE=1 SV=2 Back     alignment and function description
>sp|C3VPR6|NLRC5_MOUSE Protein NLRC5 OS=Mus musculus GN=Nlrc5 PE=1 SV=2 Back     alignment and function description
>sp|Q5DU56|NLRC3_MOUSE Protein NLRC3 OS=Mus musculus GN=Nlrc3 PE=2 SV=2 Back     alignment and function description
>sp|Q7RTR2|NLRC3_HUMAN Protein NLRC3 OS=Homo sapiens GN=NLRC3 PE=2 SV=2 Back     alignment and function description
>sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 Back     alignment and function description
>sp|Q0VAA2|CN16B_HUMAN Uncharacterized protein C14orf166B OS=Homo sapiens GN=C14orf166B PE=2 SV=2 Back     alignment and function description
>sp|A0JPI9|CN16B_RAT Uncharacterized protein C14orf166B homolog OS=Rattus norvegicus PE=2 SV=1 Back     alignment and function description
>sp|Q9VIW3|RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster GN=RanGap PE=1 SV=1 Back     alignment and function description
>sp|Q86WI3|NLRC5_HUMAN Protein NLRC5 OS=Homo sapiens GN=NLRC5 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query541
449458432539 PREDICTED: RAN GTPase-activating protein 0.996 1.0 0.731 0.0
225436920541 PREDICTED: RAN GTPase-activating protein 0.998 0.998 0.759 0.0
147789790541 hypothetical protein VITISV_039541 [Viti 0.998 0.998 0.757 0.0
356500208533 PREDICTED: RAN GTPase-activating protein 0.935 0.949 0.765 0.0
255559446546 leucine rich repeat-containing protein, 1.0 0.990 0.761 0.0
357440739533 Ran GTPase activating protein [Medicago 0.985 1.0 0.739 0.0
217074422533 unknown [Medicago truncatula] 0.985 1.0 0.737 0.0
224062521543 predicted protein [Populus trichocarpa] 0.940 0.937 0.772 0.0
156229390534 Ran GTPase-activating protein 1 [Solanum 0.977 0.990 0.740 0.0
224085459522 predicted protein [Populus trichocarpa] 0.940 0.975 0.764 0.0
>gi|449458432|ref|XP_004146951.1| PREDICTED: RAN GTPase-activating protein 1-like [Cucumis sativus] gi|449517201|ref|XP_004165634.1| PREDICTED: RAN GTPase-activating protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/541 (73%), Positives = 478/541 (88%), Gaps = 2/541 (0%)

Query: 1   MDSTTETLQHHALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSKEEAEEDAKQ 60
           MDS+T+T Q   +S+KLWPPSQSTR MLV+R+ KNLTTPSIFSRKYGLLSKEEAEEDAKQ
Sbjct: 1   MDSSTQTFQPRVMSIKLWPPSQSTRFMLVERIIKNLTTPSIFSRKYGLLSKEEAEEDAKQ 60

Query: 61  IEELAFAAANQHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATA 120
           +E++AF  ANQH+EKEPDGDGSS+VQIYAKESS+LML+++KRGPR KEDGE +I+EK+T 
Sbjct: 61  VEDMAFVTANQHFEKEPDGDGSSAVQIYAKESSRLMLDILKRGPRVKEDGEVLISEKSTT 120

Query: 121 ASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLI 180
              TVFDISGG+R FI+ EEA++LL PL +PGN +T+ICFSN+SFGL A+RVA PIL  I
Sbjct: 121 RG-TVFDISGGRRAFIDAEEAEVLLEPLKDPGNLFTKICFSNRSFGLDAARVAEPILFSI 179

Query: 181 KDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLK 240
           KD+LTEVDLSDFIAGR E +ALEV+N+FS+ALEG  LRYL+LS+NA+GEKGVRAFG LL+
Sbjct: 180 KDRLTEVDLSDFIAGRSEGDALEVMNIFSAALEGCDLRYLDLSNNAMGEKGVRAFGLLLR 239

Query: 241 SQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPA 300
           SQ NLEEL+LMNDGISEEAA+A+ ELIPST+KL++L FHNNMTGDEGA++ISEIVK SPA
Sbjct: 240 SQKNLEELYLMNDGISEEAARAVRELIPSTDKLRILQFHNNMTGDEGAISISEIVKSSPA 299

Query: 301 LEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEV 360
           LEDFRCSSTR+G+EGG+ALA+A+G CT LKKLDLRDNMFGVEAGVALS+ + +FP LTE+
Sbjct: 300 LEDFRCSSTRVGSEGGVALAEAIGTCTRLKKLDLRDNMFGVEAGVALSKSISSFPGLTEI 359

Query: 361 YLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLA 420
           YLSYLNLEDEGAEALA ALK+ APSLEVL++AGNDITAK A S+AAC+A KQFL+KL LA
Sbjct: 360 YLSYLNLEDEGAEALANALKDSAPSLEVLEVAGNDITAKGAVSIAACVATKQFLSKLYLA 419

Query: 421 ENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNF 480
           ENEL+D+G ILIGK+L++GHGQL E+D STNS++RAGAR +AQ+ V KPG K+LNIN N+
Sbjct: 420 ENELKDDGVILIGKALQDGHGQLSEVDFSTNSIRRAGARFVAQILVQKPGFKLLNINANY 479

Query: 481 IPDEGIDEVKEILKHSLDVLGPLDENDPEGEDYDDGAEEDDADIRNDLDSKLKELHINKE 540
           I +EGIDEVKEI K+S ++LG LDENDP+GEDYD+ AEE + D  ++L+SKLK L I +E
Sbjct: 480 ISEEGIDEVKEIFKNSPNMLGSLDENDPDGEDYDEDAEE-NGDHDDELESKLKGLDIKQE 538

Query: 541 E 541
           E
Sbjct: 539 E 539

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225436920|ref|XP_002275003.1| PREDICTED: RAN GTPase-activating protein 1 isoform 2 [Vitis vinifera] gi|225436922|ref|XP_002274973.1| PREDICTED: RAN GTPase-activating protein 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789790|emb|CAN73875.1| hypothetical protein VITISV_039541 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500208|ref|XP_003518925.1| PREDICTED: RAN GTPase-activating protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255559446|ref|XP_002520743.1| leucine rich repeat-containing protein, putative [Ricinus communis] gi|223540128|gb|EEF41705.1| leucine rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357440739|ref|XP_003590647.1| Ran GTPase activating protein [Medicago truncatula] gi|355479695|gb|AES60898.1| Ran GTPase activating protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074422|gb|ACJ85571.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224062521|ref|XP_002300846.1| predicted protein [Populus trichocarpa] gi|222842572|gb|EEE80119.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|156229390|emb|CAL69643.1| Ran GTPase-activating protein 1 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|224085459|ref|XP_002307582.1| predicted protein [Populus trichocarpa] gi|222857031|gb|EEE94578.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query541
TAIR|locus:2099207535 RANGAP1 "AT3G63130" [Arabidops 0.987 0.998 0.604 3e-165
TAIR|locus:2150285545 RANGAP2 "AT5G19320" [Arabidops 0.981 0.974 0.570 4.9e-156
TAIR|locus:2083028211 AT3G06000 [Arabidopsis thalian 0.303 0.777 0.391 2.1e-25
UNIPROTKB|Q7RTR21065 NLRC3 "Protein NLRC3" [Homo sa 0.654 0.332 0.282 1.6e-19
MGI|MGI:24440701064 Nlrc3 "NLR family, CARD domain 0.478 0.243 0.296 2e-18
TAIR|locus:2194604605 emb2004 "embryo defective 2004 0.506 0.452 0.261 1.3e-17
MGI|MGI:36121911915 Nlrc5 "NLR family, CARD domain 0.615 0.173 0.264 3.2e-15
ASPGD|ASPL0000071633417 ranGAP [Emericella nidulans (t 0.439 0.570 0.260 1.5e-14
UNIPROTKB|P46060 587 RANGAP1 "Ran GTPase-activating 0.595 0.548 0.270 5.6e-13
MGI|MGI:1921935391 4930451C15Rik "RIKEN cDNA 4930 0.473 0.654 0.257 7.7e-13
TAIR|locus:2099207 RANGAP1 "AT3G63130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1608 (571.1 bits), Expect = 3.0e-165, P = 3.0e-165
 Identities = 327/541 (60%), Positives = 398/541 (73%)

Query:     1 MDSTTETLQHHALSVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSXXXXXXXXXX 60
             MD + +T Q+  LSVK+WPPS+STRLMLV+RMTKN+TTPSIFSRKYGLLS          
Sbjct:     1 MDHSAKTTQNRVLSVKMWPPSKSTRLMLVERMTKNITTPSIFSRKYGLLSVEEAEQDAKR 60

Query:    61 XXXLAFAAANQHYEKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEMIAEKATA 120
                LAFA AN+H++ EPDGDG+S+V +YAKESSKLML+VIKRGP+  E+ E  +++    
Sbjct:    61 IEDLAFATANKHFQNEPDGDGTSAVHVYAKESSKLMLDVIKRGPQ--EESEVEVSKDG-- 116

Query:   121 ASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLI 180
                  FDISGG R FIEEEEA+ LL PL +P NSYT+I FSN+SFG  A++ AA +L  I
Sbjct:   117 --DVFFDISGGSRAFIEEEEARDLLRPLADPRNSYTKIRFSNRSFGSEAAKFAASVLSSI 174

Query:   181 KDQLTEVDLSDFIAGRPEEEALEVINMFSSALEGSQLRYLNLSHNALGEKGVRAFGALLK 240
             KDQLTEVDLSDF+AGRPE EALEV+NMFSSALEGS+LRYLNLS NALGEKG+RAF +L+ 
Sbjct:   175 KDQLTEVDLSDFVAGRPEAEALEVMNMFSSALEGSKLRYLNLSDNALGEKGIRAFASLIN 234

Query:   241 SQNNLEELHLMNDGISEEAAQAILELIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPA 300
             SQ++LEEL+LMNDGISE+AA+A+ EL+PST+K++VL FHNNMTGDEGA AI+EIV+  P+
Sbjct:   235 SQHDLEELYLMNDGISEDAARAVRELLPSTDKIRVLQFHNNMTGDEGATAIAEIVRECPS 294

Query:   301 LEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEV 360
             LEDFRCSSTRIG+EGG+ALA+AL  C+HLKKLDLRDNMFGVE G+AL++ L     LTE+
Sbjct:   295 LEDFRCSSTRIGSEGGVALAEALEHCSHLKKLDLRDNMFGVEGGIALAKTLSVLTHLTEI 354

Query:   361 YLSYXXXXXXXXXXXXXXXXXCAPSLEVLDLAGNDITXXXXXXXXXXXXXXQFLTKLNLA 420
             Y+SY                  APSLEVL+LAGNDIT              Q L KLNL+
Sbjct:   355 YMSYLNLEDEGTEALSEALLKSAPSLEVLELAGNDITVKSTGNLAACIASKQSLAKLNLS 414

Query:   421 ENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNF 480
             ENEL+DEG ILI K++E GH QL+E+DLSTN ++RAGAR LAQ  V K   K+LNINGNF
Sbjct:   415 ENELKDEGTILIAKAVE-GHDQLVEVDLSTNMIRRAGARALAQTVVKKNTFKLLNINGNF 473

Query:   481 IPDEGIDEVKEILKHSLDVLGPLDENXXXXXXXXXXXXXXXXXIRNDLDSKLKELHINKE 540
             I +EGIDEV ++ K  LD L PLD+N                   N+L+SKL  L I + 
Sbjct:   474 ISEEGIDEVNDMFKDCLDKLVPLDDNDPEGEDFEDEDEEEEGEDGNELESKLGSLKIKQG 533

Query:   541 E 541
             E
Sbjct:   534 E 534
GO:0005098 "Ran GTPase activator activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0000072 "M phase specific microtubule process" evidence=TAS
GO:0005635 "nuclear envelope" evidence=IDA
GO:0006606 "protein import into nucleus" evidence=RCA;TAS
GO:0009507 "chloroplast" evidence=IDA
GO:0009504 "cell plate" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0000910 "cytokinesis" evidence=IMP
GO:0032153 "cell division site" evidence=IDA
GO:0000280 "nuclear division" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006913 "nucleocytoplasmic transport" evidence=RCA
GO:0007000 "nucleolus organization" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0048527 "lateral root development" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
TAIR|locus:2150285 RANGAP2 "AT5G19320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083028 AT3G06000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7RTR2 NLRC3 "Protein NLRC3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444070 Nlrc3 "NLR family, CARD domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2194604 emb2004 "embryo defective 2004" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:3612191 Nlrc5 "NLR family, CARD domain containing 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000071633 ranGAP [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|P46060 RANGAP1 "Ran GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921935 4930451C15Rik "RIKEN cDNA 4930451C15 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LE82RAGP1_ARATHNo assigned EC number0.68570.92230.9327yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023666001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (541 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query541
pfam13943100 pfam13943, WPP, WPP domain 2e-55
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-36
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-31
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-22
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 9e-14
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 3e-11
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
>gnl|CDD|206114 pfam13943, WPP, WPP domain Back     alignment and domain information 
 Score =  180 bits (460), Expect = 2e-55
 Identities = 67/100 (67%), Positives = 79/100 (79%)

Query: 14  SVKLWPPSQSTRLMLVQRMTKNLTTPSIFSRKYGLLSKEEAEEDAKQIEELAFAAANQHY 73
           S KLWPPSQ TR  +V+R+T+ L+TPSI S++YGLLSKEEAEE AK IEE AFAAAN H 
Sbjct: 1   SFKLWPPSQRTRDAVVERLTETLSTPSILSKRYGLLSKEEAEEAAKAIEEEAFAAANAHA 60

Query: 74  EKEPDGDGSSSVQIYAKESSKLMLEVIKRGPRTKEDGEEM 113
            KEPDGDG S++Q+Y+KE SK MLEV+KR PR  E  EE 
Sbjct: 61  SKEPDGDGISALQLYSKEISKRMLEVLKRRPRAAEAPEEP 100

Length = 100
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 541
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 100.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 100.0
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.97
PF1394399 WPP: WPP domain 99.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG4308478 consensus LRR-containing protein [Function unknown 99.78
KOG4308478 consensus LRR-containing protein [Function unknown 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.69
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.58
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.52
KOG4341483 consensus F-box protein containing LRR [General fu 99.49
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.38
KOG4341483 consensus F-box protein containing LRR [General fu 99.35
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.32
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.26
KOG0617264 consensus Ras suppressor protein (contains leucine 99.23
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.67
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.54
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.48
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.42
PLN03150623 hypothetical protein; Provisional 98.24
PLN03150623 hypothetical protein; Provisional 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.04
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 98.02
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.69
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.44
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.43
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.32
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.3
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.2
PRK15386 426 type III secretion protein GogB; Provisional 97.08
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.98
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 96.96
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.88
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 96.7
PRK15386 426 type III secretion protein GogB; Provisional 96.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.49
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.14
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.03
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.44
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.63
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 84.37
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 84.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 83.71
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-39  Score=304.30  Aligned_cols=367  Identities=43%  Similarity=0.583  Sum_probs=332.7

Q ss_pred             EEeccCCCcccccHHHHHHHhccccCCCCcceEEEeeCCCCCchHHHHHHHHHHHhccCccEEEcCCCcCCCchHHHHHH
Q 009168          125 VFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEEALEV  204 (541)
Q Consensus       125 ~ldls~~~~~~~~~~~~~~ll~~l~~~~~~l~~L~Ls~~~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~~~~~~~~~l~~  204 (541)
                      .+++.|..+++-+.++...+...+... .++++|+||||.|+.++.++++..+...+ +|+..++|+.+.+++..+....
T Consensus         3 ~~s~~gk~lkl~t~ed~~~v~~~~~~~-~s~~~l~lsgnt~G~EAa~~i~~~L~~~~-~L~~v~~sd~ftGR~~~Ei~e~   80 (382)
T KOG1909|consen    3 FFSIGGKSLKLETEEDEKDVEEELEPM-DSLTKLDLSGNTFGTEAARAIAKVLASKK-ELREVNLSDMFTGRLKDEIPEA   80 (382)
T ss_pred             eeccCCeeeeeehHhhhhhHHHHhccc-CceEEEeccCCchhHHHHHHHHHHHhhcc-cceeeehHhhhcCCcHHHHHHH
Confidence            466777777766666666655555444 89999999999999999999999999865 9999999999999999999999


Q ss_pred             HHHHHhhhcCC-CeeEEEcCCCCCChhHHHHHHHHhhcCCCccEEEecCCCCCHHHHHHHHH---------hcCCCCCcc
Q 009168          205 INMFSSALEGS-QLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILE---------LIPSTEKLK  274 (541)
Q Consensus       205 l~~~~~~l~~~-~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~---------~l~~~~~L~  274 (541)
                      |.+++.++.++ +|++||||+|.|+..+++.|..+|++|..|++|+|++|+++..+...+..         .+++.+.|+
T Consensus        81 L~~l~~aL~~~~~L~~ldLSDNA~G~~g~~~l~~ll~s~~~L~eL~L~N~Glg~~ag~~l~~al~~l~~~kk~~~~~~Lr  160 (382)
T KOG1909|consen   81 LKMLSKALLGCPKLQKLDLSDNAFGPKGIRGLEELLSSCTDLEELYLNNCGLGPEAGGRLGRALFELAVNKKAASKPKLR  160 (382)
T ss_pred             HHHHHHHHhcCCceeEeeccccccCccchHHHHHHHHhccCHHHHhhhcCCCChhHHHHHHHHHHHHHHHhccCCCcceE
Confidence            99999999776 99999999999999999999999999999999999999999988877544         456678999


Q ss_pred             EEEcCCCCCChHHHHHHHHHhhcCCCccEEEecCCCCChhHHHHHHHHhhcCCCcCEEEccCCCCCchHHHHHHHhcccC
Q 009168          275 VLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAF  354 (541)
Q Consensus       275 ~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~  354 (541)
                      ++..++|++.+.++..++..+...+.|+.+.+..|.|...|+..+..++..|++|+.|||.+|.|+..+...++..+..+
T Consensus       161 v~i~~rNrlen~ga~~~A~~~~~~~~leevr~~qN~I~~eG~~al~eal~~~~~LevLdl~DNtft~egs~~LakaL~s~  240 (382)
T KOG1909|consen  161 VFICGRNRLENGGATALAEAFQSHPTLEEVRLSQNGIRPEGVTALAEALEHCPHLEVLDLRDNTFTLEGSVALAKALSSW  240 (382)
T ss_pred             EEEeeccccccccHHHHHHHHHhccccceEEEecccccCchhHHHHHHHHhCCcceeeecccchhhhHHHHHHHHHhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCEEEcccCCCChhHHHHHHHHHhhcCCCccEEEecCCCCCHHHHHHHHHHHhhCCCccEEEccCCCC--ChhHHHHH
Q 009168          355 PDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENEL--QDEGAILI  432 (541)
Q Consensus       355 ~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l--~~~g~~~l  432 (541)
                      ++|++|++++|.+...|..++.+++....|+|++|.+.+|.|+..+...++.++...+.|.+|+|++|.+  .++++..+
T Consensus       241 ~~L~El~l~dcll~~~Ga~a~~~al~~~~p~L~vl~l~gNeIt~da~~~la~~~~ek~dL~kLnLngN~l~e~de~i~ei  320 (382)
T KOG1909|consen  241 PHLRELNLGDCLLENEGAIAFVDALKESAPSLEVLELAGNEITRDAALALAACMAEKPDLEKLNLNGNRLGEKDEGIDEI  320 (382)
T ss_pred             chheeecccccccccccHHHHHHHHhccCCCCceeccCcchhHHHHHHHHHHHHhcchhhHHhcCCcccccccchhHHHH
Confidence            9999999999999999999999999998999999999999999999999999999999999999999999  88899988


Q ss_pred             HHHhhhcCCCccEEEccCCCCChHHHHHHHHHHhcCCCccEEEecCCCCChhHHHHHHHHH
Q 009168          433 GKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEIL  493 (541)
Q Consensus       433 ~~~l~~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~L~~L~L~~N~i~~~g~~~l~~~l  493 (541)
                      ...+......+...+.+.+.+.+.|.............-+.+++.++.+.+++++++.+.+
T Consensus       321 ~~~~~~~~~~~~~~~~s~e~l~~eg~e~e~~~~~~~~t~~e~~ed~e~ie~e~~ee~~e~~  381 (382)
T KOG1909|consen  321 ASKFDTAHVLLEDIDDSEEELEREGEEDEEEEVEKKETFKELNEDGEVIEEEGIEELKEIF  381 (382)
T ss_pred             HHhcccccccchhhchhHHHHHhhhhhHHHHHHHhcCcchhhcccccccchhHHHHhhhhc
Confidence            8877434566777888888888888888888888888888888888888888888887654

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13943 WPP: WPP domain Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query541
2bnh_A457 Porcine Ribonuclease Inhibitor Length = 457 2e-10
3tsr_E457 X-Ray Structure Of Mouse Ribonuclease Inhibitor Com 1e-09
1yrg_A385 The Crystal Structure Of Rna1p: A New Fold For A Gt 3e-05
1k5d_C386 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 3e-05
1a4y_A460 Ribonuclease Inhibitor-Angiogenin Complex Length = 2e-04
1z7x_W461 X-Ray Structure Of Human Ribonuclease Inhibitor Com 2e-04
>pdb|2BNH|A Chain A, Porcine Ribonuclease Inhibitor Length = 457 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 126/286 (44%), Gaps = 40/286 (13%)
Query: 217 LRYLNLSHNALGEKGVRAFG-ALLKSQNNLEELHLMNDGISEEAAQAILELIPSTEKLKV 275
           LR L+LS N LG+ G+R     LL  Q +LE+L L    ++  + + +  ++ +T  LK 
Sbjct: 111 LRELHLSDNPLGDAGLRLLCEGLLDPQCHLEKLQLEYCRLTAASCEPLASVLRATRALKE 170
Query: 276 LHFHNNMTGDEGAVAISEIVKHSPA-LEDFR---CSSTRIGAE--GGIALAKALGQCTHL 329
           L   NN  G+ GA  + + +  S   LE  R   C  T    +   GI  ++A      L
Sbjct: 171 LTVSNNDIGEAGARVLGQGLADSACQLETLRLENCGLTPANCKDLCGIVASQA-----SL 225
Query: 330 KKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYXXXXXXXXXXXXXXXXXCAPSLEVL 389
           ++LDL  N  G +AG+A  E+ P         LS                   A  L+ L
Sbjct: 226 RELDLGSNGLG-DAGIA--ELCPGL-------LSP------------------ASRLKTL 257
Query: 390 DLAGNDITXXXXXXXXXXXXXXQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLS 449
            L   DIT              + L +L+LA N+L DEGA L+ +SL +   QL  + + 
Sbjct: 258 WLWECDITASGCRDLCRVLQAKETLKELSLAGNKLGDEGARLLCESLLQPGCQLESLWVK 317
Query: 450 TNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKH 495
           + S+  A  + ++ +      L  L ++ N + D GI E+ + L  
Sbjct: 318 SCSLTAACCQHVSLMLTQNKHLLELQLSSNKLGDSGIQELCQALSQ 363
>pdb|3TSR|E Chain E, X-Ray Structure Of Mouse Ribonuclease Inhibitor Complexed With Mouse Ribonuclease 1 Length = 457 Back     alignment and structure
>pdb|1YRG|A Chain A, The Crystal Structure Of Rna1p: A New Fold For A Gtpase- Activating Protein Length = 385 Back     alignment and structure
>pdb|1K5D|C Chain C, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 386 Back     alignment and structure
>pdb|1A4Y|A Chain A, Ribonuclease Inhibitor-Angiogenin Complex Length = 460 Back     alignment and structure
>pdb|1Z7X|W Chain W, X-Ray Structure Of Human Ribonuclease Inhibitor Complexed With Ribonuclease I Length = 461 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query541
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-76
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-59
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-48
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-71
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-52
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-48
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-49
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-24
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-23
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-20
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 8e-16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-13
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
 Score =  247 bits (632), Expect = 3e-76
 Identities = 83/379 (21%), Positives = 153/379 (40%), Gaps = 15/379 (3%)

Query: 136 IEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAG 195
           + +     +L  L  P     ++   N         V +  LR +   L E+ LSD + G
Sbjct: 68  LGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLP-TLQELHLSDNLLG 126

Query: 196 RPEEEALEVINMFSSALE--GSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMND 253
               + L         L     +L  L L + +L         ++L+++ + +EL + N+
Sbjct: 127 DAGLQLL------CEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNN 180

Query: 254 GISEEAAQAILE-LIPSTEKLKVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIG 312
            I+E   + + + L  S  +L+ L   +     +    +  IV    +L +    S ++G
Sbjct: 181 DINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLG 240

Query: 313 AEGGIALAKALGQC-THLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEG 371
             G   L   L    + L+ L + +     +    L  VL A   L E+ L+   L DEG
Sbjct: 241 DVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG 300

Query: 372 AEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAIL 431
           A  L   L E    LE L +     TA   S  ++ +A  +FL +L ++ N L+D G   
Sbjct: 301 ARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRE 360

Query: 432 IGKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKE 491
           + + L +    L  + L+   +  +    LA   +    L+ L+++ N + D GI ++ E
Sbjct: 361 LCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVE 420

Query: 492 ILKHS---LDVLGPLDEND 507
            ++     L+ L  L +  
Sbjct: 421 SVRQPGCLLEQLV-LYDIY 438
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query541
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.98
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.78
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.56
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.56
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.54
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.46
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.41
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.38
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.38
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.37
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.37
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.36
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.35
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.27
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.24
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.21
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.01
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.85
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.83
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.76
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.75
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.33
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.85
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.54
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 88.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 88.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 87.8
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
Probab=100.00  E-value=5.4e-39  Score=336.52  Aligned_cols=378  Identities=21%  Similarity=0.288  Sum_probs=333.3

Q ss_pred             hhhccCCcEEeccCCCcccccHHHHHHHhccccCCCCcceEEEeeCCCCCchHHHHHHHHHHHhccCccEEEcCCCcCCC
Q 009168          117 KATAASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGR  196 (541)
Q Consensus       117 ~~~~~~l~~ldls~~~~~~~~~~~~~~ll~~l~~~~~~l~~L~Ls~~~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~~~~  196 (541)
                      ....+.+++|+|++|.   ++......+...+....+++++|+|++|.++..++..+...+... ++|++|+|++|.+++
T Consensus        52 l~~~~~L~~L~Ls~n~---l~~~~~~~l~~~l~~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~-~~L~~L~Ls~n~i~~  127 (461)
T 1z7x_W           52 LRVNPALAELNLRSNE---LGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTL-PTLQELHLSDNLLGD  127 (461)
T ss_dssp             HHTCTTCCEEECTTCC---CHHHHHHHHHHTTCSTTCCCCEEECTTSCCBGGGHHHHHHHTTSC-TTCCEEECCSSBCHH
T ss_pred             HHhCCCcCEEeCCCCc---CChHHHHHHHHHHhhCCCceeEEEccCCCCCHHHHHHHHHHHccC-CceeEEECCCCcCch
Confidence            3445789999999987   556677777777766544899999999999998888887777664 499999999999876


Q ss_pred             chHHHHHHHHHHHhhhc--CCCeeEEEcCCCCCChhHHHHHHHHhhcCCCccEEEecCCCCCHHHHHHHHHhcC-CCCCc
Q 009168          197 PEEEALEVINMFSSALE--GSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELIP-STEKL  273 (541)
Q Consensus       197 ~~~~~l~~l~~~~~~l~--~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~-~~~~L  273 (541)
                      .+...+      ...+.  .++|++|+|++|.+++.+...++..+..+++|++|+|++|.++..++..+...+. ..++|
T Consensus       128 ~~~~~l------~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~~L  201 (461)
T 1z7x_W          128 AGLQLL------CEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQL  201 (461)
T ss_dssp             HHHHHH------HHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCTTCCEEECCSSBCHHHHHHHHHHHHHHSCCCC
T ss_pred             HHHHHH------HHHHhcCCCcceEEECCCCCCCHHHHHHHHHHHhhCCCCCEEECcCCCcchHHHHHHHHHHhcCCCCc
Confidence            543332      22221  2579999999999999999999999999999999999999999988888877654 35699


Q ss_pred             cEEEcCCCCCChHHHHHHHHHhhcCCCccEEEecCCCCChhHHHHHHHHhh-cCCCcCEEEccCCCCCchHHHHHHHhcc
Q 009168          274 KVLHFHNNMTGDEGAVAISEIVKHSPALEDFRCSSTRIGAEGGIALAKALG-QCTHLKKLDLRDNMFGVEAGVALSEVLP  352 (541)
Q Consensus       274 ~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~-~~~~L~~L~L~~n~l~~~~~~~l~~~l~  352 (541)
                      ++|++++|.+++.+...++..+..+++|++|++++|.+++.+...++..+. .+++|++|++++|.++..+...++..+.
T Consensus       202 ~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~  281 (461)
T 1z7x_W          202 EALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLR  281 (461)
T ss_dssp             CEEECTTSCCBTTHHHHHHHHHHHCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHH
T ss_pred             eEEEccCCCCcHHHHHHHHHHHHhCCCccEEeccCCcCChHHHHHHHHHHhcCCCCceEEECcCCCCCHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999988888877665 5899999999999999999999999999


Q ss_pred             cCCCCCEEEcccCCCChhHHHHHHHHHhhcCCCccEEEecCCCCCHHHHHHHHHHHhhCCCccEEEccCCCCChhHHHHH
Q 009168          353 AFPDLTEVYLSYLNLEDEGAEALAGALKECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILI  432 (541)
Q Consensus       353 ~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~g~~~l  432 (541)
                      .+++|++|++++|.+++.++..++..+..+.++|+.|++++|.+++.+...+...+..+++|++|+|++|.+++.|+..+
T Consensus       282 ~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l  361 (461)
T 1z7x_W          282 AKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVREL  361 (461)
T ss_dssp             HCTTCCEEECTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHH
T ss_pred             hCCCcceEECCCCCCchHHHHHHHHHhccCCccceeeEcCCCCCchHHHHHHHHHHhhCCCccEEEccCCccccccHHHH
Confidence            99999999999999999999999998877778999999999999999988999999999999999999999999999999


Q ss_pred             HHHhhhcCCCccEEEccCCCCChHHHHHHHHHHhcCCCccEEEecCCCCChhHHHHHHHHHhcCccccccCC
Q 009168          433 GKSLEEGHGQLIEIDLSTNSMKRAGARLLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLD  504 (541)
Q Consensus       433 ~~~l~~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~L~~L~L~~N~i~~~g~~~l~~~l~~~~~~l~~l~  504 (541)
                      +.++...+++|++|+|++|.|++.|+..++..+..+++|++|++++|+|++.|+..+.+.+++....+..+.
T Consensus       362 ~~~l~~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~l~~N~i~~~~~~~l~~~l~~~~~~L~~L~  433 (461)
T 1z7x_W          362 CQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLV  433 (461)
T ss_dssp             HHHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTSTTCCCCEEE
T ss_pred             HHHHcCCCCceEEEECCCCCCChhhHHHHHHHHHhCCCccEEECCCCCCCHHHHHHHHHHhccCCcchhhee
Confidence            998873488999999999999999999999999999999999999999999999999999998766665553
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 541
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-19
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-17
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-15
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-14
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-14
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-14
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-13
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-12
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-10
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-11
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-10
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-08
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-07
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 3e-11
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 4e-10
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 88.5 bits (217), Expect = 3e-19
 Identities = 40/150 (26%), Positives = 65/150 (43%)

Query: 325 QCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGALKECAP 384
               L+ L ++   F        S VL     L E+ +S   LED G   L   L +   
Sbjct: 310 PGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGS 369

Query: 385 SLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLI 444
            L VL LA  D++  + SSLAA +     L +L+L+ N L D G + + +S+ +    L 
Sbjct: 370 VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLE 429

Query: 445 EIDLSTNSMKRAGARLLAQVAVNKPGLKML 474
           ++ L            L  +  +KP L+++
Sbjct: 430 QLVLYDIYWSEEMEDRLQALEKDKPSLRVI 459
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query541
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.98
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.8
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.59
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.52
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.17
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-33  Score=291.13  Aligned_cols=370  Identities=22%  Similarity=0.279  Sum_probs=303.9

Q ss_pred             cCCcEEeccCCCcccccHHHHHHHhccccCCCCcceEEEeeCCCCCchHHHHHHHHHHHhccCccEEEcCCCcCCCchHH
Q 009168          121 ASQTVFDISGGQRGFIEEEEAKLLLGPLTEPGNSYTRICFSNKSFGLGASRVAAPILRLIKDQLTEVDLSDFIAGRPEEE  200 (541)
Q Consensus       121 ~~l~~ldls~~~~~~~~~~~~~~ll~~l~~~~~~l~~L~Ls~~~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~~~~~~~~  200 (541)
                      ++++.||+++++   +++.++..++..+    .++++|+|++|++++.++..++..+... ++|++|||++|.+++.+. 
T Consensus         2 ~~l~~ld~~~~~---i~~~~~~~l~~~l----~~l~~L~L~~~~i~~~~~~~l~~~L~~~-~~L~~LdLs~N~i~~~~~-   72 (460)
T d1z7xw1           2 LDIQSLDIQCEE---LSDARWAELLPLL----QQCQVVRLDDCGLTEARCKDISSALRVN-PALAELNLRSNELGDVGV-   72 (460)
T ss_dssp             EEEEEEEEESCC---CCHHHHHHHHHHH----TTCSEEEEESSCCCHHHHHHHHHHHHTC-TTCCEEECTTCCCHHHHH-
T ss_pred             CCCCEEEeeCCc---CChHHHHHHHHhC----CCCCEEEeCCCCCCHHHHHHHHHHHhcC-CCCCEEECcCCcCChHHH-
Confidence            468999999987   6678888888888    7889999999999999999999988775 489999999998876532 


Q ss_pred             HHHHHHHHHhhhc--CCCeeEEEcCCCCCChhHHHHHHHHhhcCCCccEEEecCCCCCHHHHHHHHHhc-----------
Q 009168          201 ALEVINMFSSALE--GSQLRYLNLSHNALGEKGVRAFGALLKSQNNLEELHLMNDGISEEAAQAILELI-----------  267 (541)
Q Consensus       201 ~l~~l~~~~~~l~--~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l-----------  267 (541)
                           ..++..+.  ..+|++|+|++|.+++.+...++..+..+++|++|+|++|.++..++..+...+           
T Consensus        73 -----~~l~~~l~~~~~~L~~L~L~~n~it~~~~~~l~~~l~~~~~L~~L~L~~N~i~~~~~~~l~~~l~~~~~~~~~~~  147 (460)
T d1z7xw1          73 -----HCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQ  147 (460)
T ss_dssp             -----HHHHHTTCSTTCCCCEEECTTSCCBGGGHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEE
T ss_pred             -----HHHHHHHhcCCCCCCEEECCCCCccccccccccchhhccccccccccccccchhhhhhhhhhccccccccccccc
Confidence                 23344443  357999999999999999999999999999999999999999887665554432           


Q ss_pred             ------------------CCCCCccEEEcCCCCCChHHH-----------------------------HHHHHHhhcCCC
Q 009168          268 ------------------PSTEKLKVLHFHNNMTGDEGA-----------------------------VAISEIVKHSPA  300 (541)
Q Consensus       268 ------------------~~~~~L~~L~Ls~n~l~~~~~-----------------------------~~l~~~l~~~~~  300 (541)
                                        ..+..++.++++++.+.+.+.                             ..+...+..++.
T Consensus       148 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~ls~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~  227 (460)
T d1z7xw1         148 LEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKAS  227 (460)
T ss_dssp             CTTSCCBGGGHHHHHHHHHHCTTCCEEECCSSBCHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHHHHHHCTT
T ss_pred             ccccccchhhhcccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhccccccccccc
Confidence                              223455666666555554443                             333344455566


Q ss_pred             ccEEEecCCCCChhHHHHHH-HHhhcCCCcCEEEccCCCCCchHHHHHHHhcccCCCCCEEEcccCCCChhHHHHHHHHH
Q 009168          301 LEDFRCSSTRIGAEGGIALA-KALGQCTHLKKLDLRDNMFGVEAGVALSEVLPAFPDLTEVYLSYLNLEDEGAEALAGAL  379 (541)
Q Consensus       301 L~~L~L~~n~i~~~~~~~l~-~~l~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~l~~~~~~~l~~~l  379 (541)
                      ++.++++.|.+...+..... ........++.|++++|.+.......+...+..++.++.+++++|.+++.++..++..+
T Consensus       228 ~~~l~~~~n~~~~~~~~~~~~~~~~~~~~l~~l~l~~n~i~~~~~~~~~~~l~~~~~l~~l~l~~n~i~~~~~~~l~~~l  307 (460)
T d1z7xw1         228 LRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETL  307 (460)
T ss_dssp             CCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHHCTTCCEEECTTCCCHHHHHHHHHHHH
T ss_pred             ccccchhhccccccccchhhcccccccccccccccccccccccccccccccccccccccccccccccccccccchhhccc
Confidence            77777777776655443322 23345678999999999998888777888888899999999999999999999998888


Q ss_pred             hhcCCCccEEEecCCCCCHHHHHHHHHHHhhCCCccEEEccCCCCChhHHHHHHHHhhhcCCCccEEEccCCCCChHHHH
Q 009168          380 KECAPSLEVLDLAGNDITAKAASSLAACIALKQFLTKLNLAENELQDEGAILIGKSLEEGHGQLIEIDLSTNSMKRAGAR  459 (541)
Q Consensus       380 ~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~g~~~l~~~l~~~~~~L~~L~Ls~n~i~~~~~~  459 (541)
                      ....+.|+.+++++|.++..+...++.++..+++|++|+|++|.|++.|+..+++++...++.|++|+|++|.|++.|+.
T Consensus       308 ~~~~~~L~~l~l~~~~l~~~~~~~l~~~~~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~L~Ls~n~i~~~~~~  387 (460)
T d1z7xw1         308 LEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCS  387 (460)
T ss_dssp             TSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHHHHH
T ss_pred             cccccccccccccccchhhhhhhhcccccccccchhhhheeeecccCcccchhhhhhhcccCCCCEEECCCCCCChHHHH
Confidence            77668999999999999999999999999999999999999999999999999999974578899999999999999999


Q ss_pred             HHHHHHhcCCCccEEEecCCCCChhHHHHHHHHHhcCccccccCC
Q 009168          460 LLAQVAVNKPGLKMLNINGNFIPDEGIDEVKEILKHSLDVLGPLD  504 (541)
Q Consensus       460 ~l~~~l~~~~~L~~L~L~~N~i~~~g~~~l~~~l~~~~~~l~~l~  504 (541)
                      +++..+..+++|++|+|++|+|+++|+..+.+.++++...+..+.
T Consensus       388 ~l~~~l~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~l~  432 (460)
T d1z7xw1         388 SLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLV  432 (460)
T ss_dssp             HHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTSTTCCCCEEE
T ss_pred             HHHHHHhcCCCCCEEECCCCcCCHHHHHHHHHHHHhCCCccCEEE
Confidence            999999999999999999999999999999999988776665553
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure