Citrus Sinensis ID: 009641


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530
MEEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSVRGGISDEAFWKVGCDLHGVNRVRRSFYQTSGDRALGKGMVAFCSNHGQCQN
ccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHccccccccccccccHHHHHccccccEEEcccHHHHHHHcccccEEEccccEEEEEcccHHHccccHHHHHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccEEEEEEccccccHHHHHHHcccccEEEEEccccccccccEEEEEEEccccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccHHHHHHHcccccccccHHHccccccccHHHHHHcHHHHHHccccccc
cHHHHHcccEEEEccccccccccHHHccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccccccccccHHHHHHHHHcccEEEEEcccHHHHHHHcccEEEccEEEEEEEcHHHHHHHccccHHHHHHHHHcccccccccccHcccHHHHHcccHHHccHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHcccEEEEEccccccHHccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHcccccEEEEEcHHHccccccccEEEEEEcccccccHEEEEEcccccccccEEEEEEEccccHHHHHHHHHHHHHcccccccccHHHHHHccHcccccccccHcccccccccccccccccccccccccccccccccccEEEEccccccc
meeakkksmpvlpwmrspvdvslfedcpldhlpcldpRLKVALQnmgisslfPVQVAVWQetigpglferdlcinsptgsgktlsyALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELikrpkleagicydpEDVLQELQSAVDILVatpgrlmdhinatrGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQltrsdnenrfsdastflpsafgslktirrcgvergfkdkpypRLVKMVLSAtltqdpnklaqldlhhplflttgetryklpeRLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSdamtrgmdvegvnnvvnydkpayiKTYIHRAgrtaragqlgrCFTLLHKDEVKRFKKLLQkadndscpihsipsslieSLRPVYksvrggisdeaFWKVGcdlhgvnrvrrsfyqtsgdralGKGMVAFCsnhgqcqn
meeakkksmpvlpwmrsPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDAstflpsafgslktirrcgvergfkdkpyprLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIkeysglqrqsvrsktlkafregkiqvlvssdamtrgmdvegvnnvvnydkPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLlqkadndscpihsipsslieslRPVYKSVRGGISDEAFWKVGCDLHGVNRVRRSFYQTSGDRALGKGMVAFCSNHGQCQN
MEEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSVRGGISDEAFWKVGCDLHGVNRVRRSFYQTSGDRALGKGMVAFCSNHGQCQN
**********VLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRS*****FSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSVRGGISDEAFWKVGCDLHGVNRVRRSFYQTSGDRALGKGMVAFCS*******
*****************PVDV*****C*LDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEI***I***KLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNE*******TFLPSAFGSLKTIRR*****GFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETR*KLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKE***************AFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQ********************************************************************FC*NH*****
**********VLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSVRGGISDEAFWKVGCDLHGVNRVRRSFYQTSGDRALGKGMVAFCSNHGQCQN
MEEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLR*********************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSVRGGISDEAFWKVGCDLHGVNRVRRSFYQTSGDRALGKGMVAFCSNHGQCQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query530 2.2.26 [Sep-21-2011]
Q7FGZ2522 DEAD-box ATP-dependent RN yes no 0.896 0.909 0.741 0.0
Q0DWT8521 DEAD-box ATP-dependent RN yes no 0.883 0.898 0.660 0.0
Q8N8A6666 ATP-dependent RNA helicas yes no 0.843 0.671 0.382 1e-82
Q6DRI7652 ATP-dependent RNA helicas yes no 0.833 0.677 0.383 7e-81
Q6P9R1639 ATP-dependent RNA helicas yes no 0.841 0.697 0.366 1e-79
Q54BD6563 Probable ATP-dependent RN yes no 0.745 0.701 0.374 1e-66
P26802687 Probable ATP-dependent RN yes no 0.883 0.681 0.348 2e-65
Q76PD3604 ATP-dependent RNA helicas yes no 0.788 0.692 0.338 7e-59
A2QA23593 ATP-dependent RNA helicas yes no 0.788 0.704 0.375 2e-56
A5E726663 ATP-dependent RNA helicas N/A no 0.732 0.585 0.330 2e-55
>sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 Back     alignment and function desciption
 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/475 (74%), Positives = 410/475 (86%)

Query: 2   EEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQE 61
           +E K +   V+PWMR+PVDVS  E+C LD LPCL+P+LK AL+NMGISSLFPVQVAVW E
Sbjct: 5   KEDKTEMDSVVPWMRAPVDVSNVENCALDTLPCLNPKLKKALENMGISSLFPVQVAVWHE 64

Query: 62  TIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVF 121
           TIGPG FERD+C+NSPTGSGKTLSYALPIVQ L++R VRCLRALVVLPTRDLALQVKDVF
Sbjct: 65  TIGPGGFERDICVNSPTGSGKTLSYALPIVQLLASRPVRCLRALVVLPTRDLALQVKDVF 124

Query: 122 AAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPG 181
            AIAPAVGLSVG AVGQSSIA EIS+LIK PKL+AGICYDP+D+ Q L+SAVDILVATPG
Sbjct: 125 DAIAPAVGLSVGSAVGQSSIAGEISQLIKTPKLDAGICYDPDDLSQNLESAVDILVATPG 184

Query: 182 RLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLP 241
           RLMDHIN T+GFTLEHL YLVVDETDRLLREAYQ+WLPTVLQLT++ +++ F   + F+P
Sbjct: 185 RLMDHINNTKGFTLEHLRYLVVDETDRLLREAYQSWLPTVLQLTQTSDDSLFPSFTPFVP 244

Query: 242 SAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRY 301
           SAFGSL+T+RR  VERGFK KPYPRLVKMVLSATLTQDP+KL QLDLHHPLF+TTG +RY
Sbjct: 245 SAFGSLQTVRRQSVERGFKGKPYPRLVKMVLSATLTQDPSKLIQLDLHHPLFMTTGGSRY 304

Query: 302 KLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIK 361
           +LPE+LE  +LICE+ +KP+YLVALL+S   EKCI+FTSSVE+T RLC LLN FG+ +IK
Sbjct: 305 RLPEKLECLRLICETGMKPVYLVALLKSWEGEKCIIFTSSVETTRRLCKLLNFFGDPKIK 364

Query: 362 IKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIH 421
            KEYSG   QS+RSK LKAFR+G IQVLV+SDA+TRGMDV+GV NV+NYD P + KT+IH
Sbjct: 365 AKEYSGGLNQSLRSKELKAFRKGDIQVLVASDALTRGMDVKGVTNVINYDMPPFAKTFIH 424

Query: 422 RAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVY 476
           RAGRTARAGQ GRCFTLL   EV+RF KLL+K  +DSCPI+ IP + ++S+R  Y
Sbjct: 425 RAGRTARAGQAGRCFTLLSNHEVRRFSKLLEKVGSDSCPIYPIPPTSLDSIRATY 479





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1 Back     alignment and function description
>sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3 Back     alignment and function description
>sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 Back     alignment and function description
>sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=2 SV=1 Back     alignment and function description
>sp|Q54BD6|DDX51_DICDI Probable ATP-dependent RNA helicase ddx51 OS=Dictyostelium discoideum GN=ddx51 PE=3 SV=1 Back     alignment and function description
>sp|P26802|DDX51_DROME Probable ATP-dependent RNA helicase Dbp73D OS=Drosophila melanogaster GN=Dbp73D PE=2 SV=3 Back     alignment and function description
>sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 Back     alignment and function description
>sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 Back     alignment and function description
>sp|A5E726|DBP6_LODEL ATP-dependent RNA helicase DBP6 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query530
224077862518 predicted protein [Populus trichocarpa] 0.901 0.922 0.821 0.0
449433605517 PREDICTED: DEAD-box ATP-dependent RNA he 0.9 0.922 0.823 0.0
225443938516 PREDICTED: DEAD-box ATP-dependent RNA he 0.901 0.926 0.812 0.0
240255886522 RNA helicase 1 [Arabidopsis thaliana] gi 0.896 0.909 0.741 0.0
297804642522 hypothetical protein ARALYDRAFT_493299 [ 0.896 0.909 0.738 0.0
255584180469 dead box ATP-dependent RNA helicase, put 0.826 0.933 0.748 0.0
357491905497 DEAD-box ATP-dependent RNA helicase [Med 0.901 0.961 0.695 0.0
5281020474 ATP-dependent RNA helicase like protein 0.813 0.909 0.756 0.0
115449213521 Os02g0795900 [Oryza sativa Japonica Grou 0.883 0.898 0.660 1e-180
47497023517 putative DEAD box-like RNA helicase [Ory 0.884 0.907 0.658 1e-180
>gi|224077862|ref|XP_002305441.1| predicted protein [Populus trichocarpa] gi|222848405|gb|EEE85952.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/482 (82%), Positives = 436/482 (90%), Gaps = 4/482 (0%)

Query: 1   MEEA----KKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQV 56
           MEE+    + K++PVLPWMRSPVDVS FE+ PLD LPCLDPRLK+ALQNMG  +LFPVQ+
Sbjct: 1   MEESTIAKQNKNVPVLPWMRSPVDVSKFEEYPLDILPCLDPRLKMALQNMGFKTLFPVQI 60

Query: 57  AVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQ 116
           AVWQETIGPG FERDLCINSPTGSGKTL+YALPIVQ LS RAV+CLRALVVLPTRDLALQ
Sbjct: 61  AVWQETIGPGAFERDLCINSPTGSGKTLAYALPIVQLLSTRAVKCLRALVVLPTRDLALQ 120

Query: 117 VKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDIL 176
           VK VFAAIAPA+GLSVGLAVGQSSIADEISELIK+P+ EAGICYDP+DVLQELQS+VDIL
Sbjct: 121 VKQVFAAIAPAMGLSVGLAVGQSSIADEISELIKKPEHEAGICYDPQDVLQELQSSVDIL 180

Query: 177 VATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDA 236
           VATPGRLMDHI  T+GFTLEHLCYLVVDETDRLLRE+YQ+WLPTVL+LTR  +E+     
Sbjct: 181 VATPGRLMDHITTTKGFTLEHLCYLVVDETDRLLRESYQSWLPTVLKLTRPYDESLVPGV 240

Query: 237 STFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTT 296
           + FLP A GSLKTIRRCGVERGFK K YPRL KMVLSATLTQDP+KLAQL+LHHPLFLTT
Sbjct: 241 NNFLPCASGSLKTIRRCGVERGFKGKSYPRLAKMVLSATLTQDPSKLAQLNLHHPLFLTT 300

Query: 297 GETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFG 356
           G+ RY+LPE+LESYKLIC SKLKPLYLVA+LQ LG EKCIVFTSSVESTHRLCTLLN FG
Sbjct: 301 GQRRYQLPEKLESYKLICVSKLKPLYLVAVLQHLGGEKCIVFTSSVESTHRLCTLLNFFG 360

Query: 357 ELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYI 416
           +L++KIKEYSGLQRQSVRSKTLKAFREG+IQVLVSSDAMTRGMD+EGV N++NYD PAY+
Sbjct: 361 DLKVKIKEYSGLQRQSVRSKTLKAFREGEIQVLVSSDAMTRGMDIEGVRNIINYDMPAYV 420

Query: 417 KTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVY 476
           KTY+HRAGRTARAGQ GRC TLL   EVKRFKKLLQKADNDSCPI+SIPSS ++SL P Y
Sbjct: 421 KTYVHRAGRTARAGQTGRCITLLRTHEVKRFKKLLQKADNDSCPIYSIPSSSVKSLHPFY 480

Query: 477 KS 478
            S
Sbjct: 481 LS 482




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449433605|ref|XP_004134588.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1-like [Cucumis sativus] gi|449490565|ref|XP_004158642.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225443938|ref|XP_002279094.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1 [Vitis vinifera] gi|297740757|emb|CBI30939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|240255886|ref|NP_193320.6| RNA helicase 1 [Arabidopsis thaliana] gi|334302879|sp|Q7FGZ2.3|RH1_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 1 gi|332658259|gb|AEE83659.1| RNA helicase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297804642|ref|XP_002870205.1| hypothetical protein ARALYDRAFT_493299 [Arabidopsis lyrata subsp. lyrata] gi|297316041|gb|EFH46464.1| hypothetical protein ARALYDRAFT_493299 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255584180|ref|XP_002532829.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223527420|gb|EEF29559.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357491905|ref|XP_003616240.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355517575|gb|AES99198.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|5281020|emb|CAB45993.1| ATP-dependent RNA helicase like protein [Arabidopsis thaliana] gi|7268333|emb|CAB78627.1| ATP-dependent RNA helicase like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115449213|ref|NP_001048386.1| Os02g0795900 [Oryza sativa Japonica Group] gi|122170850|sp|Q0DWT8.1|RH1_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 1 gi|113537917|dbj|BAF10300.1| Os02g0795900 [Oryza sativa Japonica Group] gi|215740532|dbj|BAG97188.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|47497023|dbj|BAD19076.1| putative DEAD box-like RNA helicase [Oryza sativa Japonica Group] gi|47497232|dbj|BAD19277.1| putative DEAD box-like RNA helicase [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query530
TAIR|locus:2130839522 RH1 "RNA helicase 1" [Arabidop 0.896 0.909 0.741 3.8e-188
UNIPROTKB|E2R5R1631 DDX51 "Uncharacterized protein 0.841 0.706 0.397 4.3e-77
UNIPROTKB|F1MGC9546 DDX51 "Uncharacterized protein 0.843 0.818 0.384 7.1e-77
UNIPROTKB|Q8N8A6666 DDX51 "ATP-dependent RNA helic 0.843 0.671 0.392 8.1e-76
ZFIN|ZDB-GENE-040927-28652 ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.850 0.691 0.380 4e-74
RGD|1309580635 Ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.839 0.700 0.380 6.5e-74
MGI|MGI:1916913639 Ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.845 0.701 0.381 1.4e-73
UNIPROTKB|E1BUI4676 DDX51 "Uncharacterized protein 0.845 0.662 0.387 2.8e-73
FB|FBgn0004556687 Dbp73D "Dead box protein 73D" 0.881 0.679 0.361 4.6e-57
ASPGD|ASPL0000059362853 AN0637 [Emericella nidulans (t 0.292 0.181 0.388 9.2e-55
TAIR|locus:2130839 RH1 "RNA helicase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1824 (647.1 bits), Expect = 3.8e-188, P = 3.8e-188
 Identities = 352/475 (74%), Positives = 410/475 (86%)

Query:     2 EEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQE 61
             +E K +   V+PWMR+PVDVS  E+C LD LPCL+P+LK AL+NMGISSLFPVQVAVW E
Sbjct:     5 KEDKTEMDSVVPWMRAPVDVSNVENCALDTLPCLNPKLKKALENMGISSLFPVQVAVWHE 64

Query:    62 TIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVKDVF 121
             TIGPG FERD+C+NSPTGSGKTLSYALPIVQ L++R VRCLRALVVLPTRDLALQVKDVF
Sbjct:    65 TIGPGGFERDICVNSPTGSGKTLSYALPIVQLLASRPVRCLRALVVLPTRDLALQVKDVF 124

Query:   122 AAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPG 181
              AIAPAVGLSVG AVGQSSIA EIS+LIK PKL+AGICYDP+D+ Q L+SAVDILVATPG
Sbjct:   125 DAIAPAVGLSVGSAVGQSSIAGEISQLIKTPKLDAGICYDPDDLSQNLESAVDILVATPG 184

Query:   182 RLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLP 241
             RLMDHIN T+GFTLEHL YLVVDETDRLLREAYQ+WLPTVLQLT++ +++ F   + F+P
Sbjct:   185 RLMDHINNTKGFTLEHLRYLVVDETDRLLREAYQSWLPTVLQLTQTSDDSLFPSFTPFVP 244

Query:   242 SAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRY 301
             SAFGSL+T+RR  VERGFK KPYPRLVKMVLSATLTQDP+KL QLDLHHPLF+TTG +RY
Sbjct:   245 SAFGSLQTVRRQSVERGFKGKPYPRLVKMVLSATLTQDPSKLIQLDLHHPLFMTTGGSRY 304

Query:   302 KLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIK 361
             +LPE+LE  +LICE+ +KP+YLVALL+S   EKCI+FTSSVE+T RLC LLN FG+ +IK
Sbjct:   305 RLPEKLECLRLICETGMKPVYLVALLKSWEGEKCIIFTSSVETTRRLCKLLNFFGDPKIK 364

Query:   362 IKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIH 421
              KEYSG   QS+RSK LKAFR+G IQVLV+SDA+TRGMDV+GV NV+NYD P + KT+IH
Sbjct:   365 AKEYSGGLNQSLRSKELKAFRKGDIQVLVASDALTRGMDVKGVTNVINYDMPPFAKTFIH 424

Query:   422 RAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVY 476
             RAGRTARAGQ GRCFTLL   EV+RF KLL+K  +DSCPI+ IP + ++S+R  Y
Sbjct:   425 RAGRTARAGQAGRCFTLLSNHEVRRFSKLLEKVGSDSCPIYPIPPTSLDSIRATY 479




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0017151 "DEAD/H-box RNA helicase binding" evidence=TAS
UNIPROTKB|E2R5R1 DDX51 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGC9 DDX51 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8A6 DDX51 "ATP-dependent RNA helicase DDX51" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-28 ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309580 Ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916913 Ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUI4 DDX51 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0004556 Dbp73D "Dead box protein 73D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059362 AN0637 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7FGZ2RH1_ARATH3, ., 6, ., 4, ., 1, 30.74100.89620.9099yesno
Q0DWT8RH1_ORYSJ3, ., 6, ., 4, ., 1, 30.66020.88300.8982yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.IV.639.1
hypothetical protein (486 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.8412.1.1
annotation not avaliable (96 aa)
       0.501
estExt_fgenesh4_pg.C_1310004
hypothetical protein (402 aa)
       0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query530
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-73
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-37
cd00268203 cd00268, DEADc, DEAD-box helicases 4e-37
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 4e-35
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-31
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 2e-29
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 2e-28
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-28
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-27
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 5e-27
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 6e-27
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-26
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-25
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-24
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-23
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 7e-21
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-20
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-19
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-17
COG1205 851 COG1205, COG1205, Distinct helicase family with a 3e-13
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 1e-10
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 5e-10
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 3e-09
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 3e-07
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 7e-07
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 2e-06
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 1e-05
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 4e-05
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 4e-04
COG1205 851 COG1205, COG1205, Distinct helicase family with a 5e-04
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 7e-04
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 0.001
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 0.002
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  241 bits (616), Expect = 3e-73
 Identities = 116/441 (26%), Positives = 204/441 (46%), Gaps = 72/441 (16%)

Query: 35  LDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTL 94
           L P L  AL+++G     P+Q       I   L  RD+   + TG+GKT ++ LP++Q +
Sbjct: 36  LSPELLQALKDLGFEEPTPIQ----LAAIPLILAGRDVLGQAQTGTGKTAAFLLPLLQKI 91

Query: 95  SNRA-VRCLRALVVLPTRDLALQVKDVFAAIAPAV-GLSVGLAVGQSSIADEISELIKRP 152
                 + + AL++ PTR+LA+Q+ +    +   + GL V +  G  SI  +I       
Sbjct: 92  LKSVERKYVSALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVSIRKQI------- 144

Query: 153 KLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLRE 212
                         + L+  VDI+VATPGRL+D I   +   L  +  LV+DE DR+L  
Sbjct: 145 --------------EALKRGVDIVVATPGRLLDLIKRGK-LDLSGVETLVLDEADRMLD- 188

Query: 213 AYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVL 272
               ++  + ++ ++   +R                                     ++ 
Sbjct: 189 --MGFIDDIEKILKALPPDR-----------------------------------QTLLF 211

Query: 273 SATLTQDPNKLAQLDLHHPLFLTTG-ETRYKLPERLESYKLICESK-LKPLYLVALLQSL 330
           SAT+  D  +LA+  L+ P+ +    E   +  ++++ + L  ES+  K   L+ LL+  
Sbjct: 212 SATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEVESEEEKLELLLKLLKDE 271

Query: 331 GEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLV 390
            E + IVF  +      L   L   G    K+    G   Q  R + L+ F++G+++VLV
Sbjct: 272 DEGRVIVFVRTKRLVEELAESLRKRG---FKVAALHGDLPQEERDRALEKFKDGELRVLV 328

Query: 391 SSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLL-HKDEVKRFKK 449
           ++D   RG+D+  V++V+NYD P   + Y+HR GRT RAG+ G   + +  ++EVK+ K+
Sbjct: 329 ATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEEEVKKLKR 388

Query: 450 LLQKADNDSCPIHSIPSSLIE 470
           + ++ +        +P    E
Sbjct: 389 IEKRLERKLPSAVLLPLDEPE 409


Length = 513

>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 530
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK09200 790 preprotein translocase subunit SecA; Reviewed 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 100.0
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
KOG0354 746 consensus DEAD-box like helicase [General function 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
KOG0353 695 consensus ATP-dependent DNA helicase [General func 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
PRK09694 878 helicase Cas3; Provisional 100.0
PRK05580679 primosome assembly protein PriA; Validated 100.0
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.98
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.97
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.97
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.97
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.97
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.97
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.97
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.97
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.96
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.96
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.96
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.95
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.95
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.93
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.93
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.93
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.92
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.92
PRK05298652 excinuclease ABC subunit B; Provisional 99.9
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.9
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.9
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.89
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.89
COG4096 875 HsdR Type I site-specific restriction-modification 99.89
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.88
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.88
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.88
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.88
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.86
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.85
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.85
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.85
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.84
KOG1123776 consensus RNA polymerase II transcription initiati 99.84
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.83
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.83
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.82
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.82
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.82
COG4889 1518 Predicted helicase [General function prediction on 99.82
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.8
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.8
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.8
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.79
smart00487201 DEXDc DEAD-like helicases superfamily. 99.79
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.78
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.78
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.78
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.77
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.75
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.75
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.74
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.74
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.73
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.73
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.72
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.69
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.66
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.64
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.61
smart0049082 HELICc helicase superfamily c-terminal domain. 99.6
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.6
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.58
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.56
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.54
PRK14873665 primosome assembly protein PriA; Provisional 99.53
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.52
KOG4439901 consensus RNA polymerase II transcription terminat 99.48
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.46
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.46
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.43
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.35
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.34
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.32
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.32
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.16
COG0610 962 Type I site-specific restriction-modification syst 99.15
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.12
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.1
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.1
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.92
PRK15483 986 type III restriction-modification system StyLTI en 98.62
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.61
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.57
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.54
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 98.38
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.32
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 98.24
KOG1001674 consensus Helicase-like transcription factor HLTF/ 98.2
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.16
PF1324576 AAA_19: Part of AAA domain 98.13
KOG1803649 consensus DNA helicase [Replication, recombination 98.09
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.07
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.05
TIGR00376637 DNA helicase, putative. The gene product may repre 98.04
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 98.02
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.99
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.97
KOG18051100 consensus DNA replication helicase [Replication, r 97.76
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.75
KOG1131 755 consensus RNA polymerase II transcription initiati 97.73
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.73
PRK10536262 hypothetical protein; Provisional 97.69
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.63
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.49
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.46
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 97.41
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.4
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.4
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 97.38
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.31
PRK11054684 helD DNA helicase IV; Provisional 97.29
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.28
PRK06526254 transposase; Provisional 97.25
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.21
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.19
PRK08181269 transposase; Validated 97.11
PRK04296190 thymidine kinase; Provisional 97.05
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.03
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.98
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.97
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 96.92
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.9
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.76
KOG0383696 consensus Predicted helicase [General function pre 96.73
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 96.68
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.6
PRK06921266 hypothetical protein; Provisional 96.59
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.56
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 96.53
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 96.5
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.5
PF13871278 Helicase_C_4: Helicase_C-like 96.48
PRK14974336 cell division protein FtsY; Provisional 96.25
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.19
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.18
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.18
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.15
PRK05707328 DNA polymerase III subunit delta'; Validated 96.13
PRK07952244 DNA replication protein DnaC; Validated 96.12
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.1
smart00382148 AAA ATPases associated with a variety of cellular 96.03
PRK14087450 dnaA chromosomal replication initiation protein; P 95.96
PRK08769319 DNA polymerase III subunit delta'; Validated 95.95
PRK00149450 dnaA chromosomal replication initiation protein; R 95.92
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.92
CHL00181287 cbbX CbbX; Provisional 95.88
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.86
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 95.82
PRK12377248 putative replication protein; Provisional 95.82
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.81
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.78
PTZ001121164 origin recognition complex 1 protein; Provisional 95.74
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.73
PRK06893229 DNA replication initiation factor; Validated 95.72
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.72
PRK08727233 hypothetical protein; Validated 95.7
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.69
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.68
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.65
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.65
PHA03333 752 putative ATPase subunit of terminase; Provisional 95.64
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 95.61
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.55
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.52
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.51
PRK05642234 DNA replication initiation factor; Validated 95.45
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.41
PRK08084235 DNA replication initiation factor; Provisional 95.35
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.35
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.31
PHA02533534 17 large terminase protein; Provisional 95.3
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.29
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.29
PRK08116268 hypothetical protein; Validated 95.28
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.28
COG3973747 Superfamily I DNA and RNA helicases [General funct 95.27
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 95.26
PF00004132 AAA: ATPase family associated with various cellula 95.25
COG4626546 Phage terminase-like protein, large subunit [Gener 95.23
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.2
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.2
PTZ00293211 thymidine kinase; Provisional 95.19
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 95.17
PHA02544316 44 clamp loader, small subunit; Provisional 95.16
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.12
PRK11823446 DNA repair protein RadA; Provisional 95.09
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.08
PLN03025319 replication factor C subunit; Provisional 94.99
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.98
PRK05580 679 primosome assembly protein PriA; Validated 94.97
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.95
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.95
PRK14086617 dnaA chromosomal replication initiation protein; P 94.95
PRK13833323 conjugal transfer protein TrbB; Provisional 94.95
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 94.94
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 94.9
PRK12422445 chromosomal replication initiation protein; Provis 94.9
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.88
TIGR00595 505 priA primosomal protein N'. All proteins in this f 94.86
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.82
PRK14873 665 primosome assembly protein PriA; Provisional 94.8
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.79
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.7
PRK08939306 primosomal protein DnaI; Reviewed 94.62
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.55
PRK09183259 transposase/IS protein; Provisional 94.55
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.54
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.51
COG0593408 DnaA ATPase involved in DNA replication initiation 94.5
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.4
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.39
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.37
PRK14088440 dnaA chromosomal replication initiation protein; P 94.27
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.26
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.25
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.24
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 94.23
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.21
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.17
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 94.15
PRK05973237 replicative DNA helicase; Provisional 94.13
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.12
PRK10689 1147 transcription-repair coupling factor; Provisional 94.08
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.03
PRK06871325 DNA polymerase III subunit delta'; Validated 94.02
PRK13342413 recombination factor protein RarA; Reviewed 94.01
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.0
PRK12402337 replication factor C small subunit 2; Reviewed 93.9
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.86
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 93.85
PRK06835329 DNA replication protein DnaC; Validated 93.85
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.83
KOG2028554 consensus ATPase related to the helicase subunit o 93.79
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 93.79
TIGR02012321 tigrfam_recA protein RecA. This model describes or 93.76
COG2255332 RuvB Holliday junction resolvasome, helicase subun 93.76
cd01394218 radB RadB. The archaeal protein radB shares simila 93.68
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.65
PRK08699325 DNA polymerase III subunit delta'; Validated 93.63
PRK07993334 DNA polymerase III subunit delta'; Validated 93.59
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.54
PRK06067234 flagellar accessory protein FlaH; Validated 93.53
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.51
PRK07471365 DNA polymerase III subunit delta'; Validated 93.49
cd00983325 recA RecA is a bacterial enzyme which has roles in 93.45
PRK13341 725 recombination factor protein RarA/unknown domain f 93.42
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.39
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.35
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 93.33
PHA03368738 DNA packaging terminase subunit 1; Provisional 93.3
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 93.3
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.28
TIGR00959428 ffh signal recognition particle protein. This mode 93.23
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.21
PF13173128 AAA_14: AAA domain 93.19
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 93.18
PRK06964342 DNA polymerase III subunit delta'; Validated 93.17
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.15
TIGR00767415 rho transcription termination factor Rho. Members 93.07
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.07
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.03
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 93.0
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.0
PRK10867433 signal recognition particle protein; Provisional 92.97
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 92.94
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 92.94
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 92.88
TIGR00064272 ftsY signal recognition particle-docking protein F 92.84
cd03115173 SRP The signal recognition particle (SRP) mediates 92.8
PRK09354349 recA recombinase A; Provisional 92.79
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 92.76
PRK04195482 replication factor C large subunit; Provisional 92.75
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 92.75
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 92.7
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.64
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 92.63
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 92.63
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.55
PRK04328249 hypothetical protein; Provisional 92.53
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 92.53
PRK06090319 DNA polymerase III subunit delta'; Validated 92.5
COG1198 730 PriA Primosomal protein N' (replication factor Y) 92.49
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.43
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.43
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 92.22
PRK07940394 DNA polymerase III subunit delta'; Validated 92.22
PRK10416318 signal recognition particle-docking protein FtsY; 92.19
PRK13897606 type IV secretion system component VirD4; Provisio 92.15
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.13
PRK00771437 signal recognition particle protein Srp54; Provisi 92.12
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 92.11
PRK13851344 type IV secretion system protein VirB11; Provision 92.11
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 92.0
PRK09112351 DNA polymerase III subunit delta'; Validated 91.98
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 91.92
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 91.91
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 91.9
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.9
PRK00440319 rfc replication factor C small subunit; Reviewed 91.76
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 91.69
cd01128249 rho_factor Transcription termination factor rho is 91.68
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 91.65
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 91.57
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 91.46
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 91.41
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.4
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.38
PRK14701 1638 reverse gyrase; Provisional 91.36
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 91.22
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 91.21
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 91.17
CHL00095821 clpC Clp protease ATP binding subunit 91.12
PRK09376416 rho transcription termination factor Rho; Provisio 91.02
TIGR00763775 lon ATP-dependent protease La. This protein is ind 90.87
PRK10436462 hypothetical protein; Provisional 90.84
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 90.83
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 90.72
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 90.71
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 90.52
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 90.4
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 90.37
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 90.31
PRK08533230 flagellar accessory protein FlaH; Reviewed 90.3
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 90.28
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 90.21
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 90.17
PHA02244383 ATPase-like protein 90.16
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 90.14
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 90.09
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 90.03
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 90.0
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 89.98
PRK13850670 type IV secretion system protein VirD4; Provisiona 89.93
COG0552340 FtsY Signal recognition particle GTPase [Intracell 89.82
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 89.78
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 89.75
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 89.67
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 89.65
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 89.55
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 89.54
TIGR02533486 type_II_gspE general secretory pathway protein E. 89.54
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 89.54
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 89.43
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 89.42
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 89.28
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 89.21
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 89.19
PF12846304 AAA_10: AAA-like domain 89.16
KOG2228408 consensus Origin recognition complex, subunit 4 [R 89.12
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 89.1
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 89.05
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 89.01
PRK08760476 replicative DNA helicase; Provisional 88.86
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 88.85
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 88.84
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 88.84
PRK12608380 transcription termination factor Rho; Provisional 88.77
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 88.75
PRK04841 903 transcriptional regulator MalT; Provisional 88.73
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 88.73
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 88.72
PHA00350399 putative assembly protein 88.66
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 88.63
PRK07004460 replicative DNA helicase; Provisional 88.61
COG4098441 comFA Superfamily II DNA/RNA helicase required for 88.53
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 88.53
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 88.52
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 88.47
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.39
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 88.39
PRK07399314 DNA polymerase III subunit delta'; Validated 88.34
PRK06904472 replicative DNA helicase; Validated 88.14
PF1355562 AAA_29: P-loop containing region of AAA domain 88.12
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 88.05
PRK08506472 replicative DNA helicase; Provisional 88.04
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 87.97
KOG0745564 consensus Putative ATP-dependent Clp-type protease 87.9
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 87.85
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 87.69
TIGR02237209 recomb_radB DNA repair and recombination protein R 87.67
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 87.62
PRK13822641 conjugal transfer coupling protein TraG; Provision 87.6
PRK09361225 radB DNA repair and recombination protein RadB; Pr 87.51
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 87.51
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 87.32
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 87.28
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 87.18
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 87.15
KOG2170344 consensus ATPase of the AAA+ superfamily [General 86.91
PRK13876663 conjugal transfer coupling protein TraG; Provision 86.87
PRK08006471 replicative DNA helicase; Provisional 86.78
TIGR03743634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 86.75
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 86.58
PRK08058329 DNA polymerase III subunit delta'; Validated 86.55
PHA00012361 I assembly protein 86.54
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 86.51
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 86.48
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 86.42
PTZ00110545 helicase; Provisional 86.4
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 86.39
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 86.36
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 86.12
PRK13531498 regulatory ATPase RavA; Provisional 86.06
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 86.04
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 86.03
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 85.97
COG0556663 UvrB Helicase subunit of the DNA excision repair c 85.88
CHL00095 821 clpC Clp protease ATP binding subunit 85.87
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 85.85
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=1.8e-70  Score=498.42  Aligned_cols=387  Identities=34%  Similarity=0.506  Sum_probs=347.5

Q ss_pred             ccCCCCCCCCCCCCCCCHHHHHHHHHCCCCccchhhHHHHHHhcCCCCCCCcEEEECCCCchHHHHHHHHHHHHhhhcCC
Q 009641           20 DVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAV   99 (530)
Q Consensus        20 ~~~~~~~~~~~~~~~l~~~i~~~l~~~g~~~~~~~Q~~a~~~~~~~~~~~~~~li~apTGsGKT~~~~~~~l~~l~~~~~   99 (530)
                      ...+|.++      +++|.+++++++.||..|+++|++|++.+    +.|+|+|..|.||||||.+|++|++++|...+ 
T Consensus        59 ~~~sf~dL------gv~~~L~~ac~~l~~~~PT~IQ~~aiP~~----L~g~dvIglAeTGSGKT~afaLPIl~~LL~~p-  127 (476)
T KOG0330|consen   59 SFKSFADL------GVHPELLEACQELGWKKPTKIQSEAIPVA----LGGRDVIGLAETGSGKTGAFALPILQRLLQEP-  127 (476)
T ss_pred             hhcchhhc------CcCHHHHHHHHHhCcCCCchhhhhhcchh----hCCCcEEEEeccCCCchhhhHHHHHHHHHcCC-
Confidence            34456666      69999999999999999999999986655    46999999999999999999999999999854 


Q ss_pred             CcccEEEEcCcHHHHHHHHHHHHHhccccCceEEEeecCCchHHHHHHHhhcCccccCccCCchhHHHhhcCCCcEEEeC
Q 009641          100 RCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVAT  179 (530)
Q Consensus       100 ~~~~~lil~Pt~~L~~Q~~~~l~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ili~T  179 (530)
                      +.+.++|++|||+||.|+.+.+..++...|+++.++.||.+...+...+.                     +.|+|+|+|
T Consensus       128 ~~~~~lVLtPtRELA~QI~e~fe~Lg~~iglr~~~lvGG~~m~~q~~~L~---------------------kkPhilVaT  186 (476)
T KOG0330|consen  128 KLFFALVLTPTRELAQQIAEQFEALGSGIGLRVAVLVGGMDMMLQANQLS---------------------KKPHILVAT  186 (476)
T ss_pred             CCceEEEecCcHHHHHHHHHHHHHhccccCeEEEEEecCchHHHHHHHhh---------------------cCCCEEEeC
Confidence            56899999999999999999999999999999999999998877766544                     567999999


Q ss_pred             ChHHHHHHhcCCCCCCCCccEEEEechhHhhhHhhhhHHHHHHhhcccCcccccccccccccccccchhhhhccccccCC
Q 009641          180 PGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGF  259 (530)
Q Consensus       180 p~~l~~~l~~~~~~~~~~~~~lViDEah~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  259 (530)
                      |++|++++.+.+.+++..++++|+||||+++++.|...+..|+..++..                               
T Consensus       187 PGrL~dhl~~Tkgf~le~lk~LVlDEADrlLd~dF~~~ld~ILk~ip~e-------------------------------  235 (476)
T KOG0330|consen  187 PGRLWDHLENTKGFSLEQLKFLVLDEADRLLDMDFEEELDYILKVIPRE-------------------------------  235 (476)
T ss_pred             cHHHHHHHHhccCccHHHhHHHhhchHHhhhhhhhHHHHHHHHHhcCcc-------------------------------
Confidence            9999999998899999999999999999999999999999999988743                               


Q ss_pred             CCCCCCceeeEEEeEeecCChhhhhhhccCCceEEecCCccccCcccceeeEeeccCCCcHHHHHHHHHhcCCCcEEEEc
Q 009641          260 KDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFT  339 (530)
Q Consensus       260 ~~~~~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~l~~~l~~~~~~~~iVf~  339 (530)
                             .++++||||++..+.++....+..|..+...... .....+.+++.+.+...|..+|..+++...+..+||||
T Consensus       236 -------rqt~LfsATMt~kv~kL~rasl~~p~~v~~s~ky-~tv~~lkQ~ylfv~~k~K~~yLV~ll~e~~g~s~iVF~  307 (476)
T KOG0330|consen  236 -------RQTFLFSATMTKKVRKLQRASLDNPVKVAVSSKY-QTVDHLKQTYLFVPGKDKDTYLVYLLNELAGNSVIVFC  307 (476)
T ss_pred             -------ceEEEEEeecchhhHHHHhhccCCCeEEeccchh-cchHHhhhheEeccccccchhHHHHHHhhcCCcEEEEE
Confidence                   2899999999999999999999999988876543 45566778888899999999999999999999999999


Q ss_pred             CChHHHHHHHHHHHhcCCCcceEEEccccCCHHHHHHHHHHHhcCCccEEEEecccccCCCCCCCCEEEEccCCCChhHH
Q 009641          340 SSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTY  419 (530)
Q Consensus       340 ~s~~~~~~l~~~L~~~~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~~~iLVaT~~~~~GiDip~~~~VI~~~~p~s~~~y  419 (530)
                      ++...++.++-.|...+   +.+..+||.|++..|.-.++.|++|..+||||||+++||+|+|.+++|||||+|.+..+|
T Consensus       308 ~t~~tt~~la~~L~~lg---~~a~~LhGqmsq~~Rlg~l~~Fk~~~r~iLv~TDVaSRGLDip~Vd~VVNyDiP~~skDY  384 (476)
T KOG0330|consen  308 NTCNTTRFLALLLRNLG---FQAIPLHGQMSQSKRLGALNKFKAGARSILVCTDVASRGLDIPHVDVVVNYDIPTHSKDY  384 (476)
T ss_pred             eccchHHHHHHHHHhcC---cceecccchhhHHHHHHHHHHHhccCCcEEEecchhcccCCCCCceEEEecCCCCcHHHH
Confidence            99999999999999776   999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhhcCCCCccEEEEeecchHHHHHHHHHHhcCCCCCCcCCChhHHhhhHHHHHHHHh
Q 009641          420 IHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSVRG  481 (530)
Q Consensus       420 ~Qr~GR~gR~g~~g~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  481 (530)
                      +||+||+||+|+.|.++.+++..|.+.+.+|...+.+ ..+..+++.+..-.+.+++.++..
T Consensus       385 IHRvGRtaRaGrsG~~ItlVtqyDve~~qrIE~~~gk-kl~~~~~~~~~~~~l~erv~eA~~  445 (476)
T KOG0330|consen  385 IHRVGRTARAGRSGKAITLVTQYDVELVQRIEHALGK-KLPEYKVDKNEVMSLNERVAEAQK  445 (476)
T ss_pred             HHHcccccccCCCcceEEEEehhhhHHHHHHHHHHhc-CCCccCcchHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999777753 455566777666666665555544



>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query530
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-30
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 2e-30
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-30
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-30
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 3e-27
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 3e-27
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-24
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-23
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-22
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-22
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-22
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-22
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-22
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-22
2vso_A395 Crystal Structure Of A Translation Initiation Compl 8e-22
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-20
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 5e-20
1fuu_A394 Yeast Initiation Factor 4a Length = 394 5e-20
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 6e-20
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 6e-18
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-17
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-17
3ly5_A262 Ddx18 Dead-Domain Length = 262 9e-17
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 6e-15
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 2e-14
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 5e-14
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-14
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-14
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 6e-14
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 8e-14
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-13
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-13
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-13
2jgn_A185 Ddx3 Helicase Domain Length = 185 1e-13
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-13
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-13
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-13
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-13
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-13
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 7e-13
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 1e-12
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 2e-12
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-12
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 9e-11
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-10
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-10
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 2e-10
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 2e-10
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-10
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 4e-10
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 4e-10
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 4e-10
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 5e-10
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 6e-10
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 8e-10
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-08
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 2e-08
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 4e-07
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 7e-07
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 9e-05
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 2e-04
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 5e-04
2fwr_A472 Structure Of Archaeoglobus Fulgidis Xpb Length = 47 6e-04
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure

Iteration: 1

Score = 130 bits (328), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 122/447 (27%), Positives = 199/447 (44%), Gaps = 86/447 (19%) Query: 34 CLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLF--ERDLCINSPTGSGKTLSYALPIV 91 LD + A+ M L PVQ Q+TI P L + D+ + TG+GKT ++ +PI Sbjct: 78 VLDKEIHKAITRMEFPGLTPVQ----QKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIF 133 Query: 92 QTLSNRAVRC---LRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLA-------VGQSSI 141 Q L N ++A++V PTRDLALQ++ A + ++ GL VG + Sbjct: 134 QHLINTKFDSQYMVKAVIVAPTRDLALQIE---AEVKKIHDMNYGLKKYACVSLVGGTDF 190 Query: 142 ADEISELIK-RPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCY 200 ++++ K RP +I++ATPGRL+D + + Y Sbjct: 191 RAAMNKMNKLRP---------------------NIVIATPGRLIDVLEKYSNKFFRFVDY 229 Query: 201 LVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFK 260 V+DE DRLL ++ L T+ + N + T L Sbjct: 230 KVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLL-------------------- 269 Query: 261 DKPYPRLVKMVLSATLTQDPNKLAQ--LDLHHPLFL-TTGETRYKLPERLESYKLICESK 317 SATL KLA ++ LFL T + + ER++ +I E Sbjct: 270 -----------FSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKF 318 Query: 318 LKPLYLVALLQSLGEE--------KCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQ 369 ++ A ++ + ++ K I+F +V+ T LC++L + + + I E+ G Sbjct: 319 ANSIF--AAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKI 376 Query: 370 RQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARA 429 Q+ R+ +K F++ + +LV +D RGMD V+ V+ P+ + YIHR GRTAR+ Sbjct: 377 TQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARS 436 Query: 430 GQLGRCFTLLHKDEVKRFKKLLQKADN 456 G+ G + KDE+ F + L+ A N Sbjct: 437 GKEGSSVLFICKDELP-FVRELEDAKN 462
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query530
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 4e-80
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 8e-78
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-56
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-52
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-52
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 8e-52
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-51
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-50
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 3e-49
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 4e-49
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-47
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 4e-47
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-46
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 9e-45
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 9e-44
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-40
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-40
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 7e-39
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 3e-31
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 1e-29
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 7e-28
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 8e-28
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-26
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-26
3bor_A237 Human initiation factor 4A-II; translation initiat 5e-26
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 5e-25
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-24
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 6e-24
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 7e-24
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-23
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-23
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-23
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-23
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-23
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-23
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-23
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 9e-23
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-20
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 2e-22
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-22
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-21
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-18
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 7e-12
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-11
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 7e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 7e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-07
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 8e-11
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-08
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-10
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-07
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 7e-10
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 7e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 8e-10
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 9e-08
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 1e-07
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-07
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-07
3b6e_A216 Interferon-induced helicase C domain-containing P; 5e-06
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  260 bits (665), Expect = 4e-80
 Identities = 121/484 (25%), Positives = 197/484 (40%), Gaps = 80/484 (16%)

Query: 2   EEAKKKSMPVLPWMRSPVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQE 61
             +K   +P     +     SL E+  LD        +  A+  M    L PVQ    Q+
Sbjct: 52  TFSKLIHVPKEDNSKEVTLDSLLEEGVLD------KEIHKAITRMEFPGLTPVQ----QK 101

Query: 62  TIGPGLF--ERDLCINSPTGSGKTLSYALPIVQTLSNR---AVRCLRALVVLPTRDLALQ 116
           TI P L   + D+   + TG+GKT ++ +PI Q L N    +   ++A++V PTRDLALQ
Sbjct: 102 TIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQ 161

Query: 117 VKDVFAAIA----PAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSA 172
           ++     I          +    VG +     ++++ K                      
Sbjct: 162 IEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLR-------------------- 201

Query: 173 VDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENR 232
            +I++ATPGRL+D +          + Y V+DE DRLL   ++  L T+  +    N   
Sbjct: 202 PNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKS 261

Query: 233 FSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPL 292
             +  T L                  F             SATL     KLA   ++   
Sbjct: 262 ADNIKTLL------------------F-------------SATLDDKVQKLANNIMNKKE 290

Query: 293 FL---TTGETRYKLPERLESYKLICESKLKPLYLVA------LLQSLGEEKCIVFTSSVE 343
            L   T  +   +  ER++   +I E     ++         + +     K I+F  +V+
Sbjct: 291 CLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVK 350

Query: 344 STHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEG 403
            T  LC++L +  +  + I E+ G   Q+ R+  +K F++ +  +LV +D   RGMD   
Sbjct: 351 FTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPN 410

Query: 404 VNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHS 463
           V+ V+    P+ +  YIHR GRTAR+G+ G     + KDE   F + L+ A N       
Sbjct: 411 VHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDE-LPFVRELEDAKNIVIAKQE 469

Query: 464 IPSS 467
               
Sbjct: 470 KYEP 473


>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query530
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3jux_A 822 Protein translocase subunit SECA; protein transloc 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.98
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.98
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.98
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.98
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.98
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.98
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.96
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.96
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.96
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.96
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.95
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.95
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.95
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.95
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.95
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.87
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.92
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.9
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.88
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.86
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.85
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.83
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.78
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.78
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.6
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.27
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.17
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.11
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.09
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 98.05
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.83
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.6
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.47
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 97.26
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 97.18
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.03
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.89
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.75
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.75
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.61
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.58
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.36
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.34
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.23
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.17
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.17
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.03
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.91
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.89
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.27
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.13
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.0
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.87
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.68
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.62
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.38
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 94.25
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.19
3bos_A242 Putative DNA replication factor; P-loop containing 94.04
2gno_A305 DNA polymerase III, gamma subunit-related protein; 94.04
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.82
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 93.38
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.23
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.23
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 93.16
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 92.99
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 92.98
2z43_A324 DNA repair and recombination protein RADA; archaea 92.7
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 92.69
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 92.49
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 92.44
3pvs_A447 Replication-associated recombination protein A; ma 92.42
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 92.29
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 92.26
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 92.18
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.1
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 92.1
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.05
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 91.9
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 91.83
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 91.28
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 90.99
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 90.97
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 90.33
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 90.29
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 89.82
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 89.82
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 89.42
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 89.39
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 89.02
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 88.93
1tue_A212 Replication protein E1; helicase, replication, E1E 88.7
3io5_A333 Recombination and repair protein; storage dimer, i 88.66
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 88.61
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.29
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 88.08
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 87.49
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.46
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 87.43
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 87.35
3bor_A237 Human initiation factor 4A-II; translation initiat 86.8
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 86.52
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.52
2qgz_A308 Helicase loader, putative primosome component; str 86.46
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 86.43
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 86.37
3co5_A143 Putative two-component system transcriptional RES 86.29
2eyu_A261 Twitching motility protein PILT; pilus retraction 86.21
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 86.14
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 86.08
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 85.94
2oap_1511 GSPE-2, type II secretion system protein; hexameri 85.73
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 85.61
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 85.5
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 85.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 85.45
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 85.2
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 84.83
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 84.72
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 84.59
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 84.47
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 84.28
2r44_A331 Uncharacterized protein; putative ATPase, structur 84.06
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 84.06
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 83.74
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 82.97
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 82.94
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 82.64
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 82.57
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 82.38
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 82.17
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 82.08
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 82.01
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 81.21
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 81.08
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 81.03
2kjq_A149 DNAA-related protein; solution structure, NESG, st 80.85
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 80.78
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 80.65
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 80.49
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 80.49
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 80.21
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=7.7e-60  Score=477.94  Aligned_cols=364  Identities=25%  Similarity=0.411  Sum_probs=312.0

Q ss_pred             CcccCCCCCCCCCCCCCCCHHHHHHHHHCCCCccchhhHHHHHHhcCCCCCCCcEEEECCCCchHHHHHHHHHHHHhhhc
Q 009641           18 PVDVSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNR   97 (530)
Q Consensus        18 ~~~~~~~~~~~~~~~~~l~~~i~~~l~~~g~~~~~~~Q~~a~~~~~~~~~~~~~~li~apTGsGKT~~~~~~~l~~l~~~   97 (530)
                      |....+|+++      +|++.+.+.|+++||..|+|+|++||+.++.    ++|++++||||||||++|++|+++.+...
T Consensus        52 p~~~~~f~~~------~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~----g~d~i~~a~TGsGKT~a~~lpil~~l~~~  121 (434)
T 2db3_A           52 PQPIQHFTSA------DLRDIIIDNVNKSGYKIPTPIQKCSIPVISS----GRDLMACAQTGSGKTAAFLLPILSKLLED  121 (434)
T ss_dssp             CCCCCCGGGS------CCCHHHHHHHHHTTCCSCCHHHHHHHHHHHT----TCCEEEECCTTSSHHHHHHHHHHHHHHHS
T ss_pred             CCCcCChhhc------CCCHHHHHHHHHcCCCCCCHHHHHHHHHHhc----CCCEEEECCCCCCchHHHHHHHHHHHHhc
Confidence            4455677777      4999999999999999999999999998764    89999999999999999999999998764


Q ss_pred             C----CCcccEEEEcCcHHHHHHHHHHHHHhccccCceEEEeecCCchHHHHHHHhhcCccccCccCCchhHHHhhcCCC
Q 009641           98 A----VRCLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAV  173 (530)
Q Consensus        98 ~----~~~~~~lil~Pt~~L~~Q~~~~l~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (530)
                      .    ..++++||++||++|+.|+++.+++++...++++..++|+.....+..                     .+..++
T Consensus       122 ~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~---------------------~l~~~~  180 (434)
T 2db3_A          122 PHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNE---------------------CITRGC  180 (434)
T ss_dssp             CCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHH---------------------HHTTCC
T ss_pred             ccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHH---------------------HhhcCC
Confidence            3    236789999999999999999999999888899999999988766543                     234678


Q ss_pred             cEEEeCChHHHHHHhcCCCCCCCCccEEEEechhHhhhHhhhhHHHHHHhhcccCcccccccccccccccccchhhhhcc
Q 009641          174 DILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRC  253 (530)
Q Consensus       174 ~Ili~Tp~~l~~~l~~~~~~~~~~~~~lViDEah~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  253 (530)
                      +|+|+||++|.+++.+ ....+.++++||+||||++++.+|...+..++..+...                         
T Consensus       181 ~Ivv~Tp~~l~~~l~~-~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~-------------------------  234 (434)
T 2db3_A          181 HVVIATPGRLLDFVDR-TFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMR-------------------------  234 (434)
T ss_dssp             SEEEECHHHHHHHHHT-TSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSC-------------------------
T ss_pred             CEEEEChHHHHHHHHh-CCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCC-------------------------
Confidence            9999999999999987 45678899999999999999999999999888764321                         


Q ss_pred             ccccCCCCCCCCceeeEEEeEeecCChhhhhhhccCCceEEecCCccccCcccceeeEeeccCCCcHHHHHHHHHhcCCC
Q 009641          254 GVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEE  333 (530)
Q Consensus       254 ~~~~~~~~~~~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~l~~~l~~~~~~  333 (530)
                                 +..+++++|||++..+..+...++.++..+....... ....+.+....+....|...+..++..... 
T Consensus       235 -----------~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~-~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-  301 (434)
T 2db3_A          235 -----------PEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGG-ACSDVKQTIYEVNKYAKRSKLIEILSEQAD-  301 (434)
T ss_dssp             -----------SSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTC-CCTTEEEEEEECCGGGHHHHHHHHHHHCCT-
T ss_pred             -----------CCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccc-cccccceEEEEeCcHHHHHHHHHHHHhCCC-
Confidence                       2338999999999888888888888888877654432 234455666667777888888888887654 


Q ss_pred             cEEEEcCChHHHHHHHHHHHhcCCCcceEEEccccCCHHHHHHHHHHHhcCCccEEEEecccccCCCCCCCCEEEEccCC
Q 009641          334 KCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKP  413 (530)
Q Consensus       334 ~~iVf~~s~~~~~~l~~~L~~~~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~~~iLVaT~~~~~GiDip~~~~VI~~~~p  413 (530)
                      ++||||++++.|+.+++.|...+   +.+..+||++++.+|.++++.|++|+.+|||||+++++|+|+|++++||+||+|
T Consensus       302 ~~lVF~~t~~~a~~l~~~L~~~~---~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p  378 (434)
T 2db3_A          302 GTIVFVETKRGADFLASFLSEKE---FPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMP  378 (434)
T ss_dssp             TEEEECSSHHHHHHHHHHHHHTT---CCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCC
T ss_pred             CEEEEEeCcHHHHHHHHHHHhCC---CCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCC
Confidence            49999999999999999999876   889999999999999999999999999999999999999999999999999999


Q ss_pred             CChhHHHHHHhhhhcCCCCccEEEEeecc-hHHHHHHHHHHh
Q 009641          414 AYIKTYIHRAGRTARAGQLGRCFTLLHKD-EVKRFKKLLQKA  454 (530)
Q Consensus       414 ~s~~~y~Qr~GR~gR~g~~g~~i~~~~~~-~~~~~~~~~~~~  454 (530)
                      .+..+|+||+||+||.|+.|.+++|++++ +......+.+.+
T Consensus       379 ~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~~l  420 (434)
T 2db3_A          379 SKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKIL  420 (434)
T ss_dssp             SSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHHHHHHH
T ss_pred             CCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHHHHHHH
Confidence            99999999999999999999999999954 444444444444



>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 530
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 3e-20
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 5e-20
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-19
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 4e-18
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-16
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-16
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 7e-16
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-15
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 7e-15
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-14
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-14
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 4e-14
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 9e-14
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-13
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-12
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-12
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 7e-12
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-10
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-10
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 4e-10
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-09
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 6e-09
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 6e-09
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 6e-08
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 7e-07
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 1e-06
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-04
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.001
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]
 Score = 88.8 bits (219), Expect = 3e-20
 Identities = 41/155 (26%), Positives = 57/155 (36%), Gaps = 16/155 (10%)

Query: 302 KLPERLESYKLICESKLKPLYLVALLQSL----GEEKCIVFTSSVESTHRLCTLLNHFGE 357
           K    L   K I     K   L  +++         K IVFT+  E+  ++   L   G 
Sbjct: 127 KAISLLVQAKEIGLDHPKMDKLKEIIREQLQRKQNSKIIVFTNYRETAKKIVNELVKDG- 185

Query: 358 LRIKIKEYSGLQRQSVRS--------KTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVN 409
             IK K + G   +              L  F  G+  VLV++     G+DV  V+ VV 
Sbjct: 186 --IKAKRFVGQASKENDRGLSQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLVVF 243

Query: 410 YDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEV 444
           Y+        I R GRT R    GR   L+ K   
Sbjct: 244 YEPVPSAIRSIQRRGRTGRHMP-GRVIILMAKGTR 277


>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query530
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.98
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.97
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.97
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.96
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.96
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.96
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.93
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.93
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.92
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.91
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.91
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.9
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.83
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.82
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.81
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.8
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.79
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.78
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.77
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.75
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.73
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.73
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.69
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.63
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.5
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.48
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.43
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.36
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.34
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.24
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.03
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 99.01
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.86
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.96
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.93
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.75
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.4
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.98
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.98
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.67
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.52
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.45
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 96.44
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.34
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.04
d1vmaa2213 GTPase domain of the signal recognition particle r 95.9
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.85
d1okkd2207 GTPase domain of the signal recognition particle r 95.77
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.73
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 95.69
d2qy9a2211 GTPase domain of the signal recognition particle r 95.66
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 95.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.36
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.21
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.17
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.14
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.07
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.84
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.8
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.53
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.47
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.16
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 93.99
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 93.15
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 92.77
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 92.41
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 92.38
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.71
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.35
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.22
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 91.18
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.06
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 90.64
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.53
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 90.0
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 89.17
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.09
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 88.84
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 88.75
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.72
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.56
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.25
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.18
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 88.09
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 87.0
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 86.15
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 86.14
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 85.86
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 85.69
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 85.59
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 85.47
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 85.08
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 84.74
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 84.5
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.11
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 84.04
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 83.99
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 83.81
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 83.78
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 83.51
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 82.54
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 82.44
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.41
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 82.34
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 80.22
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 80.02
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.9e-38  Score=285.34  Aligned_cols=206  Identities=23%  Similarity=0.406  Sum_probs=183.1

Q ss_pred             cCCCCCCCCCCCCCCCHHHHHHHHHCCCCccchhhHHHHHHhcCCCCCCCcEEEECCCCchHHHHHHHHHHHHhhhcCCC
Q 009641           21 VSLFEDCPLDHLPCLDPRLKVALQNMGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVR  100 (530)
Q Consensus        21 ~~~~~~~~~~~~~~l~~~i~~~l~~~g~~~~~~~Q~~a~~~~~~~~~~~~~~li~apTGsGKT~~~~~~~l~~l~~~~~~  100 (530)
                      ..+|+++      +|++.+.++|+++||.+|+|+|..||+.++.    |+|+++.||||||||++|++|+++.+.... .
T Consensus        16 ~~sF~~l------~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~----g~dvi~~a~TGSGKTlayllPil~~l~~~~-~   84 (222)
T d2j0sa1          16 TPTFDTM------GLREDLLRGIYAYGFEKPSAIQQRAIKQIIK----GRDVIAQSQSGTGKTATFSISVLQCLDIQV-R   84 (222)
T ss_dssp             CCSGGGG------CCCHHHHHHHHHHTCCSCCHHHHHHHHHHHT----TCCEEEECCTTSSHHHHHHHHHHHTCCTTS-C
T ss_pred             CCCHHHC------CCCHHHHHHHHHCCCCCCCHHHHHHHHHHHC----CCCeEEEcCcchhhhhhhcccccccccccc-c
Confidence            3468888      4999999999999999999999999998875    999999999999999999999999887643 5


Q ss_pred             cccEEEEcCcHHHHHHHHHHHHHhccccCceEEEeecCCchHHHHHHHhhcCccccCccCCchhHHHhhcCCCcEEEeCC
Q 009641          101 CLRALVVLPTRDLALQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATP  180 (530)
Q Consensus       101 ~~~~lil~Pt~~L~~Q~~~~l~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ili~Tp  180 (530)
                      .++++|++||++|+.|+++.+++++...++++...+|+.....+...+                     ..+++|+|+||
T Consensus        85 ~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l---------------------~~~~~Ilv~TP  143 (222)
T d2j0sa1          85 ETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKL---------------------DYGQHVVAGTP  143 (222)
T ss_dssp             SCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHH---------------------HHCCSEEEECH
T ss_pred             CceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHh---------------------ccCCeEEeCCC
Confidence            678999999999999999999999999999999999999877765432                     35679999999


Q ss_pred             hHHHHHHhcCCCCCCCCccEEEEechhHhhhHhhhhHHHHHHhhcccCcccccccccccccccccchhhhhccccccCCC
Q 009641          181 GRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFK  260 (530)
Q Consensus       181 ~~l~~~l~~~~~~~~~~~~~lViDEah~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  260 (530)
                      +++.+++.+ +...+++++++|+||||.|++.+|...+..++..++..                                
T Consensus       144 grl~~~~~~-~~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~--------------------------------  190 (222)
T d2j0sa1         144 GRVFDMIRR-RSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPA--------------------------------  190 (222)
T ss_dssp             HHHHHHHHT-TSSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTSCTT--------------------------------
T ss_pred             CcHHhcccc-cccccccceeeeecchhHhhhcCcHHHHHHHHHhCCCC--------------------------------
Confidence            999999887 56788999999999999999999999999999876532                                


Q ss_pred             CCCCCceeeEEEeEeecCChhhhhhhccCCceEEecC
Q 009641          261 DKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTG  297 (530)
Q Consensus       261 ~~~~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~~  297 (530)
                            .|++++|||++.++..+...++++|+.+.++
T Consensus       191 ------~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         191 ------TQVVLISATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             ------CEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             ------CEEEEEEEeCCHHHHHHHHHHCCCCEEEEEe
Confidence                  2899999999999999999999999877653



>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure