Citrus Sinensis ID: 009257
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 539 | ||||||
| 359493253 | 565 | PREDICTED: uncharacterized protein LOC10 | 0.988 | 0.943 | 0.685 | 0.0 | |
| 296081014 | 529 | unnamed protein product [Vitis vinifera] | 0.879 | 0.896 | 0.745 | 0.0 | |
| 449447785 | 595 | PREDICTED: uncharacterized protein LOC10 | 0.988 | 0.895 | 0.636 | 0.0 | |
| 449517957 | 595 | PREDICTED: uncharacterized LOC101210433 | 0.988 | 0.895 | 0.635 | 0.0 | |
| 255571738 | 592 | ATP binding protein, putative [Ricinus c | 0.990 | 0.902 | 0.636 | 0.0 | |
| 356507706 | 546 | PREDICTED: uncharacterized protein LOC10 | 0.779 | 0.769 | 0.781 | 0.0 | |
| 356515424 | 544 | PREDICTED: uncharacterized protein LOC10 | 0.797 | 0.790 | 0.767 | 0.0 | |
| 297841951 | 586 | deoxynucleoside kinase family [Arabidops | 0.875 | 0.805 | 0.679 | 0.0 | |
| 22330580 | 580 | P-loop containing nucleoside triphosphat | 0.771 | 0.717 | 0.763 | 0.0 | |
| 357455479 | 583 | Deoxycytidine kinase [Medicago truncatul | 0.743 | 0.687 | 0.795 | 0.0 |
| >gi|359493253|ref|XP_002272639.2| PREDICTED: uncharacterized protein LOC100233118 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 743 bits (1918), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 391/570 (68%), Positives = 446/570 (78%), Gaps = 37/570 (6%)
Query: 1 MQKLMRLNPK-GPLLCSCNP---SFSSFTFNPRRLIMHSTAAGTPSFSTDAFAALA---- 52
MQKL R GP+L + S S PR+L M +TA +F + LA
Sbjct: 1 MQKLFRRTASSGPILFTSGKPPLSLHSLPLPPRQLAMPATAT---AFHGGGLSNLASSWS 57
Query: 53 -RKS-TLSAGF------YARCSLKMPPPPR-SWVVMREGRAWFHTAACEGVK-------A 96
RKS +++A F RCS++ R +W R AWF + +G +
Sbjct: 58 TRKSISVAAAFGGGNCRICRCSIEGGAGVRLAWGRTRG--AWFRAGSEDGFTVKTVEKGS 115
Query: 97 AGSESQKEKSEDKTSSS--VKVSRRRGGGAGTAPGLVG-NPDLLTIPGVGPRNLRKLVDN 153
G + E+ +K S +++ RR+ G + G V N DLLTIPGVGPRNLRKLVD
Sbjct: 116 GGCSVEDEEDGEKGSDEKPLRLQRRQRGSSSLNSGAVAANVDLLTIPGVGPRNLRKLVDK 175
Query: 154 GIGDVAELKQLYKDKFW-EASQKMIEYLQSSVGIIHKNHAESITTFIKDSVDEELKD-SN 211
GIG VAELKQLYKDKF+ E+SQKM+E+L+SSVGIIH+NHAESITTFIK+SVDEELKD S+
Sbjct: 176 GIGGVAELKQLYKDKFFGESSQKMVEFLRSSVGIIHRNHAESITTFIKESVDEELKDNSD 235
Query: 212 SDDKPAPKKRITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVGPDHFN 271
SD KP KKR+TFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPI+KWQDVGPDHFN
Sbjct: 236 SDAKPTQKKRLTFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPINKWQDVGPDHFN 295
Query: 272 ILGAYYDAPERYAYTFQNYVFVTRVMQERESSGGIKPLRLMERSVFSDRMVFVRAVHEAK 331
IL A+Y P+RYAYTFQNYVFVTRVMQERESSGG+KPLRLMERSVFSDRMVFVRAVHEA
Sbjct: 296 ILDAFYAEPQRYAYTFQNYVFVTRVMQERESSGGVKPLRLMERSVFSDRMVFVRAVHEAN 355
Query: 332 YMNEMEISIYDSWFDPVVSVLPGLIPDGFIYLRASPDTCHKRMMLRKRAEEGGVSLDYLR 391
+MNEMEISIYDSWFDPVVS LPGLIPDGFIYLRA+PDTCHKRM LRKR EEGGVSL+YLR
Sbjct: 356 WMNEMEISIYDSWFDPVVSCLPGLIPDGFIYLRATPDTCHKRMKLRKRNEEGGVSLEYLR 415
Query: 392 SLHEKHENWLFPFESGNHGVLAVSKLPLHIDNGLHPDIRDRVFYLDGPHMHSSIQKVPAL 451
LHEKHE+WLFPF+SGNHGVL+V++LP ID+ LHPDIRDRVFYL+G HMHSSIQKVPAL
Sbjct: 416 DLHEKHESWLFPFQSGNHGVLSVNQLPFGIDSSLHPDIRDRVFYLEGDHMHSSIQKVPAL 475
Query: 452 VLDCEPNIDFSRDIDLKRQYARQVAEFFEFVKKKKED---QSAEECAATSNQAKVLLPHK 508
VLDCEPNIDFS+DI+ K+QYARQVAEFFEFVKKKKE +++EE AA S+QA VLLPHK
Sbjct: 476 VLDCEPNIDFSKDIEAKQQYARQVAEFFEFVKKKKEVPSLKASEEAAAKSSQAHVLLPHK 535
Query: 509 GGFWLPDGKHFPESALKSLDLRRAMSVMSG 538
GG W+PDGKHFPESALKSLD RRAMS +SG
Sbjct: 536 GGLWVPDGKHFPESALKSLDFRRAMSFLSG 565
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296081014|emb|CBI18518.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449447785|ref|XP_004141648.1| PREDICTED: uncharacterized protein LOC101210433 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449517957|ref|XP_004166010.1| PREDICTED: uncharacterized LOC101210433 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255571738|ref|XP_002526812.1| ATP binding protein, putative [Ricinus communis] gi|223533816|gb|EEF35547.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356507706|ref|XP_003522605.1| PREDICTED: uncharacterized protein LOC100799545 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356515424|ref|XP_003526400.1| PREDICTED: uncharacterized protein LOC100789564 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297841951|ref|XP_002888857.1| deoxynucleoside kinase family [Arabidopsis lyrata subsp. lyrata] gi|297334698|gb|EFH65116.1| deoxynucleoside kinase family [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|22330580|ref|NP_565032.2| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|63003832|gb|AAY25445.1| At1g72040 [Arabidopsis thaliana] gi|110737520|dbj|BAF00702.1| hypothetical protein [Arabidopsis thaliana] gi|332197145|gb|AEE35266.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357455479|ref|XP_003598020.1| Deoxycytidine kinase [Medicago truncatula] gi|355487068|gb|AES68271.1| Deoxycytidine kinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 539 | ||||||
| TAIR|locus:2030367 | 580 | dNK "AT1G72040" [Arabidopsis t | 0.884 | 0.822 | 0.677 | 2e-171 | |
| UNIPROTKB|E5KNQ5 | 307 | TK2 "Mitochondrial thymidine k | 0.330 | 0.579 | 0.386 | 2.2e-28 | |
| UNIPROTKB|O00142 | 265 | TK2 "Thymidine kinase 2, mitoc | 0.330 | 0.671 | 0.386 | 2.2e-28 | |
| MGI|MGI:1351602 | 277 | Dguok "deoxyguanosine kinase" | 0.319 | 0.620 | 0.359 | 3.2e-28 | |
| UNIPROTKB|F1MNI9 | 305 | TK2 "Uncharacterized protein" | 0.335 | 0.593 | 0.371 | 4.8e-28 | |
| ZFIN|ZDB-GENE-040718-243 | 268 | tk2 "thymidine kinase 2, mitoc | 0.319 | 0.641 | 0.362 | 6.2e-28 | |
| UNIPROTKB|Q5ZJM7 | 265 | LOC770922 "Deoxyadenosine kina | 0.333 | 0.679 | 0.372 | 1.4e-27 | |
| UNIPROTKB|F1P6V1 | 227 | TK2 "Uncharacterized protein" | 0.374 | 0.889 | 0.339 | 1.8e-27 | |
| UNIPROTKB|F5GYK4 | 216 | TK2 "Thymidine kinase 2, mitoc | 0.313 | 0.782 | 0.385 | 1.8e-27 | |
| UNIPROTKB|Q16854 | 277 | DGUOK "Deoxyguanosine kinase, | 0.319 | 0.620 | 0.354 | 1.8e-27 |
| TAIR|locus:2030367 dNK "AT1G72040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1647 (584.8 bits), Expect = 2.0e-171, Sum P(2) = 2.0e-171
Identities = 338/499 (67%), Positives = 390/499 (78%)
Query: 50 ALARKSTLSAGFYARCSLKMPPPPRSWVVMREG--RAWFHTAACEG---VKA-AGS--ES 101
A R ST AG Y C + R+WV R G RA F + + G V A AG+ ES
Sbjct: 86 ASVRFST--AG-YRTCRCSIDGTNRAWVG-RTGSWRALFCSDSTGGLTPVNATAGAVVES 141
Query: 102 QKE---KSEDKTXXXXXXXXXXXXXAGTAPG-LVGNPDLLTIPGVGPRNLRKLVDNGIGD 157
++E + ED+ + + G VGNPDLL IPGVG RN RKLVDNGIGD
Sbjct: 142 EEESDGEDEDEEKDEKPVRMNRRNRSSSGSGEFVGNPDLLKIPGVGLRNQRKLVDNGIGD 201
Query: 158 VAELKQLYKDKFWEASQKMIEYLQSSVGIIHKNHAESITTFIKDSVDEELKDSNSDDKPA 217
VAELK+LYKDKFW+ASQKM++YL+SSVGIIH+NHAESITTFIK+SVD+ELKDS +
Sbjct: 202 VAELKKLYKDKFWKASQKMVDYLRSSVGIIHRNHAESITTFIKESVDDELKDSGPEPNLN 261
Query: 218 PKKRITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVGPDHFNILGAYY 277
KKR+TFCVEGNISVGK+TFLQRIANET+EL+DLVEIVPEP+DKWQDVGPDHFNIL A+Y
Sbjct: 262 VKKRLTFCVEGNISVGKSTFLQRIANETVELQDLVEIVPEPVDKWQDVGPDHFNILDAFY 321
Query: 278 DAPERYAYTFQNYVFVTRVMQERESSGGIKPLRLMERSVFSDRMVFVRAVHEAKYMNEME 337
P+RYAYTFQNYVFVTR+MQE+ES+ G+KPLRLMERSVFSDRMVFVRAVHEAK+MNEME
Sbjct: 322 SEPQRYAYTFQNYVFVTRLMQEKESASGVKPLRLMERSVFSDRMVFVRAVHEAKWMNEME 381
Query: 338 ISIYDSWFDPVVSVLPGLIPDGFIYLRASPDTCHKRMMLRKRAEEGGVSLDYLRSLHEKH 397
ISIYDSWFDPVVS LPGL+PDGFIYLRASPDTCHKRMMLRKRAEEGGVSL YL+ LHEKH
Sbjct: 382 ISIYDSWFDPVVSSLPGLVPDGFIYLRASPDTCHKRMMLRKRAEEGGVSLKYLQDLHEKH 441
Query: 398 ENWLFPFESGNHGVLAVSKLPLHIDNGLHPDIRDRVFYLDGPHMHSSIQKVPALVLDCEP 457
E+WL PFESGNHGVL+VS+ LH+DN LHPDI+DRVFYL+G HMHSSIQKVPALVLDCEP
Sbjct: 442 ESWLLPFESGNHGVLSVSRPSLHMDNSLHPDIKDRVFYLEGNHMHSSIQKVPALVLDCEP 501
Query: 458 NIDFSRDIDLKRQYARQVAXXXXXXXXXXXDQSAEECAATSNQAKVLLPHK-GGFWL-PD 515
NIDFSRDI+ K QYARQVA + S E+ +++Q+ VLLPH+ GG W+ P
Sbjct: 502 NIDFSRDIEAKTQYARQVAEFFEFVKKKQ-ETSTEK---SNSQSPVLLPHQNGGLWMGPA 557
Query: 516 GKHFPESALKSLDLRRAMS 534
G H P L LDL+ ++
Sbjct: 558 GNHVPGLDLPPLDLKSLLT 576
|
|
| UNIPROTKB|E5KNQ5 TK2 "Mitochondrial thymidine kinase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00142 TK2 "Thymidine kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1351602 Dguok "deoxyguanosine kinase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MNI9 TK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-243 tk2 "thymidine kinase 2, mitochondrial" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJM7 LOC770922 "Deoxyadenosine kinase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P6V1 TK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GYK4 TK2 "Thymidine kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16854 DGUOK "Deoxyguanosine kinase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 539 | |||
| cd01673 | 193 | cd01673, dNK, Deoxyribonucleoside kinase (dNK) cat | 3e-61 | |
| pfam01712 | 146 | pfam01712, dNK, Deoxynucleoside kinase | 1e-26 | |
| COG1428 | 216 | COG1428, COG1428, Deoxynucleoside kinases [Nucleot | 8e-20 | |
| cd02030 | 219 | cd02030, NDUO42, NADH:Ubiquinone oxioreductase, 42 | 8e-10 | |
| smart00483 | 334 | smart00483, POLXc, DNA polymerase X family | 0.002 |
| >gnl|CDD|238836 cd01673, dNK, Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
Score = 199 bits (509), Expect = 3e-61
Identities = 68/202 (33%), Positives = 102/202 (50%), Gaps = 14/202 (6%)
Query: 224 FCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVGPDHFNILGAYYDAPERY 283
VEGNI GK+T + +A E+VPEP++ + L +Y+ P+R+
Sbjct: 2 IVVEGNIGAGKSTLAKELAE-----HLGYEVVPEPVE----PDVEGNPFLEKFYEDPKRW 52
Query: 284 AYTFQNYVFVTRVMQERESSGGI--KPLRLMERSVFSDRMVFVRAVHEAKYMNEMEISIY 341
A+ FQ Y ++R+ Q +++ + ++ERS+FSDR+ + E M E +Y
Sbjct: 53 AFPFQLYFLLSRLKQYKDALEHLSTGQGVILERSIFSDRVFAEANLKEGGIMK-TEYDLY 111
Query: 342 DSWFDPVVSVLPGLIPDGFIYLRASPDTCHKRMMLRKRAEEGGVSLDYLRSLHEKHENWL 401
+ FD ++ L PD IYL ASP+TC KR+ R R EE G+ LDYL LHE +E W
Sbjct: 112 NELFDNLIP--ELLPPDLVIYLDASPETCLKRIKKRGRPEEQGIPLDYLEDLHEAYEKWF 169
Query: 402 FPFESGNHGVLAVSKLPLHIDN 423
P VL + I+
Sbjct: 170 LPQMYEKAPVLIIDANEADIEY 191
|
This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA. Length = 193 |
| >gnl|CDD|216657 pfam01712, dNK, Deoxynucleoside kinase | Back alignment and domain information |
|---|
| >gnl|CDD|224345 COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238988 cd02030, NDUO42, NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >gnl|CDD|214688 smart00483, POLXc, DNA polymerase X family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 539 | |||
| KOG4235 | 244 | consensus Mitochondrial thymidine kinase 2/deoxygu | 100.0 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 100.0 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 99.98 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 99.97 | |
| PF01712 | 146 | dNK: Deoxynucleoside kinase; InterPro: IPR002624 T | 99.95 | |
| KOG3877 | 393 | consensus NADH:ubiquinone oxidoreductase, NDUFA10/ | 99.92 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 99.91 | |
| PHA03132 | 580 | thymidine kinase; Provisional | 99.9 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 99.9 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 99.89 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 99.87 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 99.87 | |
| PLN02924 | 220 | thymidylate kinase | 99.86 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 99.84 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 99.83 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 99.83 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 99.81 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 99.8 | |
| PHA03136 | 378 | thymidine kinase; Provisional | 99.8 | |
| PHA03138 | 340 | thymidine kinase; Provisional | 99.76 | |
| PHA03134 | 340 | thymidine kinase; Provisional | 99.54 | |
| PHA03135 | 343 | thymidine kinase; Provisional | 99.51 | |
| KOG3327 | 208 | consensus Thymidylate kinase/adenylate kinase [Nuc | 99.39 | |
| PF00693 | 281 | Herpes_TK: Thymidine kinase from herpesvirus; Inte | 99.28 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 99.19 | |
| PHA03133 | 368 | thymidine kinase; Provisional | 99.19 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 99.03 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 98.94 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 98.92 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 98.92 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 98.91 | |
| PRK06217 | 183 | hypothetical protein; Validated | 98.9 | |
| PLN02200 | 234 | adenylate kinase family protein | 98.88 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 98.83 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 98.76 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 98.76 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 98.75 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 98.74 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 98.66 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 98.66 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 98.62 | |
| PRK03839 | 180 | putative kinase; Provisional | 98.61 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 98.61 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.6 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 98.52 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 98.51 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 98.5 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 98.48 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 98.46 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 98.46 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 98.45 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 98.42 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 98.42 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 98.41 | |
| PLN02842 | 505 | nucleotide kinase | 98.41 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 98.4 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 98.37 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 98.35 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 98.34 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 98.34 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 98.34 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 98.34 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 98.33 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 98.27 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 98.26 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 98.24 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 98.21 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 98.2 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 98.18 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 98.18 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 98.18 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 98.18 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 98.16 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 98.16 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 98.16 | |
| TIGR03707 | 230 | PPK2_P_aer polyphosphate kinase 2, PA0141 family. | 98.15 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 98.14 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 98.12 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 98.1 | |
| PRK07667 | 193 | uridine kinase; Provisional | 98.1 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 98.09 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 98.09 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.09 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 98.08 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 98.06 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 98.04 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 98.04 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 98.03 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 98.02 | |
| TIGR03709 | 264 | PPK2_rel_1 polyphosphate:nucleotide phosphotransfe | 98.02 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 97.99 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 97.98 | |
| PLN02674 | 244 | adenylate kinase | 97.98 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 97.98 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 97.97 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 97.96 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 97.96 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 97.95 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 97.95 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 97.93 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 97.93 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 97.92 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.92 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.91 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 97.89 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 97.89 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 97.88 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 97.87 | |
| PF03976 | 228 | PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR | 97.87 | |
| PLN02422 | 232 | dephospho-CoA kinase | 97.85 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 97.81 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.79 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 97.77 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 97.74 | |
| PLN02348 | 395 | phosphoribulokinase | 97.71 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.71 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 97.71 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.71 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 97.7 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 97.7 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 97.64 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 97.6 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 97.59 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 97.58 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 97.57 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 97.55 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.55 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 97.55 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 97.55 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 97.51 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 97.5 | |
| KOG3079 | 195 | consensus Uridylate kinase/adenylate kinase [Nucle | 97.49 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 97.45 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 97.44 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 97.44 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 97.44 | |
| PLN02199 | 303 | shikimate kinase | 97.43 | |
| PLN02459 | 261 | probable adenylate kinase | 97.43 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 97.41 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 97.4 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 97.39 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 97.34 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 97.33 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 97.33 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 97.32 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 97.3 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.28 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 97.26 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 97.25 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 97.19 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 97.19 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 97.17 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.1 | |
| KOG3308 | 225 | consensus Uncharacterized protein of the uridine k | 97.06 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.03 | |
| KOG3354 | 191 | consensus Gluconate kinase [Carbohydrate transport | 97.02 | |
| COG2326 | 270 | Uncharacterized conserved protein [Function unknow | 97.0 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.98 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.98 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 96.93 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.93 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 96.87 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.85 | |
| COG3172 | 187 | NadR Predicted ATPase/kinase involved in NAD metab | 96.82 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 96.7 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 96.7 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 96.66 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 96.61 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.57 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 96.49 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 96.48 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 96.48 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 96.36 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 96.24 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 96.23 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 96.09 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.86 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 95.78 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 95.76 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.73 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 95.62 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.59 | |
| COG4639 | 168 | Predicted kinase [General function prediction only | 95.56 | |
| KOG3220 | 225 | consensus Similar to bacterial dephospho-CoA kinas | 95.5 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 95.48 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 95.4 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 95.4 | |
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 95.38 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.37 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.24 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 95.23 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 95.2 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 95.06 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.94 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 94.91 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 94.84 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.82 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 94.74 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 94.65 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 94.64 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 94.59 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 94.58 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 94.57 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 94.54 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 94.52 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 94.49 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 94.48 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 94.48 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 94.44 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 94.43 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 94.43 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 94.42 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 94.4 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 94.39 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 94.39 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 94.37 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 94.33 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 94.3 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 94.3 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 94.27 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 94.26 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 94.25 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 94.25 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 94.24 | |
| smart00483 | 334 | POLXc DNA polymerase X family. includes vertebrate | 94.2 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 94.2 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 94.19 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.18 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 94.18 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 94.15 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 94.14 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 94.14 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 94.13 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 94.12 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 94.11 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 94.05 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 94.04 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 94.04 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 94.04 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 94.03 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 93.98 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 93.98 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 93.97 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 93.97 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 93.97 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 93.97 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 93.95 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 93.95 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 93.95 | |
| PRK13695 | 174 | putative NTPase; Provisional | 93.95 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 93.95 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 93.93 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 93.92 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 93.91 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 93.91 | |
| PF13173 | 128 | AAA_14: AAA domain | 93.91 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 93.9 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 93.9 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 93.89 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 93.86 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 93.85 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.84 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 93.84 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 93.81 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 93.8 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 93.79 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 93.78 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 93.78 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.77 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 93.76 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 93.76 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.75 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 93.75 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 93.75 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 93.73 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 93.71 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 93.7 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 93.68 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 93.68 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 93.67 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.67 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 93.67 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 93.66 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 93.65 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 93.64 | |
| PHA02575 | 227 | 1 deoxynucleoside monophosphate kinase; Provisiona | 93.63 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 93.63 | |
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 93.63 | |
| cd00141 | 307 | NT_POLXc Nucleotidyltransferase (NT) domain of fam | 93.62 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 93.61 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 93.61 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 93.6 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 93.59 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 93.58 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 93.58 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 93.58 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 93.57 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 93.57 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 93.57 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 93.57 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 93.57 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 93.54 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 93.54 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 93.53 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 93.52 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 93.51 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.51 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.51 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 93.5 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 93.5 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 93.49 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.49 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.49 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 93.48 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 93.48 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 93.48 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 93.47 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 93.47 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 93.46 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 93.45 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 93.45 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 93.43 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 93.43 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 93.41 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 93.38 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 93.36 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.35 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 93.35 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 93.34 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 93.33 | |
| PF05729 | 166 | NACHT: NACHT domain | 93.31 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.31 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 93.3 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.3 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.29 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 93.29 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.28 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 93.28 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.27 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 93.26 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 93.26 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 93.26 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 93.25 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.24 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 93.24 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 93.21 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.21 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 93.21 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 93.2 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 93.2 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 93.19 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 93.18 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 93.17 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 93.16 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 93.15 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.15 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 93.15 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 93.15 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.09 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 93.08 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 93.08 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 93.07 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 93.06 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 93.06 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 93.06 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.05 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 93.03 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 93.02 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 93.01 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 93.0 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 92.99 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 92.98 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 92.97 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 92.97 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 92.95 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 92.94 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 92.94 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 92.92 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 92.92 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 92.92 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.91 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 92.88 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 92.88 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 92.87 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.87 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 92.86 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 92.86 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 92.84 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 92.83 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.82 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 92.82 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 92.82 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 92.8 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 92.79 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 92.78 | |
| PF10391 | 52 | DNA_pol_lambd_f: Fingers domain of DNA polymerase | 92.72 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 92.69 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 92.68 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.67 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 92.67 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 92.66 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 92.66 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 92.64 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 92.64 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 92.64 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.64 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 92.63 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 92.63 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.61 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 92.61 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 92.58 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 92.58 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 92.57 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 92.56 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 92.55 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 92.51 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 92.47 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 92.47 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 92.46 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 92.45 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 92.45 | |
| PLN02772 | 398 | guanylate kinase | 92.45 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 92.44 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 92.41 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 92.41 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 92.41 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.4 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 92.4 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 92.39 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 92.36 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.34 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 92.34 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 92.34 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 92.33 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 92.32 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.31 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 92.3 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 92.3 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 92.29 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 92.29 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 92.29 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 92.27 | |
| PF11731 | 93 | Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd | 92.26 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.25 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.21 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 92.21 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.2 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.2 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.2 | |
| PRK13768 | 253 | GTPase; Provisional | 92.2 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 92.19 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.17 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 92.16 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 92.16 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 92.14 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 92.13 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 92.13 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 92.12 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.12 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 92.11 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 92.11 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 92.06 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 92.05 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 92.04 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 92.04 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 92.03 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 92.02 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 91.98 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 91.96 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 91.93 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 91.93 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 91.92 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 91.87 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.85 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 91.79 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 91.78 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.76 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 91.74 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.73 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 91.71 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 91.67 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 91.67 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 91.63 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 91.62 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 91.62 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 91.57 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 91.57 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 91.54 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 91.54 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 91.44 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 91.43 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 91.4 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 91.38 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 91.38 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 91.37 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 91.32 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 91.3 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 91.28 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 91.25 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 91.24 |
| >KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-50 Score=386.39 Aligned_cols=222 Identities=47% Similarity=0.833 Sum_probs=201.1
Q ss_pred CCeEEEEEcCCCCcHHHHHHHHHHHHhccCCceEEeeCCccccccCCCCccchhHhhhcCCCCCcHHHHHHHHHHHHHHH
Q 009257 220 KRITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVGPDHFNILGAYYDAPERYAYTFQNYVFVTRVMQE 299 (539)
Q Consensus 220 K~m~IaIEG~IGSGKSTLaklLak~~L~a~~~~EvV~EPi~~W~~i~~~g~~lLe~FY~Dp~r~Sf~~Ql~FLadR~kq~ 299 (539)
|...| ||||||+||||+++.+.+. ....++++.||+++|+++++.+.++|++||.+|.||+|+||.|.+.+|+++.
T Consensus 22 kr~~~-iEGNIa~GKsTfl~~~~~~---t~~~~ev~tEPV~kW~nV~~~~~n~L~~mY~ep~Rws~tfQtYv~ltrL~~~ 97 (244)
T KOG4235|consen 22 KRLSI-IEGNIAVGKSTFLNFFLNK---TYEEWEVLTEPVAKWQNVQGANANLLDMMYREPARWSYTFQTYVFLTRLKVQ 97 (244)
T ss_pred ceeEE-EecccccchHHHHHHHHhc---cCccceecCchHHHHhccccccccHHHHHhhchHhheehhhHHHHHHHHHHH
Confidence 44444 9999999999999988764 2234789999999999998777789999999999999999999999999998
Q ss_pred HHhcCCCCCeeeecceEeechHHHHHHHHHhcccCchhHHHHHhhHHHHHhcCCCCCCcEEEEEeCCHHHHHHHHHHhcc
Q 009257 300 RESSGGIKPLRLMERSVFSDRMVFVRAVHEAKYMNEMEISIYDSWFDPVVSVLPGLIPDGFIYLRASPDTCHKRMMLRKR 379 (539)
Q Consensus 300 ~e~~~~~~~~VI~DRSV~SDryIFA~~lye~G~lse~E~~iY~~l~~~l~~~Lp~l~PDLIIYLdaspE~~leRIkkRGR 379 (539)
.+..++.+++.||+||||||||||++++|++|.|++.+|.+|++||+|+.... .+.+|++|||+++|++|++||..|+|
T Consensus 98 ~~p~~~~kpvrimERSv~SdRyiFv~nl~esg~m~e~e~~iy~eW~d~i~~~~-~v~~dgiIYLrasPetc~~Ri~~R~R 176 (244)
T KOG4235|consen 98 LEPFNGRKPVRIMERSVYSDRYIFVENLYESGSMNEVEYVIYQEWFDWILRSM-DVSLDGIIYLRASPETCYKRIYLRAR 176 (244)
T ss_pred hcCCCCCCCeehhhhhhhhhHHHHHHHHHhcCCcccchhhhHHHHHHHHHhcc-ccccceEEEeecChHHHHHHHHHHhh
Confidence 88877778999999999999999999999999999999999999999998653 36899999999999999999999999
Q ss_pred ccccCCcHHHHHHHHHHHHHhhccCCCCCeEEEecCCCCcccCCCCCcccccceeeecCccccccccCCceEEEcCCCCC
Q 009257 380 AEEGGVSLDYLRSLHEKHENWLFPFESGNHGVLAVSKLPLHIDNGLHPDIRDRVFYLDGPHMHSSIQKVPALVLDCEPNI 459 (539)
Q Consensus 380 d~E~~i~leYLe~L~e~YEewl~~~~~~~~~VIdad~~~~~~d~~~~pe~~d~V~~~~~~h~~~~~~~iPvLviD~d~~~ 459 (539)
.+|++++++||+.||..||.|+... +++ .|+++||||||||.++
T Consensus 177 ~EE~gipL~YLe~LH~~HE~WLi~~---------------~f~---------------------~lq~vpvLVLDad~n~ 220 (244)
T KOG4235|consen 177 EEEKGIPLKYLEALHELHESWLIKL---------------HFP---------------------NLQAVPVLVLDADHNM 220 (244)
T ss_pred hhhcCCcHHHHHHHHHHHHHHHHHH---------------hhh---------------------HhhcCCeEEEecccch
Confidence 9999999999999999999999732 222 3788999999999999
Q ss_pred CcccCHHHHHHHHHHHHHHHHHH
Q 009257 460 DFSRDIDLKRQYARQVAEFFEFV 482 (539)
Q Consensus 460 DF~~d~~~~e~i~~~I~~fl~~v 482 (539)
||..+...++.+.++|.+|++.+
T Consensus 221 df~~e~~~~~~~~~~v~ef~~~~ 243 (244)
T KOG4235|consen 221 DFSLELTEYERLMREVNEFVKNL 243 (244)
T ss_pred hHHHHHHHHHHHHHHHHHHHhcC
Confidence 99999999999999999999864
|
|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 | Back alignment and domain information |
|---|
| >KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA03132 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03136 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03138 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03134 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03135 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3327 consensus Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00693 Herpes_TK: Thymidine kinase from herpesvirus; InterPro: IPR001889 The thymidine kinase from Herpesviridae catalyses the reaction: |
Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03133 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2326 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG4639 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >smart00483 POLXc DNA polymerase X family | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PHA02575 1 deoxynucleoside monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 539 | ||||
| 2a2z_A | 248 | Crystal Structure Of Human Deoxycytidine Kinase In | 9e-35 | ||
| 2zi3_A | 279 | C4s-E247a Dck Variant Of Dck In Complex With D-Da+a | 5e-34 | ||
| 2zi4_A | 279 | C4s Dck Variant Of Dck In Complex With L-Da+adp Len | 6e-34 | ||
| 2no9_A | 280 | The Structure Of Deoxycytidine Kinase Complexed Wit | 6e-34 | ||
| 3qej_A | 279 | S74e-Dck Mutant In Complex With Udp Length = 279 | 6e-34 | ||
| 1p5z_B | 263 | Structure Of Human Dck Complexed With Cytarabine An | 9e-34 | ||
| 2qrn_A | 280 | Human Deoxycytidine Kinase Dcmp, Udp, Mg Ion Produc | 1e-33 | ||
| 3ipx_A | 241 | X-Ray Structure Of Human Deoxycytidine Kinase In Co | 1e-33 | ||
| 3qeo_A | 279 | S74e-R104m-D133a Dck Variant In Complex With L-Deox | 3e-32 | ||
| 3hp1_A | 280 | Crystal Structure Of Human Dck R104mD133A IN COMPLE | 8e-32 | ||
| 2ocp_A | 241 | Crystal Structure Of Human Deoxyguanosine Kinase Le | 1e-28 | ||
| 1ot3_A | 250 | Crystal Structure Of Drosophila Deoxyribonucleotide | 2e-24 | ||
| 1j90_A | 230 | Crystal Structure Of Drosophila Deoxyribonucleoside | 4e-24 | ||
| 2jcs_A | 230 | Active Site Mutant Of Dnk From D. Melanogaster With | 1e-23 | ||
| 1zmx_A | 230 | Crystal Structure Of D. Melanogaster Deoxyribonucle | 2e-23 |
| >pdb|2A2Z|A Chain A, Crystal Structure Of Human Deoxycytidine Kinase In Complex With Deoxycytidine And Uridine Diphosphate Length = 248 | Back alignment and structure |
|
| >pdb|2ZI3|A Chain A, C4s-E247a Dck Variant Of Dck In Complex With D-Da+adp Length = 279 | Back alignment and structure |
| >pdb|2ZI4|A Chain A, C4s Dck Variant Of Dck In Complex With L-Da+adp Length = 279 | Back alignment and structure |
| >pdb|2NO9|A Chain A, The Structure Of Deoxycytidine Kinase Complexed With Troxacitabine And Adp. Length = 280 | Back alignment and structure |
| >pdb|3QEJ|A Chain A, S74e-Dck Mutant In Complex With Udp Length = 279 | Back alignment and structure |
| >pdb|1P5Z|B Chain B, Structure Of Human Dck Complexed With Cytarabine And Adp-Mg Length = 263 | Back alignment and structure |
| >pdb|2QRN|A Chain A, Human Deoxycytidine Kinase Dcmp, Udp, Mg Ion Product Complex Length = 280 | Back alignment and structure |
| >pdb|3IPX|A Chain A, X-Ray Structure Of Human Deoxycytidine Kinase In Complex With Adp And An Inhibitor Length = 241 | Back alignment and structure |
| >pdb|3QEO|A Chain A, S74e-R104m-D133a Dck Variant In Complex With L-Deoxythymidine And Udp Length = 279 | Back alignment and structure |
| >pdb|3HP1|A Chain A, Crystal Structure Of Human Dck R104mD133A IN COMPLEX WITH L-Dt And Adp Length = 280 | Back alignment and structure |
| >pdb|2OCP|A Chain A, Crystal Structure Of Human Deoxyguanosine Kinase Length = 241 | Back alignment and structure |
| >pdb|1OT3|A Chain A, Crystal Structure Of Drosophila Deoxyribonucleotide Kinase Complexed With The Substrate Deoxythymidine Length = 250 | Back alignment and structure |
| >pdb|1J90|A Chain A, Crystal Structure Of Drosophila Deoxyribonucleoside Kinase Length = 230 | Back alignment and structure |
| >pdb|2JCS|A Chain A, Active Site Mutant Of Dnk From D. Melanogaster With Dttp Bound Length = 230 | Back alignment and structure |
| >pdb|1ZMX|A Chain A, Crystal Structure Of D. Melanogaster Deoxyribonucleoside Kinase N64d Mutant In Complex With Thymidine Length = 230 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 539 | |||
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 5e-53 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 9e-50 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 4e-49 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 6e-47 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 2e-46 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 1e-42 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 2e-30 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 3e-29 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-07 |
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Length = 241 | Back alignment and structure |
|---|
Score = 179 bits (454), Expect = 5e-53
Identities = 81/280 (28%), Positives = 126/280 (45%), Gaps = 57/280 (20%)
Query: 217 APKKRITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDV----------G 266
P+ +EGNI+VGK+TF++ + E + EP+ WQ++
Sbjct: 1 GPR---RLSIEGNIAVGKSTFVKLLTKTYPE----WHVATEPVATWQNIQAAGNQKACTA 53
Query: 267 PDHFNILGAYYDAPERYAYTFQNYVFVTRVMQERESSGG-----IKPLRLMERSVFSDRM 321
N+L Y P R++YTFQ + F++R+ + E KP+++ ERSV+SDR
Sbjct: 54 QSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIFERSVYSDRY 113
Query: 322 VFVRAVHEAKYMNEMEISIYDSWFDPVVSVLPGLIP-DGFIYLRASPDTCHKRMMLRKRA 380
+F + + E ++++E IY W ++ I GFIYL+ASP C KR+ R R
Sbjct: 114 IFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVCLKRLYQRARE 173
Query: 381 EEGGVSLDYLRSLHEKHENWLFPFESGNHGVLAVSKLPLHIDNGLHPDIRDRVFYLDGPH 440
EE G+ L YL LH +HE WL + H
Sbjct: 174 EEKGIELAYLEQLHGQHEAWLIHKTTKLH------------------------------- 202
Query: 441 MHSSIQKVPALVLDCEPNIDFSRDIDLKRQYARQVAEFFE 480
++ +P LVLD N DFS ++ + R+V F +
Sbjct: 203 -FEALMNIPVLVLDV--NDDFSEEVTKQEDLMREVNTFVK 239
|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Length = 263 | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Length = 334 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Length = 230 | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Length = 341 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Length = 205 | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Length = 376 | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Length = 331 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 539 | |||
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 99.97 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 99.95 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 99.95 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 99.94 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 99.93 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 99.92 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 99.92 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 99.92 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 99.91 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 99.91 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 99.91 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 99.9 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 99.9 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 99.89 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 99.89 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 99.87 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 99.82 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 99.78 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 99.7 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 99.69 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 99.66 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 99.64 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 99.63 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 99.57 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 99.53 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 99.45 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 99.41 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 99.35 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 99.31 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 99.28 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 99.2 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 99.19 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 99.19 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 99.18 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 99.15 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 99.14 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 99.13 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 99.12 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 99.1 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 99.09 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 99.05 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 99.02 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 99.02 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 99.01 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 99.0 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 99.0 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 98.99 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 98.97 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 98.96 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 98.96 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 98.95 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 98.91 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 98.88 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 98.82 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.82 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 98.76 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 98.75 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 98.75 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 98.74 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 98.72 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 98.72 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 98.69 | |
| 3rhf_A | 289 | Putative polyphosphate kinase 2 family protein; PS | 98.65 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 98.64 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.64 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 98.59 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 98.56 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 98.54 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 98.52 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 98.51 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.49 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 98.45 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 98.44 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 98.43 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 98.43 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.38 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.38 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 98.35 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 98.33 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 98.32 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.32 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 98.31 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 98.24 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 98.23 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 98.23 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 98.19 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 98.15 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.14 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 98.13 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 98.11 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 98.11 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 98.06 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 98.05 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 98.02 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 97.97 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 97.86 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.84 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.8 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.78 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.77 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.77 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.75 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.72 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.71 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.57 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 97.38 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 97.34 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 97.16 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.03 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 96.97 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.86 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.85 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 96.56 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.48 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.44 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.43 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.32 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.26 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 96.17 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.1 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.04 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 95.99 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.92 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 95.86 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 95.86 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 95.79 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 95.71 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.68 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.61 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 95.53 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 95.46 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.46 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.44 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.43 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 95.42 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.4 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 95.4 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.24 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.2 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 94.91 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.8 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.79 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 94.59 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 94.59 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 94.59 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.56 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 94.55 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.51 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.51 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.49 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 94.49 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.48 | |
| 2fmp_A | 335 | DNA polymerase beta; nucleotidyl transferase, tran | 94.41 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.39 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 94.36 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.33 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 94.32 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 94.31 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 94.25 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 94.22 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 94.13 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 94.08 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.08 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 94.08 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.05 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 94.02 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 94.01 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 93.99 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 93.99 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 93.98 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 93.93 | |
| 2bcq_A | 335 | DNA polymerase lambda; misalignment, extrahelical, | 93.93 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 93.93 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 93.93 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 93.9 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 93.9 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 93.9 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 93.9 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 93.88 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.86 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 93.83 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 93.81 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.8 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 93.77 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 93.77 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.76 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 93.76 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.76 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 93.71 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 93.63 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 93.6 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 93.58 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 93.55 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 93.43 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 93.37 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 93.31 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 93.18 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 93.14 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 93.12 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 93.1 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.07 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 92.99 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.98 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.95 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 92.92 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 92.92 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.9 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 92.86 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 92.86 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.86 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 92.82 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 92.81 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 92.8 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 92.74 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 92.72 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 92.68 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 92.68 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 92.67 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 92.67 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 92.65 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 92.63 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 92.62 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 92.61 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 92.59 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 92.57 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 92.55 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 92.55 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 92.52 | |
| 1jms_A | 381 | Terminal deoxynucleotidyltransferase; polymerase; | 92.52 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.44 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.43 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 92.43 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 92.39 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 92.38 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 92.34 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 92.33 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 92.32 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 92.3 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.29 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 92.24 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 92.21 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 92.21 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 92.17 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 92.13 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 92.13 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 92.12 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 92.1 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 92.09 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 92.09 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 92.08 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 92.06 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 92.01 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 92.0 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 91.96 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 91.93 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 91.9 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 91.86 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 91.84 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.84 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 91.8 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 91.78 | |
| 2ihm_A | 360 | POL MU, DNA polymerase MU; helix-turn-helix, trans | 91.78 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 91.77 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 91.72 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 91.72 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.68 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.6 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 91.58 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 91.55 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 91.54 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 91.53 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 91.53 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 91.49 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 91.44 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 91.4 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 91.37 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 91.35 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 91.35 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 91.31 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 91.31 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 91.3 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 91.18 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 91.18 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 91.13 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 91.11 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 91.1 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 91.09 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 91.09 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 91.09 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 91.04 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 91.04 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 90.97 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 90.92 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 90.91 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 90.89 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 90.89 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 90.86 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 90.83 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.82 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 90.8 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 90.78 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 90.73 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 90.73 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 90.7 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 90.7 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 90.64 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 90.63 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 90.61 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 90.61 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 90.6 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 90.6 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 90.6 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 90.58 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 90.49 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 90.48 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 90.48 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 90.47 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 90.47 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 90.43 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 90.41 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 90.36 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 90.33 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 90.28 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 90.25 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 90.23 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 90.22 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 90.21 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 90.2 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 90.14 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 90.12 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 90.1 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 90.1 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 90.08 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 90.07 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 90.05 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 90.04 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 90.03 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.0 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 89.99 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 89.99 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 89.97 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 89.96 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 89.95 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 89.94 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 89.92 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 89.92 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 89.91 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 89.82 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 89.81 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 89.79 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 89.78 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 89.75 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 89.67 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 89.66 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 89.64 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 89.61 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 89.59 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 89.55 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 89.53 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 89.46 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 89.43 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 89.41 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 89.31 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 89.3 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 89.23 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 89.18 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 89.14 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 89.08 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 89.05 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 89.01 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 89.01 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 88.99 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 88.95 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.92 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 88.91 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 88.91 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 88.89 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.83 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 88.82 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 88.81 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 88.8 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 88.79 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 88.76 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 88.75 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 88.73 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 88.73 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 88.73 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 88.65 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 88.58 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 88.56 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.54 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 88.49 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 88.46 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 88.46 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 88.39 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 88.37 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 88.34 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 88.28 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 88.23 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 88.22 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 88.22 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 88.21 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 88.19 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 88.12 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 88.08 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 88.02 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 88.02 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 88.01 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 88.0 | |
| 3bqs_A | 93 | Uncharacterized protein; 10114F, NYSGXRC, PSI-2, s | 87.97 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 87.92 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 87.88 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 87.85 | |
| 1ci4_A | 89 | Protein (barrier-TO-autointegration factor (BAF) ) | 87.85 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 87.84 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 87.81 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 87.78 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 87.66 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 87.64 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 87.61 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 87.53 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 87.5 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 87.48 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 87.43 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 87.32 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 87.29 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 87.23 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 87.15 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 87.1 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 87.07 | |
| 3mab_A | 93 | Uncharacterized protein; NYSGXRC, PSI-2, structura | 86.95 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 86.95 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 86.83 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 86.82 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 86.8 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 86.78 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 86.78 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 86.77 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 86.76 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 86.74 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 86.7 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 86.69 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 86.58 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 86.52 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 86.42 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 86.37 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 86.35 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 86.33 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 86.31 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 86.3 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 86.3 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 86.22 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 86.13 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 86.12 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 85.97 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 85.97 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 85.92 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 85.92 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 85.86 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 85.7 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 85.68 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 85.67 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 85.65 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 85.65 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 85.45 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 85.44 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 85.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 85.42 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 85.4 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 85.27 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 85.17 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 85.1 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 85.0 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 84.96 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 84.73 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 84.62 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 84.52 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 84.5 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 84.46 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 84.33 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 84.3 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 84.17 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 84.09 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 84.08 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 84.02 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 84.01 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 83.87 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 83.78 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 83.77 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 83.74 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 83.53 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 83.48 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 83.41 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 83.4 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 83.39 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 83.39 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 83.37 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 83.85 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 83.07 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 83.03 |
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
Probab=99.97 E-value=1.2e-29 Score=244.30 Aligned_cols=224 Identities=35% Similarity=0.689 Sum_probs=179.1
Q ss_pred CCeEEEEEcCCCCcHHHHHHHHHHHHhccCCceEEeeCCccccccCC----------CCccchhHhhhcCCCCCcHHHHH
Q 009257 220 KRITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVG----------PDHFNILGAYYDAPERYAYTFQN 289 (539)
Q Consensus 220 K~m~IaIEG~IGSGKSTLaklLak~~L~a~~~~EvV~EPi~~W~~i~----------~~g~~lLe~FY~Dp~r~Sf~~Ql 289 (539)
++++|+|||++||||||+++.|+++ +.. ..++.||+++|.++. ..++++++.+|.++.+|+|.+|+
T Consensus 1 ~~~~i~~~G~~g~GKtt~~~~l~~~-l~~---~~~~~Ep~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 76 (241)
T 2ocp_A 1 GPRRLSIEGNIAVGKSTFVKLLTKT-YPE---WHVATEPVATWQNIQAAGNQKACTAQSLGNLLDMMYREPARWSYTFQT 76 (241)
T ss_dssp CCEEEEEEECTTSSHHHHHHHHHHH-CTT---SEEECCCGGGTSCCC------------CCCHHHHHHHSHHHHHHHHHH
T ss_pred CCeEEEEEcCCCCCHHHHHHHHHHH-cCC---CeeeecchhhhccccccccccccccccCCchHHHHHhCcccchhHHHH
Confidence 5789999999999999999999996 431 347899999996542 13467999999999889999999
Q ss_pred HHHHHHHHHHHHhc-----CCCCCeeeecceEeechHHHHHHHHHhcccCchhHHHHHhhHHHHHhcCC-CCCCcEEEEE
Q 009257 290 YVFVTRVMQERESS-----GGIKPLRLMERSVFSDRMVFVRAVHEAKYMNEMEISIYDSWFDPVVSVLP-GLIPDGFIYL 363 (539)
Q Consensus 290 ~FLadR~kq~~e~~-----~~~~~~VI~DRSV~SDryIFA~~lye~G~lse~E~~iY~~l~~~l~~~Lp-~l~PDLIIYL 363 (539)
+++..|++++.... ....+.++.||+|++|+|+|+...|+.+.+++.++..|.+|+.++...++ ...||++|||
T Consensus 77 ~~ll~r~~~~~~~~~~~~~~~~~~~l~~~r~vi~Dr~~~s~~~y~~~~~~~~e~~~~~~~~~~l~~~~~~~~~pd~~i~l 156 (241)
T 2ocp_A 77 FSFLSRLKVQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYL 156 (241)
T ss_dssp HHHHHHHHHHHSCCCHHHHSCSSCEEEEESCHHHHHHTHHHHHHHTTSSCHHHHHHHHHHHHHHHHHSHHHHCCCEEEEE
T ss_pred HHHHHHHHHHHHHHhhhhcccCCceEeeeCCchhhHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcccccCCCEEEEE
Confidence 99999988754321 12346778999999999999999999888888899999999988765442 1269999999
Q ss_pred eCCHHHHHHHHHHhccccccCCcHHHHHHHHHHHHHhhccCCCCCeEEEecCCCCcccCCCCCcccccceeeecCccccc
Q 009257 364 RASPDTCHKRMMLRKRAEEGGVSLDYLRSLHEKHENWLFPFESGNHGVLAVSKLPLHIDNGLHPDIRDRVFYLDGPHMHS 443 (539)
Q Consensus 364 daspE~~leRIkkRGRd~E~~i~leYLe~L~e~YEewl~~~~~~~~~VIdad~~~~~~d~~~~pe~~d~V~~~~~~h~~~ 443 (539)
++|++++++|+.+|+|..|...+.+|+++|++.|+.|+.+... ++.++
T Consensus 157 ~~~~~~~~~R~~~R~r~~e~~~~~~~~~~v~~~y~~~~~~~~~-----------p~~~~--------------------- 204 (241)
T 2ocp_A 157 QASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTT-----------KLHFE--------------------- 204 (241)
T ss_dssp ECCHHHHHHHHHHSCCTTTTTCCHHHHHHHHHHHHHHHTSCCS-----------CCCCT---------------------
T ss_pred ECCHHHHHHHHHhcCCcccccCCHHHHHHHHHHHHHHHhhccc-----------ccccc---------------------
Confidence 9999999999999999877666799999999999999865320 10000
Q ss_pred cccCCceEEEcCCCCCCcccCHHHHHHHHHHHHHHHHH
Q 009257 444 SIQKVPALVLDCEPNIDFSRDIDLKRQYARQVAEFFEF 481 (539)
Q Consensus 444 ~~~~iPvLviD~d~~~DF~~d~~~~e~i~~~I~~fl~~ 481 (539)
.....++++||++. |+....++.+.+++.|.++++.
T Consensus 205 ~~~~~~~~~Id~~~--~~~~v~~~i~~i~~~i~~~l~~ 240 (241)
T 2ocp_A 205 ALMNIPVLVLDVND--DFSEEVTKQEDLMREVNTFVKN 240 (241)
T ss_dssp TGGGCCEEEEECCS--CTTTCHHHHHHHHHHHHHHHHT
T ss_pred ccCCCCEEEEECCC--ChhhCHHHHHHHHHHHHHHHhc
Confidence 01246899999973 7888899999999999988753
|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1ci4_A Protein (barrier-TO-autointegration factor (BAF) ); DNA binding protein, retroviral integration, preintegration complex; 1.90A {Homo sapiens} SCOP: a.60.5.1 PDB: 1qck_A 2bzf_A 2ezx_A 2ezy_A 2ezz_A 2odg_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3mab_A Uncharacterized protein; NYSGXRC, PSI-2, structural genomics; 1.42A {Listeria monocytogenes} PDB: 3bqt_A | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 539 | ||||
| d1p6xa_ | 333 | c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus | 2e-38 | |
| d1osna_ | 331 | c.37.1.1 (A:) Thymidine kinase {Varicella-zoster v | 7e-37 | |
| d1e2ka_ | 329 | c.37.1.1 (A:) Thymidine kinase {Herpes simplex vir | 2e-30 | |
| d2vp4a1 | 197 | c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fr | 4e-25 | |
| d2ocpa1 | 241 | c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human ( | 7e-25 | |
| d1p5zb_ | 241 | c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sa | 1e-24 | |
| d1gsia_ | 208 | c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tu | 8e-09 | |
| d1pzna1 | 61 | a.60.4.1 (A:35-95) DNA repair protein Rad51, N-ter | 5e-04 | |
| d2i1qa1 | 60 | a.60.4.1 (A:5-64) DNA repair protein Rad51, N-term | 0.002 | |
| d1jmsa3 | 60 | a.60.12.1 (A:243-302) Terminal deoxynucleotidyl tr | 0.003 | |
| d2p6ra2 | 198 | a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglob | 0.004 |
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Length = 333 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: Thymidine kinase species: Equine herpesvirus type 4 [TaxId: 10331]
Score = 141 bits (357), Expect = 2e-38
Identities = 24/205 (11%), Positives = 60/205 (29%), Gaps = 36/205 (17%)
Query: 221 RITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVGPDHFNILGAYYDAP 280
RI ++G +GK+T + +A PEP+ W+ + +++ YD
Sbjct: 8 RIY--LDGVYGIGKSTTGRVMA-SAASGGSPTLYFPEPMAYWRTLFET--DVISGIYDTQ 62
Query: 281 ERY-------------AYTFQNYVFVTRVM-----------QERESSGGIKPLRLMERSV 316
R +Q+ ++ + + +R
Sbjct: 63 NRKQQGNLAVDDAALITAHYQSRFTTPYLILHDHTCTLFGGNSLQRGTQPDLTLVFDRHP 122
Query: 317 FSDRMVFVRAVHEAKYMNEMEISIYDSWFDPVVSVLPGLIPDGFIYLRASPDTCHKRMML 376
+ + F A + M+ + + + + + +R+
Sbjct: 123 VASTVCFPAARYLLGDMSMCALMAMVATLPR------EPQGGNIVVTTLNVEEHIRRLRT 176
Query: 377 RKRAEEGGVSLDYLRSLHEKHENWL 401
R R E + + + +L + +
Sbjct: 177 RARIGE-QIDITLIATLRNVYFMLV 200
|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Length = 331 | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Length = 329 | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 197 | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 241 | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 241 | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 208 | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 61 | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Length = 60 | Back information, alignment and structure |
|---|
| >d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 539 | |||
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 100.0 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 100.0 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 99.97 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 99.95 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 99.94 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 99.94 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 99.93 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 99.92 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 99.89 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 99.85 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 99.46 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 99.32 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 99.28 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 99.25 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 99.19 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 99.16 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 99.11 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 99.11 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 99.08 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 99.02 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 99.02 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 99.01 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.99 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 98.89 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 98.89 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 98.88 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 98.84 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 98.83 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 98.81 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.67 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.54 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 98.53 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 98.53 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 98.52 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 98.48 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 98.47 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 98.44 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 98.44 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 98.36 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 98.22 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 98.21 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.21 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.19 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 98.19 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 98.04 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.92 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 97.87 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 97.81 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 97.7 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.62 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 97.58 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.37 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.24 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.82 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.74 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.66 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.44 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 96.38 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.13 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.01 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 95.98 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.9 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.85 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.78 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.63 | |
| d1jmsa3 | 60 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 95.06 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 94.91 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.83 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 94.8 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.75 | |
| d2fmpa2 | 57 | DNA polymerase beta {Human (Homo sapiens) [TaxId: | 94.68 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.51 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.5 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.42 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 94.41 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 94.33 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.29 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 94.29 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.27 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 94.26 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.19 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.09 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 94.08 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.03 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.02 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 93.96 | |
| d2bcqa2 | 57 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 93.94 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.87 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.65 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.64 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 93.62 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 93.61 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.56 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.51 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 93.45 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 93.39 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 93.2 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 93.16 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 93.08 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.05 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 93.0 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 93.0 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 93.0 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 92.82 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 92.81 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.78 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.75 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.65 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.63 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.63 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 92.6 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.6 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 92.38 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 92.24 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 92.09 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 92.07 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 92.05 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.96 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 91.94 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 91.83 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 91.77 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 91.72 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 91.69 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 91.67 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.5 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 91.46 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 91.38 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 91.34 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.23 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 91.22 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 91.14 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 91.1 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 91.09 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 91.04 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 90.94 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 90.78 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 90.75 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.75 | |
| d1szpa1 | 64 | DNA repair protein Rad51, N-terminal domain {Baker | 90.71 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.39 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 90.13 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.02 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 89.94 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 89.78 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.76 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 89.74 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 89.73 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 89.66 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.64 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 89.38 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 89.31 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 89.29 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 89.28 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 89.26 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.23 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.23 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 89.23 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 89.23 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 89.2 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 88.99 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 88.97 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 88.88 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.86 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 88.82 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 88.76 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 88.67 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 88.64 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.61 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 88.59 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 88.59 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 88.42 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 88.36 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.23 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 88.16 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 88.13 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 88.04 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 87.91 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 87.85 | |
| d2p6ra2 | 198 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 87.84 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 87.77 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 87.66 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 87.65 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 87.61 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.5 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 87.47 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 87.43 | |
| d1b22a_ | 70 | DNA repair protein Rad51, N-terminal domain {Human | 87.4 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 87.32 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 87.2 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 87.17 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 87.14 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.14 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 86.88 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 86.76 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 86.49 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 86.28 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 86.25 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 86.15 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 85.9 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 85.71 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.68 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 85.66 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 85.63 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 85.6 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 85.56 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 85.56 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 85.54 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 85.26 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 84.83 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 84.82 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 84.46 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 84.14 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 84.13 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 83.94 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 83.81 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 83.7 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 82.8 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 82.72 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 82.6 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 81.74 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 81.69 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 80.76 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 80.36 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 80.24 |
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: Deoxyguanosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=3e-35 Score=278.70 Aligned_cols=224 Identities=34% Similarity=0.675 Sum_probs=186.5
Q ss_pred CeEEEEEcCCCCcHHHHHHHHHHHHhccCCceEEeeCCccccccCCC----------CccchhHhhhcCCCCCcHHHHHH
Q 009257 221 RITFCVEGNISVGKTTFLQRIANETLELRDLVEIVPEPIDKWQDVGP----------DHFNILGAYYDAPERYAYTFQNY 290 (539)
Q Consensus 221 ~m~IaIEG~IGSGKSTLaklLak~~L~a~~~~EvV~EPi~~W~~i~~----------~g~~lLe~FY~Dp~r~Sf~~Ql~ 290 (539)
+++|+|||++|||||||+++|+++ +... .+..||+..|..+.. ..+++|+.||.||.+++|++|++
T Consensus 2 pk~IviEG~~GsGKST~~~~L~~~-l~~~---~i~~epv~~~~~~~~~~~~~~~~~~~~~~~l~~f~~~~~~~~~~~q~~ 77 (241)
T d2ocpa1 2 PRRLSIEGNIAVGKSTFVKLLTKT-YPEW---HVATEPVATWQNIQAAGNQKACTAQSLGNLLDMMYREPARWSYTFQTF 77 (241)
T ss_dssp CEEEEEEECTTSSHHHHHHHHHHH-CTTS---EEECCCGGGTSCCC------------CCCHHHHHHHSHHHHHHHHHHH
T ss_pred CeEEEEECCCCCcHHHHHHHHHHH-Hhhc---CCcccccCccceeecCCCCchHHHHHHHHHhhhhhccchhhhhHHHHH
Confidence 679999999999999999999996 5543 367899999976531 23468999999999999999999
Q ss_pred HHHHHHHHHHHhc-----CCCCCeeeecceEeechHHHHHHHHHhcccCchhHHHHHhhHHHHHhcCC-CCCCcEEEEEe
Q 009257 291 VFVTRVMQERESS-----GGIKPLRLMERSVFSDRMVFVRAVHEAKYMNEMEISIYDSWFDPVVSVLP-GLIPDGFIYLR 364 (539)
Q Consensus 291 FLadR~kq~~e~~-----~~~~~~VI~DRSV~SDryIFA~~lye~G~lse~E~~iY~~l~~~l~~~Lp-~l~PDLIIYLd 364 (539)
|+++|+.++.+.. ...+..+++||+++|+.++|....+..|.+.+.++..|.+|+.++...+. ...||++|||+
T Consensus 78 ~~~~r~~~~~~~~~~~~~~~~~~~vi~dr~~~s~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~pdl~i~Ld 157 (241)
T d2ocpa1 78 SFLSRLKVQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQ 157 (241)
T ss_dssp HHHHHHHHHHSCCCHHHHSCSSCEEEEESCHHHHHHTHHHHHHHTTSSCHHHHHHHHHHHHHHHHHSHHHHCCCEEEEEE
T ss_pred HHHHHHHHHHHHHHHHhhhccchhhhhcccchhhhhhhhhhhhhhccchhHHHHHHHHHHHHHhhhhccccccceEEEec
Confidence 9999999876642 24457899999999998888888999999999999999999887764331 13799999999
Q ss_pred CCHHHHHHHHHHhccccccCCcHHHHHHHHHHHHHhhccCCCCCeEEEecCCCCcccCCCCCcccccceeeecCcccccc
Q 009257 365 ASPDTCHKRMMLRKRAEEGGVSLDYLRSLHEKHENWLFPFESGNHGVLAVSKLPLHIDNGLHPDIRDRVFYLDGPHMHSS 444 (539)
Q Consensus 365 aspE~~leRIkkRGRd~E~~i~leYLe~L~e~YEewl~~~~~~~~~VIdad~~~~~~d~~~~pe~~d~V~~~~~~h~~~~ 444 (539)
++|+++++|+.+|+|+.|..++.+|+++|++.|++|+.++... .. ...
T Consensus 158 ~~~~~~~~Ri~~r~r~~E~~i~~~yl~~l~~~Y~~~~~~~~~~-------------~~-------------------~~~ 205 (241)
T d2ocpa1 158 ASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTTK-------------LH-------------------FEA 205 (241)
T ss_dssp CCHHHHHHHHHHSCCTTTTTCCHHHHHHHHHHHHHHHTSCCSC-------------CC-------------------CTT
T ss_pred CCHHHHHHHHhcccchhhhcCCHHHHHHHHHHHHHHHHhhhhh-------------hh-------------------Hhh
Confidence 9999999999999999999999999999999999999876410 00 012
Q ss_pred ccCCceEEEcCCCCCCcccCHHHHHHHHHHHHHHHHHH
Q 009257 445 IQKVPALVLDCEPNIDFSRDIDLKRQYARQVAEFFEFV 482 (539)
Q Consensus 445 ~~~iPvLviD~d~~~DF~~d~~~~e~i~~~I~~fl~~v 482 (539)
..+.|+++||++ -||.+..++.++|+++|.+||+.+
T Consensus 206 ~~~~~~~iID~~--~d~~~~~~~~~~i~~~I~~~i~~~ 241 (241)
T d2ocpa1 206 LMNIPVLVLDVN--DDFSEEVTKQEDLMREVNTFVKNL 241 (241)
T ss_dssp GGGCCEEEEECC--SCTTTCHHHHHHHHHHHHHHHHTC
T ss_pred cCCCCEEEEECC--CchhhhHHHHHHHHHHHHHHHhcC
Confidence 335799999996 399999999999999999999753
|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|