Citrus Sinensis ID: 009255


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MEGFGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSISKAVD
cccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHcc
ccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHc
megfgclpdnvTYNTILDALFKKGKLNEVRDLLSDmkkqglvpnrttyNILVSGYCKLGWLKEAMRVVDLMtqnkslpdvwtYNMLINGWCNAGMLEEAFRLRKEMESLkllpdvvtYNTLINRFFESGRSMEAFKLIDEldehgikpnavTHNIMIKWYCKEGKIDKACKIVRNmeengfspdcvtynTLIDANCKAGNMEEAFRMMDVMgrkglkmnTITLNTILHTLCCEKKLDEAYMLLNSAskrgyyldevSYGTLITGYFRDEKANRALKLWDEMkerqimpstfTYNAMIWGLSQSGKTEQAIDMLNELLqsgmipdettfnTIIHGFCSEGQVEKALQFHNKMveksfkpdivtCNILLSGLCREGILEKALKFFRSWIlkgkavdsVTYNTLISSLCKERRLEDAFGLLSEMEekklgpdrytYAAIHTALVESGRLEEAQKFTSIMVETGkinhqvvqpntsktpeeidpssisySEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSISKAVD
megfgclpdnvTYNTILDALFKKGKLNEVRDLLsdmkkqglvpnrttyniLVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLkllpdvvtYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGtlitgyfrdEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWIlkgkavdsvtyNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGkinhqvvqpntsktpeeidpSSISYSEKINEHCSQGRYKDALQIFEETRqkgiainkstymnlmnglikrrksiskavd
MEGFGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMntitlntilhtlCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSISKAVD
***FGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKI**********************************RYKDALQIFEETRQKGIAINKSTYMNLMNGLI***********
***FGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSISKAVD
MEGFGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVV***************ISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRR********
****GCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSI*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGFGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSISKAVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query539 2.2.26 [Sep-21-2011]
Q9ZVX5743 Pentatricopeptide repeat- yes no 0.909 0.659 0.545 1e-157
Q9FMF6730 Pentatricopeptide repeat- no no 0.847 0.626 0.318 7e-75
Q3EDF8598 Pentatricopeptide repeat- no no 0.784 0.707 0.342 1e-74
Q9LFC5729 Pentatricopeptide repeat- no no 0.901 0.666 0.299 8e-73
Q9FIX3747 Pentatricopeptide repeat- no no 0.914 0.659 0.292 1e-72
Q9FJE6907 Putative pentatricopeptid no no 0.929 0.552 0.309 5e-71
Q9LQ14629 Pentatricopeptide repeat- no no 0.935 0.801 0.299 7e-71
Q9LPX2644 Pentatricopeptide repeat- no no 0.959 0.802 0.300 8e-71
Q9LFF1754 Pentatricopeptide repeat- no no 0.857 0.612 0.311 5e-70
Q76C99 791 Protein Rf1, mitochondria N/A no 0.948 0.646 0.285 6e-70
>sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 Back     alignment and function desciption
 Score =  555 bits (1431), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/510 (54%), Positives = 377/510 (73%), Gaps = 20/510 (3%)

Query: 4   FGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKE 63
           F   PDNVTYNTIL A+ KKG+L+++++LL DMKK GLVPNR TYN LV GYCKLG LKE
Sbjct: 234 FKVNPDNVTYNTILKAMSKKGRLSDLKELLLDMKKNGLVPNRVTYNNLVYGYCKLGSLKE 293

Query: 64  AMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLIN 123
           A ++V+LM Q   LPD+ TYN+LING CNAG + E   L   M+SLKL PDVVTYNTLI+
Sbjct: 294 AFQIVELMKQTNVLPDLCTYNILINGLCNAGSMREGLELMDAMKSLKLQPDVVTYNTLID 353

Query: 124 RFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEE-NGFS 182
             FE G S+EA KL+++++  G+K N VTHNI +KW CKE K +   + V+ + + +GFS
Sbjct: 354 GCFELGLSLEARKLMEQMENDGVKANQVTHNISLKWLCKEEKREAVTRKVKELVDMHGFS 413

Query: 183 PDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYML 242
           PD VTY+TLI A  K G++  A  MM  MG+KG+KMNTITLNTIL  LC E+KLDEA+ L
Sbjct: 414 PDIVTYHTLIKAYLKVGDLSGALEMMREMGQKGIKMNTITLNTILDALCKERKLDEAHNL 473

Query: 243 LNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQ 302
           LNSA KRG+ +DEV+YGTLI G+FR+EK  +AL++WDEMK+ +I P+  T+N++I GL  
Sbjct: 474 LNSAHKRGFIVDEVTYGTLIMGFFREEKVEKALEMWDEMKKVKITPTVSTFNSLIGGLCH 533

Query: 303 SGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVT 362
            GKTE A++  +EL +SG++PD++TFN+II G+C EG+VEKA +F+N+ ++ SFKPD  T
Sbjct: 534 HGKTELAMEKFDELAESGLLPDDSTFNSIILGYCKEGRVEKAFEFYNESIKHSFKPDNYT 593

Query: 363 CNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEME 422
           CNILL+GLC+EG+ EKAL FF + I + + VD+VTYNT+IS+ CK+++L++A+ LLSEME
Sbjct: 594 CNILLNGLCKEGMTEKALNFFNTLI-EEREVDTVTYNTMISAFCKDKKLKEAYDLLSEME 652

Query: 423 EKKLGPDRYTYAAIHTALVESGRLEEA----QKFTS--------IMVETGKINHQVVQPN 470
           EK L PDR+TY +  + L+E G+L E     +KF+         + VET K       P 
Sbjct: 653 EKGLEPDRFTYNSFISLLMEDGKLSETDELLKKFSGKFGSMKRDLQVETEK------NPA 706

Query: 471 TSKTPEEIDPSSISYSEKINEHCSQGRYKD 500
           TS++ EE++  +I+YS+ I+E CS+GR K+
Sbjct: 707 TSESKEELNTEAIAYSDVIDELCSRGRLKE 736





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query539
147819144 778 hypothetical protein VITISV_021300 [Viti 0.994 0.688 0.690 0.0
359486541 778 PREDICTED: pentatricopeptide repeat-cont 0.994 0.688 0.688 0.0
255565812 784 pentatricopeptide repeat-containing prot 0.996 0.684 0.668 0.0
449451888 783 PREDICTED: pentatricopeptide repeat-cont 0.996 0.685 0.629 0.0
255585033605 pentatricopeptide repeat-containing prot 0.975 0.869 0.632 0.0
357443403 873 Pentatricopeptide repeat-containing prot 0.981 0.605 0.613 0.0
224109690 728 predicted protein [Populus trichocarpa] 0.927 0.686 0.644 0.0
357120446 787 PREDICTED: pentatricopeptide repeat-cont 0.998 0.683 0.491 1e-161
297836398 743 pentatricopeptide repeat-containing prot 0.920 0.667 0.557 1e-158
414865374 793 TPA: hypothetical protein ZEAMMB73_16802 0.998 0.678 0.501 1e-158
>gi|147819144|emb|CAN78081.1| hypothetical protein VITISV_021300 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/542 (69%), Positives = 448/542 (82%), Gaps = 6/542 (1%)

Query: 1   MEGFGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGW 60
           M  + C PDNVTYNTILDAL KKG+L + RDLL DMK +GL+PNR TYNILV GYCK+GW
Sbjct: 234 MGKYNCSPDNVTYNTILDALCKKGRLGDARDLLMDMKSRGLLPNRNTYNILVYGYCKMGW 293

Query: 61  LKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNT 120
           LKEA  V++LMTQN  LPDVWTYNMLING CN G +EEAF+LR EME+LKLLPDVV+YNT
Sbjct: 294 LKEAANVIELMTQNNLLPDVWTYNMLINGLCNEGRIEEAFKLRDEMENLKLLPDVVSYNT 353

Query: 121 LINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENG 180
           LIN   E  +  EAFKL++E+ E G+KPNAVTHNIM+KWYCKEGK+D A   +  MEE+G
Sbjct: 354 LINGCLEWSKISEAFKLLEEMSEKGVKPNAVTHNIMVKWYCKEGKMDDASNTITKMEESG 413

Query: 181 FSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAY 240
           FSPDCVTYNTLI+  CKAGNM EAFR MD MGRK +KM+++TLNTIL TLC EKKL+EAY
Sbjct: 414 FSPDCVTYNTLINGYCKAGNMGEAFRTMDEMGRKNMKMDSVTLNTILRTLCREKKLEEAY 473

Query: 241 MLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGL 300
            LL+SA KRGY++DEVSYGTLI GYF+D   +RALKLWDEMKE++I+PST TYN +I GL
Sbjct: 474 KLLSSARKRGYFIDEVSYGTLIVGYFKDGNVDRALKLWDEMKEKEIIPSTVTYNCIIGGL 533

Query: 301 SQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDI 360
            Q GKTEQAI  LNELL+SG++PDETT+NTI+HG+C EG VEKA QFHNKMVE SFKPD+
Sbjct: 534 CQCGKTEQAISKLNELLESGLLPDETTYNTILHGYCREGDVEKAFQFHNKMVENSFKPDV 593

Query: 361 VTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSE 420
            TCNILL GLC EG+LEKALK F +W+ KGKA+D+VTYNTLI+SLCKE RL+DAF LLSE
Sbjct: 594 FTCNILLRGLCMEGMLEKALKLFNTWVSKGKAIDTVTYNTLITSLCKEGRLDDAFNLLSE 653

Query: 421 MEEKKLGPDRYTYAAIHTALVESGRLEEAQKFTSIMVETGKINHQVVQPNTSKT------ 474
           MEEK+LGPD YTY AI TAL +SGR+ EA++F S M+E G +  QV+Q + ++T      
Sbjct: 654 MEEKELGPDHYTYNAIITALTDSGRIREAEEFMSKMLEKGXLPXQVLQLDXNETVVTSET 713

Query: 475 PEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIKRRKSI 534
            EE D SS++YSE I E C++G+YKDA++IF E++QKGI ++KSTY+NLM+GLIKRRKSI
Sbjct: 714 SEESDSSSVAYSEWIKELCTEGKYKDAMRIFGESKQKGITVDKSTYINLMDGLIKRRKSI 773

Query: 535 SK 536
           SK
Sbjct: 774 SK 775




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486541|ref|XP_002275423.2| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565812|ref|XP_002523895.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536825|gb|EEF38464.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449451888|ref|XP_004143692.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Cucumis sativus] gi|449529106|ref|XP_004171542.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255585033|ref|XP_002533225.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526957|gb|EEF29157.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357443403|ref|XP_003591979.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355481027|gb|AES62230.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224109690|ref|XP_002315278.1| predicted protein [Populus trichocarpa] gi|222864318|gb|EEF01449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357120446|ref|XP_003561938.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297836398|ref|XP_002886081.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331921|gb|EFH62340.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|414865374|tpg|DAA43931.1| TPA: hypothetical protein ZEAMMB73_168023 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query539
TAIR|locus:2039415743 AT2G16880 "AT2G16880" [Arabido 0.910 0.660 0.528 9.2e-139
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.840 0.757 0.309 4.2e-71
TAIR|locus:2173403730 AT5G64320 "AT5G64320" [Arabido 0.855 0.631 0.312 2.1e-68
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.972 0.701 0.296 7.2e-68
TAIR|locus:2168078907 AT5G59900 "AT5G59900" [Arabido 0.870 0.517 0.317 1.7e-67
TAIR|locus:1009023134644 AT1G12775 [Arabidopsis thalian 0.829 0.694 0.305 6.8e-67
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.853 0.610 0.306 1.2e-65
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.853 0.730 0.306 1.6e-65
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.823 0.705 0.308 9.9e-64
TAIR|locus:2015218590 AT1G63070 [Arabidopsis thalian 0.914 0.835 0.303 6.8e-65
TAIR|locus:2039415 AT2G16880 "AT2G16880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1358 (483.1 bits), Expect = 9.2e-139, P = 9.2e-139
 Identities = 265/501 (52%), Positives = 367/501 (73%)

Query:     8 PDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRV 67
             PDNVTYNTIL A+ KKG+L+++++LL DMKK GLVPNR TYN LV GYCKLG LKEA ++
Sbjct:   238 PDNVTYNTILKAMSKKGRLSDLKELLLDMKKNGLVPNRVTYNNLVYGYCKLGSLKEAFQI 297

Query:    68 VDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFE 127
             V+LM Q   LPD+ TYN+LING CNAG + E   L   M+SLKL PDVVTYNTLI+  FE
Sbjct:   298 VELMKQTNVLPDLCTYNILINGLCNAGSMREGLELMDAMKSLKLQPDVVTYNTLIDGCFE 357

Query:   128 SGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEE-NGFSPDCV 186
              G S+EA KL+++++  G+K N VTHNI +KW CKE K +   + V+ + + +GFSPD V
Sbjct:   358 LGLSLEARKLMEQMENDGVKANQVTHNISLKWLCKEEKREAVTRKVKELVDMHGFSPDIV 417

Query:   187 TYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMXXXXXXXXXXXXCCEKKLDEAYMLLNSA 246
             TY+TLI A  K G++  A  MM  MG+KG+KM            C E+KLDEA+ LLNSA
Sbjct:   418 TYHTLIKAYLKVGDLSGALEMMREMGQKGIKMNTITLNTILDALCKERKLDEAHNLLNSA 477

Query:   247 SKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKT 306
              KRG+ +DEV+YGTLI G+FR+EK  +AL++WDEMK+ +I P+  T+N++I GL   GKT
Sbjct:   478 HKRGFIVDEVTYGTLIMGFFREEKVEKALEMWDEMKKVKITPTVSTFNSLIGGLCHHGKT 537

Query:   307 EQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNIL 366
             E A++  +EL +SG++PD++TFN+II G+C EG+VEKA +F+N+ ++ SFKPD  TCNIL
Sbjct:   538 ELAMEKFDELAESGLLPDDSTFNSIILGYCKEGRVEKAFEFYNESIKHSFKPDNYTCNIL 597

Query:   367 LSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKL 426
             L+GLC+EG+ EKAL FF + +++ + VD+VTYNT+IS+ CK+++L++A+ LLSEMEEK L
Sbjct:   598 LNGLCKEGMTEKALNFFNT-LIEEREVDTVTYNTMISAFCKDKKLKEAYDLLSEMEEKGL 656

Query:   427 GPDRYTYAAIHTALVESGRLEEA----QKFTSIMVETGKINHQVV---QPNTSKTPEEID 479
              PDR+TY +  + L+E G+L E     +KF+     + K + QV     P TS++ EE++
Sbjct:   657 EPDRFTYNSFISLLMEDGKLSETDELLKKFSG-KFGSMKRDLQVETEKNPATSESKEELN 715

Query:   480 PSSISYSEKINEHCSQGRYKD 500
               +I+YS+ I+E CS+GR K+
Sbjct:   716 TEAIAYSDVIDELCSRGRLKE 736


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168078 AT5G59900 "AT5G59900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015218 AT1G63070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZVX5PP156_ARATHNo assigned EC number0.54500.90900.6594yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query539
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-32
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-30
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-28
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-24
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-22
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-20
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-17
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-14
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-12
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-10
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-08
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-06
pfam0153531 pfam01535, PPR, PPR repeat 3e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-06
pfam0153531 pfam01535, PPR, PPR repeat 5e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
pfam0153531 pfam01535, PPR, PPR repeat 0.003
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  130 bits (329), Expect = 7e-32
 Identities = 87/385 (22%), Positives = 177/385 (45%), Gaps = 45/385 (11%)

Query: 1   MEGFGCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGW 60
           ++  G   D   Y T++    K GK++ + ++  +M   G+  N  T+  L+ G  + G 
Sbjct: 463 VQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQ 522

Query: 61  LKEAMRVVDLMTQNKSLPDVWTYNMLINGWCNAGMLEEAFRLRKEM--ESLKLLPDVVTY 118
           + +A     +M      PD   +N LI+    +G ++ AF +  EM  E+  + PD +T 
Sbjct: 523 VAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITV 582

Query: 119 NTLIN---RFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRN 175
             L+       +  R+ E +++I    E+ IK     + I +    ++G  D A  I  +
Sbjct: 583 GALMKACANAGQVDRAKEVYQMI---HEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDD 639

Query: 176 MEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHTLCCEKK 235
           M++ G  PD V ++ L+D    AG++++AF ++    ++G+K+ T++ ++ L   C   K
Sbjct: 640 MKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSS-LMGACSNAK 698

Query: 236 LDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNA 295
                                                +AL+L++++K  ++ P+  T NA
Sbjct: 699 ----------------------------------NWKKALELYEDIKSIKLRPTVSTMNA 724

Query: 296 MIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKS 355
           +I  L +  +  +A+++L+E+ + G+ P+  T++ ++     +   +  L   ++  E  
Sbjct: 725 LITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDG 784

Query: 356 FKPDIVTCNILLSGLCREGILEKAL 380
            KP++V C   ++GLC     EKA 
Sbjct: 785 IKPNLVMCRC-ITGLCLRRF-EKAC 807


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 539
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.98
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.97
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.93
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.93
PRK14574 822 hmsH outer membrane protein; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.88
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.86
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.86
KOG1915677 consensus Cell cycle control protein (crooked neck 99.85
KOG2076 895 consensus RNA polymerase III transcription factor 99.85
KOG2003 840 consensus TPR repeat-containing protein [General f 99.84
KOG2003 840 consensus TPR repeat-containing protein [General f 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.84
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.82
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.81
KOG2076 895 consensus RNA polymerase III transcription factor 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.78
KOG0547606 consensus Translocase of outer mitochondrial membr 99.77
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
KOG0547606 consensus Translocase of outer mitochondrial membr 99.73
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
KOG1126638 consensus DNA-binding cell division cycle control 99.71
KOG1126638 consensus DNA-binding cell division cycle control 99.71
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.7
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.69
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.69
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.68
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.68
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.68
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.67
KOG1129478 consensus TPR repeat-containing protein [General f 99.64
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.6
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.6
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.59
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.59
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.58
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.58
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.55
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.53
PRK12370553 invasion protein regulator; Provisional 99.52
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.52
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.51
PRK12370553 invasion protein regulator; Provisional 99.5
KOG1129478 consensus TPR repeat-containing protein [General f 99.5
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.5
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.49
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.47
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.45
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.45
PRK11189296 lipoprotein NlpI; Provisional 99.44
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.44
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.43
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.39
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.36
PRK11189296 lipoprotein NlpI; Provisional 99.34
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.3
PF1304150 PPR_2: PPR repeat family 99.26
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.26
KOG1125579 consensus TPR repeat-containing protein [General f 99.25
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.24
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.23
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.21
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.2
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.2
PF1304150 PPR_2: PPR repeat family 99.2
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.2
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.2
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.18
PRK04841 903 transcriptional regulator MalT; Provisional 99.14
KOG1125579 consensus TPR repeat-containing protein [General f 99.13
PRK04841903 transcriptional regulator MalT; Provisional 99.12
PRK15359144 type III secretion system chaperone protein SscB; 99.12
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.12
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.1
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.09
KOG1914656 consensus mRNA cleavage and polyadenylation factor 99.08
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.07
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.05
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.04
PRK10370198 formate-dependent nitrite reductase complex subuni 99.04
PLN02789320 farnesyltranstransferase 99.03
PLN02789320 farnesyltranstransferase 98.98
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.97
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.92
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.9
KOG1128777 consensus Uncharacterized conserved protein, conta 98.89
PRK15359144 type III secretion system chaperone protein SscB; 98.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.88
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.87
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.85
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.85
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.84
PRK10370198 formate-dependent nitrite reductase complex subuni 98.83
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.81
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.73
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.73
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.72
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.72
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.71
PF1285434 PPR_1: PPR repeat 98.71
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.68
KOG0553304 consensus TPR repeat-containing protein [General f 98.66
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.65
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.61
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.61
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.61
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.61
PF1285434 PPR_1: PPR repeat 98.56
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.5
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.48
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.47
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.46
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.36
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.32
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.32
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.31
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.29
PF12688120 TPR_5: Tetratrico peptide repeat 98.28
COG4700251 Uncharacterized protein conserved in bacteria cont 98.28
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.24
COG4700251 Uncharacterized protein conserved in bacteria cont 98.23
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.23
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.23
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.23
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.23
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.2
KOG0553304 consensus TPR repeat-containing protein [General f 98.19
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.18
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.16
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.15
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.12
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.09
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.08
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.06
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.05
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.05
KOG20411189 consensus WD40 repeat protein [General function pr 98.04
PRK10803263 tol-pal system protein YbgF; Provisional 98.03
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.02
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.02
PF1337173 TPR_9: Tetratricopeptide repeat 98.01
PF12688120 TPR_5: Tetratrico peptide repeat 97.99
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.97
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.95
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.95
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.95
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.94
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.93
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.92
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.91
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.89
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.84
PRK15331165 chaperone protein SicA; Provisional 97.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.83
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.82
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.82
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.82
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.73
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.7
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.68
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.67
KOG20411189 consensus WD40 repeat protein [General function pr 97.66
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.65
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.65
PRK10803263 tol-pal system protein YbgF; Provisional 97.65
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.63
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.61
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.6
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.59
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.59
COG3898531 Uncharacterized membrane-bound protein [Function u 97.57
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.57
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.54
PF13512142 TPR_18: Tetratricopeptide repeat 97.52
PRK15331165 chaperone protein SicA; Provisional 97.5
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.47
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.44
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.41
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.38
KOG1258577 consensus mRNA processing protein [RNA processing 97.37
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.37
KOG4555175 consensus TPR repeat-containing protein [Function 97.36
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.35
PRK11906458 transcriptional regulator; Provisional 97.34
PF1337173 TPR_9: Tetratricopeptide repeat 97.29
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.25
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.15
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.14
KOG4555175 consensus TPR repeat-containing protein [Function 97.11
PF1342844 TPR_14: Tetratricopeptide repeat 97.09
KOG1258577 consensus mRNA processing protein [RNA processing 97.07
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.07
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.98
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.94
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.93
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.91
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.89
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.87
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.81
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.77
PRK11906458 transcriptional regulator; Provisional 96.75
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.71
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.71
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.69
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.68
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.66
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.64
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.63
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 96.57
PF1342844 TPR_14: Tetratricopeptide repeat 96.52
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.51
PF13512142 TPR_18: Tetratricopeptide repeat 96.5
KOG1585308 consensus Protein required for fusion of vesicles 96.39
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.38
PF1343134 TPR_17: Tetratricopeptide repeat 96.37
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.36
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.34
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.27
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.18
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.16
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.14
KOG4234271 consensus TPR repeat-containing protein [General f 96.14
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.09
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.0
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.91
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.81
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.79
KOG4648 536 consensus Uncharacterized conserved protein, conta 95.78
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.76
smart00299140 CLH Clathrin heavy chain repeat homology. 95.74
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.72
smart00299140 CLH Clathrin heavy chain repeat homology. 95.7
KOG1585308 consensus Protein required for fusion of vesicles 95.67
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.63
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.6
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.47
COG3629280 DnrI DNA-binding transcriptional activator of the 95.33
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.32
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.31
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.28
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.18
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.08
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.01
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.0
KOG3941406 consensus Intermediate in Toll signal transduction 94.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.92
COG3629280 DnrI DNA-binding transcriptional activator of the 94.72
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.71
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.61
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.59
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.57
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.45
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.44
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.34
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.32
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.28
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 94.18
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.13
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.09
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.98
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.86
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.82
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 93.73
COG1747 711 Uncharacterized N-terminal domain of the transcrip 93.73
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 93.7
KOG3941406 consensus Intermediate in Toll signal transduction 93.64
KOG4234271 consensus TPR repeat-containing protein [General f 93.4
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.3
PF1343134 TPR_17: Tetratricopeptide repeat 93.29
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.27
KOG3364149 consensus Membrane protein involved in organellar 93.15
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.13
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 92.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.84
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.73
PF13929292 mRNA_stabil: mRNA stabilisation 92.69
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.64
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.57
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.5
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.45
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.05
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.05
KOG1586288 consensus Protein required for fusion of vesicles 91.88
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.85
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.77
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 91.75
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 91.68
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.64
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.64
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.6
COG3947361 Response regulator containing CheY-like receiver a 91.43
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.2
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 90.87
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.78
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 90.7
KOG1586288 consensus Protein required for fusion of vesicles 90.57
KOG2471 696 consensus TPR repeat-containing protein [General f 90.54
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.51
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.5
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 90.43
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.34
KOG2471 696 consensus TPR repeat-containing protein [General f 90.01
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.97
KOG4570418 consensus Uncharacterized conserved protein [Funct 89.69
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.62
KOG4648 536 consensus Uncharacterized conserved protein, conta 89.42
KOG1550552 consensus Extracellular protein SEL-1 and related 89.41
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.32
KOG1550552 consensus Extracellular protein SEL-1 and related 89.24
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.16
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.05
COG4455 273 ImpE Protein of avirulence locus involved in tempe 88.92
PRK10941269 hypothetical protein; Provisional 88.78
COG4455273 ImpE Protein of avirulence locus involved in tempe 88.74
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.41
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 88.16
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 88.02
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.81
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.79
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.64
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 87.34
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 87.33
KOG4507 886 consensus Uncharacterized conserved protein, conta 87.24
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 86.95
PF13929292 mRNA_stabil: mRNA stabilisation 86.95
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.07
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 85.87
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.76
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.03
COG3947361 Response regulator containing CheY-like receiver a 84.44
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.2
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.14
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 84.05
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 83.54
PF1286294 Apc5: Anaphase-promoting complex subunit 5 83.04
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 82.91
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 82.82
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 82.35
PRK09687280 putative lyase; Provisional 82.11
PF13762145 MNE1: Mitochondrial splicing apparatus component 81.71
KOG4507 886 consensus Uncharacterized conserved protein, conta 80.85
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-67  Score=525.38  Aligned_cols=503  Identities=20%  Similarity=0.313  Sum_probs=476.8

Q ss_pred             CCCcChhhHHHHHHHHHhcCChHHHHHHHHHHHhCCC-CCCHHHHHHHHHHHHccCCHhHHHHHHHHHHhCCCCCChhhH
Q 009255            5 GCLPDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGL-VPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTY   83 (539)
Q Consensus         5 g~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~   83 (539)
                      ...++...|..++..|.+.|++++|.++|++|...|+ +++..++..++..|.+.|.+++|..+|+.|..    |+..+|
T Consensus       365 ~~~~~~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~----pd~~Ty  440 (1060)
T PLN03218        365 SGKRKSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRN----PTLSTF  440 (1060)
T ss_pred             CCCCCchHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCC----CCHHHH
Confidence            4566788899999999999999999999999999985 56777888999999999999999999999874    899999


Q ss_pred             HHHHHHHHhcCChHHHHHHHHHHHhCCCCCChhhHHHHHHHHhccCCHhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhc
Q 009255           84 NMLINGWCNAGMLEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKE  163 (539)
Q Consensus        84 ~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  163 (539)
                      +.++.+|++.|+++.|.++|++|.+.|+.||..+|+.++.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|++.
T Consensus       441 n~LL~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~  520 (1060)
T PLN03218        441 NMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARA  520 (1060)
T ss_pred             HHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHhHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHhh--CCCCCCHHhHHHHHHHHhccCCHHHHHH
Q 009255          164 GKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGR--KGLKMNTITLNTILHTLCCEKKLDEAYM  241 (539)
Q Consensus       164 g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~~~~l~~~~~~~~~~~~a~~  241 (539)
                      |++++|.++|+.|.+.|+.||..+|+.++.+|++.|++++|.++|++|..  .|+.||..+|+.++.+|++.|++++|.+
T Consensus       521 G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~e  600 (1060)
T PLN03218        521 GQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKE  600 (1060)
T ss_pred             cCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999976  6789999999999999999999999999


Q ss_pred             HHHHHhhcCCccCHhhHHHHHHHHHccCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHHcCCCHHHHHHHHHHHHHCCC
Q 009255          242 LLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGM  321 (539)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~  321 (539)
                      +|+.+.+.++.|+..+|+.++.+|++.|++++|.++|++|...|+.||..+|+.++.+|.+.|+.++|.+++++|.+.|+
T Consensus       601 lf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~  680 (1060)
T PLN03218        601 VYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGI  680 (1060)
T ss_pred             HHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHhHHHHHHHHhcCCCHHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCChhhHHHH
Q 009255          322 IPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTL  401 (539)
Q Consensus       322 ~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l  401 (539)
                      .|+..+|+.++.+|++.|++++|.++|++|.+.++.|+..+|+.++.+|++.|++++|.++|++|...|..||..+|+.+
T Consensus       681 ~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sL  760 (1060)
T PLN03218        681 KLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSIL  760 (1060)
T ss_pred             CCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHccCChHHHHHHHHHHHhCCCCCCHhhHHHHHHHHHh----c-------------------CCHHHHHHHHHHHHH
Q 009255          402 ISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVE----S-------------------GRLEEAQKFTSIMVE  458 (539)
Q Consensus       402 ~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~----~-------------------g~~~~A~~~~~~~~~  458 (539)
                      +.+|++.|++++|.+++.+|.+.|+.||..+|..++..|.+    .                   +..++|..+|++|++
T Consensus       761 L~a~~k~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~lf~eM~~  840 (1060)
T PLN03218        761 LVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETIS  840 (1060)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998866432    1                   224679999999999


Q ss_pred             cCCCCcccccCCCCCCCCCCCCChhhHHHHHHHHhhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHH
Q 009255          459 TGKINHQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLI  528 (539)
Q Consensus       459 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~~l~~~~  528 (539)
                      .+..                 |+..+|..++.+++..+..+.+..+++.+...+..|+..+|..++.++.
T Consensus       841 ~Gi~-----------------Pd~~T~~~vL~cl~~~~~~~~~~~m~~~m~~~~~~~~~~~y~~Li~g~~  893 (1060)
T PLN03218        841 AGTL-----------------PTMEVLSQVLGCLQLPHDATLRNRLIENLGISADSQKQSNLSTLVDGFG  893 (1060)
T ss_pred             CCCC-----------------CCHHHHHHHHHHhcccccHHHHHHHHHHhccCCCCcchhhhHHHHHhhc
Confidence            8865                 9999999999888888999999999998887778888999999998873



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query539
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 84.5 bits (207), Expect = 3e-17
 Identities = 25/199 (12%), Positives = 64/199 (32%), Gaps = 4/199 (2%)

Query: 96  LEEAFRLRKEMESLKLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIK---PNAVT 152
           L+       +    +L                + +   A  L+        K        
Sbjct: 108 LDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDM 167

Query: 153 HNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEAF-RMMDVM 211
           +N ++  + ++G   +   ++  +++ G +PD ++Y   +    +         R ++ M
Sbjct: 168 YNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQM 227

Query: 212 GRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKA 271
            ++GLK+  +    +L        L   + +  + S        V+   L+   +  +  
Sbjct: 228 SQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGR 287

Query: 272 NRALKLWDEMKERQIMPST 290
               KL   +K  Q +   
Sbjct: 288 VSYPKLHLPLKTLQCLFEK 306


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query539
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.92
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.92
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.89
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.82
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.79
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.78
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.78
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.77
3u4t_A272 TPR repeat-containing protein; structural genomics 99.77
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.76
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.74
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.73
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.72
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.71
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.71
3u4t_A272 TPR repeat-containing protein; structural genomics 99.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.7
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.69
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.67
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.67
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.66
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.65
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.64
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.61
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.61
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.61
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.6
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.58
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.57
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.57
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.55
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.54
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.52
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.51
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.49
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.49
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.48
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.46
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.46
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.39
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.37
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.37
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.33
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.32
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.31
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.3
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.3
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.3
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.29
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.28
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.27
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.26
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.25
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.25
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.25
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.25
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.24
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.24
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.23
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.23
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.16
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.14
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.13
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.12
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.11
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.1
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.1
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.09
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.08
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.02
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.02
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.0
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.0
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.98
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.97
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.96
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.95
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.95
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.95
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.94
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.94
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.93
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.92
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.92
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.92
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.91
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.9
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.9
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.9
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.89
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.88
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.88
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.88
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.86
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.86
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.86
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.85
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.85
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.83
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.82
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.82
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.81
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.81
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.81
3k9i_A117 BH0479 protein; putative protein binding protein, 98.79
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.77
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.77
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.75
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.72
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.72
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.71
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.7
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.66
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.66
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.65
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.64
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.64
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.64
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.63
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.62
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.62
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.62
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.61
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.55
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.51
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.5
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.5
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.47
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.47
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.46
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.46
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.46
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.42
3k9i_A117 BH0479 protein; putative protein binding protein, 98.38
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.38
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.26
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.25
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.25
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.24
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.18
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.17
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.14
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.1
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.96
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.94
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.9
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.88
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.81
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.78
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.76
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.64
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.63
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.58
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.56
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.26
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.26
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.15
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.11
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.03
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.01
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.95
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.89
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.71
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.69
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.58
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.45
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.4
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.22
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.09
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.08
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.07
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.9
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.62
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.61
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.5
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.3
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.2
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.03
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 94.2
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 93.61
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.53
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.85
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.59
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.5
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.06
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.67
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.64
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.47
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 91.26
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 90.66
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.11
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.87
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 89.37
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.7
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.5
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.27
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.01
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 86.0
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 84.27
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.08
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 83.91
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 81.56
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1e-43  Score=352.72  Aligned_cols=490  Identities=10%  Similarity=-0.013  Sum_probs=397.4

Q ss_pred             cChhhHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCCHhHHHHHHHHHHhCCCCCChhhHHHHH
Q 009255            8 PDNVTYNTILDALFKKGKLNEVRDLLSDMKKQGLVPNRTTYNILVSGYCKLGWLKEAMRVVDLMTQNKSLPDVWTYNMLI   87 (539)
Q Consensus         8 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~   87 (539)
                      ++...|+.++..|.+.|++++|..+|+++...  .|+..++..++.+|.+.|++++|..+|+.+...  +++..+++.++
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~  157 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACRYLAA  157 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHHHHHH
Confidence            46677888888888888888888888888754  456777788888888888888888888877543  45777888888


Q ss_pred             HHHHhcCChHHHHHHHHHHHhC---------------CCCCChhhHHHHHHHHhccCCHhHHHHHHHHHHhCCCCCCHHH
Q 009255           88 NGWCNAGMLEEAFRLRKEMESL---------------KLLPDVVTYNTLINRFFESGRSMEAFKLIDELDEHGIKPNAVT  152 (539)
Q Consensus        88 ~~~~~~g~~~~a~~~~~~~~~~---------------~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~  152 (539)
                      .+|.+.|++++|.++|+++...               +.+++..+|+.++.+|.+.|++++|+++|+++.+.+.. +...
T Consensus       158 ~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~  236 (597)
T 2xpi_A          158 FCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEA  236 (597)
T ss_dssp             HHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHH
T ss_pred             HHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHH
Confidence            8888888888888888753211               11234677888888888888888888888888775322 4455


Q ss_pred             HHHHHHHHHhcCCHhHHH--HH-HHHHHHcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCCCHHhHHHHHHH
Q 009255          153 HNIMIKWYCKEGKIDKAC--KI-VRNMEENGFSPDCVTYNTLIDANCKAGNMEEAFRMMDVMGRKGLKMNTITLNTILHT  229 (539)
Q Consensus       153 ~~~l~~~~~~~g~~~~a~--~~-~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~  229 (539)
                      +..+...+...+..+.+.  .+ +..+...+..+...+|+.++..|.+.|++++|.++|+++.+.  +++..++..++..
T Consensus       237 ~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~  314 (597)
T 2xpi_A          237 FDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADT  314 (597)
T ss_dssp             HHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHH
T ss_pred             HHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHH
Confidence            555554443332222111  11 333333333334445666677888999999999999998775  5799999999999


Q ss_pred             HhccCCHHHHHHHHHHHhhcCCccCHhhHHHHHHHHHccCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHHcCCCHHHH
Q 009255          230 LCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKERQIMPSTFTYNAMIWGLSQSGKTEQA  309 (539)
Q Consensus       230 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a  309 (539)
                      +.+.|++++|..+|+++.+.+.. +..++..++.++...|++++|..+++++....+ .+..++..++..|.+.|++++|
T Consensus       315 ~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A  392 (597)
T 2xpi_A          315 LFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRHP-EKAVTWLAVGIYYLCVNKISEA  392 (597)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCT-TSHHHHHHHHHHHHHTTCHHHH
T ss_pred             HHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCc-ccHHHHHHHHHHHHHhccHHHH
Confidence            99999999999999999987643 778899999999999999999999999987654 3788999999999999999999


Q ss_pred             HHHHHHHHHCCCCCCHHhHHHHHHHHhcCCCHHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhcCCHHHHHHHHHHHHHc
Q 009255          310 IDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCNILLSGLCREGILEKALKFFRSWILK  389 (539)
Q Consensus       310 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  389 (539)
                      .++|+++.+..+ .+..++..++.++.+.|++++|.++|+++.+.+ +.+..++..++.+|.+.|++++|.++|+++.+.
T Consensus       393 ~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  470 (597)
T 2xpi_A          393 RRYFSKSSTMDP-QFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL  470 (597)
T ss_dssp             HHHHHHHHHHCT-TCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Confidence            999999988643 367899999999999999999999999999875 457889999999999999999999999999987


Q ss_pred             CCCCChhhHHHHHHHHHccCChHHHHHHHHHHHhC----CCCCC--HhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCC
Q 009255          390 GKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEK----KLGPD--RYTYAAIHTALVESGRLEEAQKFTSIMVETGKIN  463 (539)
Q Consensus       390 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~----~~~~~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~  463 (539)
                      .+ .++.+|+.++.+|.+.|++++|+++|+++.+.    +..|+  ..++..++.+|.+.|++++|.++++++++.+   
T Consensus       471 ~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~---  546 (597)
T 2xpi_A          471 FQ-YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS---  546 (597)
T ss_dssp             CC-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS---
T ss_pred             CC-CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC---
Confidence            43 37889999999999999999999999999875    55777  7899999999999999999999999999987   


Q ss_pred             cccccCCCCCCCCCCCCChhhHHHHHHHHhhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHh
Q 009255          464 HQVVQPNTSKTPEEIDPSSISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNLMNGLIK  529 (539)
Q Consensus       464 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~~l~~~~~  529 (539)
                                     +.+..+|..++.+|...|++++|.+.|+++++  +.|+.......++.++.
T Consensus       547 ---------------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~--~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          547 ---------------TNDANVHTAIALVYLHKKIPGLAITHLHESLA--ISPNEIMASDLLKRALE  595 (597)
T ss_dssp             ---------------SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HCTTCHHHHHHHHHTTC
T ss_pred             ---------------CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHh--cCCCChHHHHHHHHHHh
Confidence                           44667999999999999999999999999998  57888777776665553



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query539
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.73
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.71
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.44
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.42
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.4
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.34
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.33
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.29
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.24
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.23
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.04
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.98
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.88
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.85
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.84
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.84
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.84
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.83
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.81
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.8
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.74
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.74
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.71
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.65
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.6
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.59
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.53
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.52
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.42
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.4
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.36
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.36
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.29
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.26
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.21
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.21
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.89
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.89
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.73
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.27
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.2
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.12
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.31
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.78
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.75
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.12
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.99
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.77
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.61
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=8.9e-25  Score=202.10  Aligned_cols=376  Identities=13%  Similarity=0.050  Sum_probs=204.8

Q ss_pred             HhccCCHhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHhHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCCHHHH
Q 009255          125 FFESGRSMEAFKLIDELDEHGIKPNAVTHNIMIKWYCKEGKIDKACKIVRNMEENGFSPDCVTYNTLIDANCKAGNMEEA  204 (539)
Q Consensus       125 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a  204 (539)
                      +.+.|++++|++.++++.+.. +-++..+..+..+|.+.|++++|...++++.+.. +.+..++..+..++...|++++|
T Consensus         9 ~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A   86 (388)
T d1w3ba_           9 EYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcccccc
Confidence            333444444444444443321 1133344444444444444444444444444332 22233444444444444444444


Q ss_pred             HHHHHHHhhCCCCCCHHhHHHHHHHHhccCCHHHHHHHHHHHhhcCCccCHhhHHHHHHHHHccCCHHHHHHHHHHHHHc
Q 009255          205 FRMMDVMGRKGLKMNTITLNTILHTLCCEKKLDEAYMLLNSASKRGYYLDEVSYGTLITGYFRDEKANRALKLWDEMKER  284 (539)
Q Consensus       205 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~  284 (539)
                      +..+......... +..............+....+............. ...............+....+...+......
T Consensus        87 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (388)
T d1w3ba_          87 IEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-LYCVRSDLGNLLKALGRLEEAKACYLKAIET  164 (388)
T ss_dssp             HHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-CTHHHHHHHHHHHTTSCHHHHHHHHHHHHHH
T ss_pred             ccccccccccccc-cccccccccccccccccccccccccccccccccc-cccccccccccccccchhhhhHHHHHHhhcc
Confidence            4444444433211 2222222222222223333333222222222111 2233333444444555555555555555544


Q ss_pred             CCCCCHhhHHHHHHHHHcCCCHHHHHHHHHHHHHCCCCCCHHhHHHHHHHHhcCCCHHHHHHHHHHHHhCCCCCCHHhHH
Q 009255          285 QIMPSTFTYNAMIWGLSQSGKTEQAIDMLNELLQSGMIPDETTFNTIIHGFCSEGQVEKALQFHNKMVEKSFKPDIVTCN  364 (539)
Q Consensus       285 ~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  364 (539)
                      .+. +...+..+...+...|+++.|...+++.....+. +...+..+...+...|++++|...++...... +.+...+.
T Consensus       165 ~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~  241 (388)
T d1w3ba_         165 QPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHG  241 (388)
T ss_dssp             CTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             Ccc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHH
Confidence            332 4555666666666677777777777666654322 45566666666777777777777777666653 33555666


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHHHHcCCCCChhhHHHHHHHHHccCChHHHHHHHHHHHhCCCCCCHhhHHHHHHHHHhcC
Q 009255          365 ILLSGLCREGILEKALKFFRSWILKGKAVDSVTYNTLISSLCKERRLEDAFGLLSEMEEKKLGPDRYTYAAIHTALVESG  444 (539)
Q Consensus       365 ~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g  444 (539)
                      .+..++.+.|++++|...|+++.+..+ .++.++..++.++...|++++|+..++.+.... +.+...+..++.++...|
T Consensus       242 ~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~  319 (388)
T d1w3ba_         242 NLACVYYEQGLIDLAIDTYRRAIELQP-HFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQG  319 (388)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHTCS-SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCC
Confidence            667777777777777777777766532 255567777777777777777777777766542 445566667777777777


Q ss_pred             CHHHHHHHHHHHHHcCCCCcccccCCCCCCCCCCCCCh-hhHHHHHHHHhhcCCHHHHHHHHHHHHHcCCCCCHHHHHHH
Q 009255          445 RLEEAQKFTSIMVETGKINHQVVQPNTSKTPEEIDPSS-ISYSEKINEHCSQGRYKDALQIFEETRQKGIAINKSTYMNL  523 (539)
Q Consensus       445 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~~  523 (539)
                      ++++|++.++++++..                   |+. .+|..++.+|...|++++|+..|+++++  +.|+.......
T Consensus       320 ~~~~A~~~~~~al~~~-------------------p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~  378 (388)
T d1w3ba_         320 NIEEAVRLYRKALEVF-------------------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSN  378 (388)
T ss_dssp             CHHHHHHHHHHHTTSC-------------------TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHH
T ss_pred             CHHHHHHHHHHHHHhC-------------------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHH
Confidence            7777777777777665                   433 3677777777777777777777777775  56765544444


Q ss_pred             HHHHHhc
Q 009255          524 MNGLIKR  530 (539)
Q Consensus       524 l~~~~~~  530 (539)
                      ++.++..
T Consensus       379 lg~~~~~  385 (388)
T d1w3ba_         379 MGNTLKE  385 (388)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            4444443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure