Citrus Sinensis ID: 009973

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
MAEADQGFVEHDGNHDLEQIPENQEVENQVPGYEVPEYEVPEVPQEQVPQEQVPESQVTKEQVTEDQLTEDQVPEDHVPEDQVPEDHVPEDQVPEDIVPEDSQLQEKQENEVNLAVGSTEKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMDGLLRVHKRIVDGLDSDSSHAPSGTGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAEAAAPSQAQMGASADQGYNPYASMYGSPPSNPGHAGHAGGYGSVYGSNYGY
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEcccccEEEccccHHHHHHHHHHcccEEEcccccccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccEEEcccccHHHHHHHHcccEEEEEcccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccEEccccccHHHHHHHcccEEEEEcccccccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccEEEEEEEccccEEEEEcccccHHHHHHHHcccEEEEccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEcccEEEEEcccccHHHHHHHHcccEEEEEccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccHcccccccccccccccccccccccccccccccccEEEEEEEEccHcccEEEcccccHHHHHHHHcccEEEEEccccccccEEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccc
maeadqgfvehdgnhdleqipenqevenqvpgyevpeyevpevpqeqvpqeqvpesqvtkeqvtedqltedqvpedhvpedqvpedhvpedqvpedivpedsqlqekqeNEVNLavgstekkwpgwpgesvfRMLVPAQKVGSIIGRKGEFIKKIVEETRARIkildgppgtteRAVMIsakeepesslppamdGLLRVHKRIVdgldsdsshapsgtggkvstkllvpasqagsligkqggtvKSIQEASNCIVRVlgaedlpvfalqddrVVEVVGDASGVHKAMELIGSHLRKFLvdrsiiplfemhmqmpnpqmdhipppqswgppqglppsggpgyghnpqymppprqaesyyppadlpppmekqphqgisaygreapvnvhgssnaqstpsMITQVTQQMQIPLSYADAVIGTAGASISYIRrssgatvtiqetrgvpgemtvEISGTASQVQTAQQLIQNFMAeaaapsqaqmgasadqgynpyasmygsppsnpghaghaggygsvygsnygy
maeadqgfvehdgnhdleqipeNQEVENQVPGYEVPEYEVPEVPQEQVPQEQVPESQVTKEQVTEDQLTEDQVPEDHVPEDQVPEDHVPEDQVPEDIVPEDSQLQEKQENEvnlavgstekkwpgwpgESVFRMLVPAQkvgsiigrkgefIKKIVEETrarikildgppgttERAVMISakeepesslppaMDGLLRVHKRIVDGLDSDSSHAPSGTGGKVSTKLLVPASQAGsligkqggtvKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAEAAAPSQAQMGASADQGYNPYASMYGSPPSNPGHAGHAGGYGSVYGSNYGY
MAEADQGFVEHDGNHDLEQIPENQEVENqvpgyevpeyevpevpqeqvpqeqvpesqvTKEQVTEDQLTEDQVPEDHVPEDQVPEDHVPEDQVPEDIVPEDSQLQEKQENEVNLAVGSTEKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMDGLLRVHKRIVDGLDSDSSHAPSGTGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIpppqswgppqglppsggpgygHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAEAAAPSQAQMGASADQGYNPYASMYGSPPSNPGHAGHAggygsvygsnygy
************************************************************************************************************************KKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILD*********************************************************************IG**GGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEM**********************************************************************************************QQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQ***********************************************************************************
******G***************************************************************************************************************************VFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMDGLLRVH************************KLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFL***********************************************************YPPADLPPPMEKQPHQGIS************************QVTQQMQIPLSYADAVIGTAGASISYIRRSSG***************TVEISGTASQVQTAQQLI********************************************************
********VEHDGNHDLEQIPENQEVENQVPGYEVPEYEVP************************************VPEDQVPEDHVPEDQVPEDIVPEDSQLQEKQENEVNLAVGSTEKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMIS*********PPAMDGLLRVHKRIVDGLDS***********KVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAE************ADQGYNPYASMYGSPPSNPGHAGHAGGYGSVYGSNYGY
*******************IPENQ**ENQVPGYEVP*YEVPEVPQ**********SQVTKEQ**EDQLTEDQVPEDHVPEDQVPEDHVPEDQVPE******************************WPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMDGLLRVHKRIVDGLDSD*******TGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGS***Q***SMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAEAAA**************NPYASMYGSPPSNPGHAGHAGGYGSVYGS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEADQGFVEHDGNHDLEQIPENQEVENQVPGYEVPEYEVPEVPQEQVPQEQVPESQVTKEQVTEDQLTEDQVPEDHVPEDQVPEDHVPEDQVPEDIVPEDSQLQEKQENEVNLAVGSTEKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMDGLLRVHKRIVDGLDSDSSHAPSGTGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAEAAAPSQAQMGASADQGYNPYASMYGSPPSNPGHAGHAGGYGSVYGSNYGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query521 2.2.26 [Sep-21-2011]
P58223 606 KH domain-containing prot no no 0.589 0.506 0.264 6e-19
O19048356 Poly(rC)-binding protein yes no 0.606 0.887 0.289 3e-17
P60335356 Poly(rC)-binding protein yes no 0.606 0.887 0.289 3e-17
Q15365356 Poly(rC)-binding protein yes no 0.606 0.887 0.289 3e-17
Q5E9A3356 Poly(rC)-binding protein yes no 0.606 0.887 0.289 3e-17
P57722371 Poly(rC)-binding protein no no 0.573 0.805 0.283 1e-16
P57721371 Poly(rC)-binding protein no no 0.573 0.805 0.283 1e-16
Q15366365 Poly(rC)-binding protein no no 0.573 0.819 0.268 2e-16
Q0VCU0403 Poly(rC)-binding protein no no 0.579 0.749 0.280 9e-16
Q61990362 Poly(rC)-binding protein no no 0.585 0.842 0.271 1e-15
>sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375 OS=Arabidopsis thaliana GN=At4g18375 PE=2 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 156/351 (44%), Gaps = 44/351 (12%)

Query: 131 VFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMI--SAKEEPESS 188
           V+R+L P   VG +IG+ G+ I  I   T+A+IK+ D   G ++R + I  S KE+ E  
Sbjct: 37  VYRILCPIDVVGGVIGKSGKVINAIRHNTKAKIKVFDQLHGCSQRVITIYCSVKEKQEEI 96

Query: 189 ---------LPPAMDGLLRVHKRIVDGLDSDSSHAPSGTGGKVSTKLLVPASQAGSLIGK 239
                    L  A D LL+V+  IV   + +++            +LLVP SQ+ SLIGK
Sbjct: 97  GFTKSENEPLCCAQDALLKVYDAIVASDEENNTKTNVDRDDNKECRLLVPFSQSSSLIGK 156

Query: 240 QGGTVKSIQEASNCIVRVLGAEDLP----VFALQDDRVVEVVGDASGVHKAMELIGSHLR 295
            G  +K I+  +   V+V+ ++D+     V A++ D VV + G+   V +A+  + + + 
Sbjct: 157 AGENIKRIRRRTRASVKVV-SKDVSDPSHVCAMEYDNVVVISGEPESVKQALFAVSAIMY 215

Query: 296 KFLVDRSIIPLFEMHMQMPNPQM-------DHIPPPQSWGPPQGLPPSGGPGYGHNPQYM 348
           K +  R  IPL      +P   +       + + P   +   Q      G G    P Y 
Sbjct: 216 K-INPRENIPLDSTSQDVPAASVIVPSDLSNSVYPQTGFYSNQDHILQQGAGV---PSYF 271

Query: 349 PPPRQAE--SYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQM 406
                ++   Y   A  P P+          +    PV  HG   +  +  ++ +V    
Sbjct: 272 NALSVSDFQGYAETAANPVPV----------FASSLPVT-HGFGGSSRSEELVFKVL--- 317

Query: 407 QIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQ 457
             PL     VIG  G++I  IR +SG+ + + ++R   G+    I  TA++
Sbjct: 318 -CPLCNIMRVIGKGGSTIKRIREASGSCIEVNDSRTKCGDDECVIIVTATE 367

Arabidopsis thaliana (taxid: 3702)
>sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 Back     alignment and function description
>sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 Back     alignment and function description
>sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=2 SV=3 Back     alignment and function description
>sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 Back     alignment and function description
>sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 Back     alignment and function description
>sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 Back     alignment and function description
>sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
255561873548 Poly(rC)-binding protein, putative [Rici 0.813 0.773 0.858 0.0
224123476392 predicted protein [Populus trichocarpa] 0.744 0.989 0.854 0.0
356573119446 PREDICTED: insulin-like growth factor 2 0.775 0.905 0.796 1e-180
296087899511 unnamed protein product [Vitis vinifera] 0.813 0.829 0.819 1e-179
225463940442 PREDICTED: poly(rC)-binding protein 3-li 0.813 0.959 0.819 1e-179
356505941443 PREDICTED: KH domain-containing protein 0.765 0.900 0.791 1e-176
449442959483 PREDICTED: poly(rC)-binding protein 3-li 0.767 0.828 0.762 1e-171
147794489534 hypothetical protein VITISV_007074 [Viti 0.744 0.726 0.815 1e-164
61661324577 FLK [Arabidopsis thaliana] gi|61661326|g 0.800 0.722 0.729 1e-164
15229321577 RNA-binding KH domain-containing protein 0.800 0.722 0.729 1e-164
>gi|255561873|ref|XP_002521945.1| Poly(rC)-binding protein, putative [Ricinus communis] gi|223538749|gb|EEF40349.1| Poly(rC)-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/432 (85%), Positives = 397/432 (91%), Gaps = 8/432 (1%)

Query: 96  DIVPEDSQLQEKQENEVNLAVGSTEKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKI 155
           D VPE+ Q QEK  ++ +   G  EKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKI
Sbjct: 119 DQVPENYQAQEKG-HDADTVSGGIEKKWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKI 177

Query: 156 VEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMDGLLRVHKRIVDGLDSDSSHAP 215
           VEETRARIKILDGPPGTTERAVM+SAKEEP+S+LPPAMDGLLRVHKRIVDGLD DSSHA 
Sbjct: 178 VEETRARIKILDGPPGTTERAVMVSAKEEPDSALPPAMDGLLRVHKRIVDGLDGDSSHAS 237

Query: 216 SGTGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVE 275
           SGTG KVST+LLVPASQAGSLIGKQGGTVKSIQEAS+C+VRVLGAEDLPVFALQDDRVVE
Sbjct: 238 SGTGTKVSTRLLVPASQAGSLIGKQGGTVKSIQEASSCVVRVLGAEDLPVFALQDDRVVE 297

Query: 276 VVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMPN-PQMDHIPPPQSWGPPQGLP 334
           V+GDA+GVHKA+ELI SHLRKFLVDRSIIPLFEMHMQM N P M+H+PP QSWGPPQG+P
Sbjct: 298 VLGDAAGVHKAVELIASHLRKFLVDRSIIPLFEMHMQMQNPPHMEHMPPHQSWGPPQGIP 357

Query: 335 PS--GGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGREAPVNVHGSSNA 392
           P+  GGPGYG NPQYMPPPRQ E+YYPPADLPPPMEKQPHQGISAYGREAP+ VHGSSN+
Sbjct: 358 PNAGGGPGYG-NPQYMPPPRQIENYYPPADLPPPMEKQPHQGISAYGREAPMGVHGSSNS 416

Query: 393 QSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEIS 452
           Q+ PSMITQ+TQQMQIPLSYADAVIGTAG SISYIRR+SGATVTIQETRGVPGEMTVEIS
Sbjct: 417 QAAPSMITQITQQMQIPLSYADAVIGTAGTSISYIRRASGATVTIQETRGVPGEMTVEIS 476

Query: 453 GTASQVQTAQQLIQNFMAEAAAPSQAQMGASADQGYNPYA---SMYGSPPSNPGHAGHAG 509
           GTASQVQTAQQLIQNFMAEA AP+QAQ G S DQGYNPYA   S+Y SPPSNPGHAGH G
Sbjct: 477 GTASQVQTAQQLIQNFMAEAGAPTQAQTGGSTDQGYNPYAAHGSVYASPPSNPGHAGHTG 536

Query: 510 GYGSVYGSNYGY 521
           GYGSVYG+NYGY
Sbjct: 537 GYGSVYGTNYGY 548

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224123476|ref|XP_002319087.1| predicted protein [Populus trichocarpa] gi|222857463|gb|EEE95010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356573119|ref|XP_003554712.1| PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|296087899|emb|CBI35182.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225463940|ref|XP_002269249.1| PREDICTED: poly(rC)-binding protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505941|ref|XP_003521747.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information
>gi|449442959|ref|XP_004139248.1| PREDICTED: poly(rC)-binding protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147794489|emb|CAN67081.1| hypothetical protein VITISV_007074 [Vitis vinifera] Back     alignment and taxonomy information
>gi|61661324|gb|AAX51268.1| FLK [Arabidopsis thaliana] gi|61661326|gb|AAX51269.1| FLK [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15229321|ref|NP_187112.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] gi|6175183|gb|AAF04909.1|AC011437_24 putative RNA-binding protein [Arabidopsis thaliana] gi|17979249|gb|AAL49941.1| AT3g04610/F7O18_9 [Arabidopsis thaliana] gi|332640585|gb|AEE74106.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
TAIR|locus:2084908577 FLK "AT3G04610" [Arabidopsis t 0.806 0.727 0.683 3.8e-150
TAIR|locus:2120755495 PEP "AT4G26000" [Arabidopsis t 0.700 0.737 0.452 1.3e-75
TAIR|locus:2017612621 AT1G51580 "AT1G51580" [Arabido 0.305 0.256 0.349 6.6e-28
TAIR|locus:2150956 548 AT5G15270 "AT5G15270" [Arabido 0.318 0.302 0.354 4.1e-26
TAIR|locus:2831364 606 AT4G18375 "AT4G18375" [Arabido 0.351 0.301 0.313 3.9e-21
UNIPROTKB|F1SFQ4353 PCBP2 "Uncharacterized protein 0.608 0.898 0.262 3.9e-20
UNIPROTKB|Q3SYT9349 PCBP2 "Poly(RC) binding protei 0.600 0.896 0.262 5.2e-20
UNIPROTKB|J3QT27322 PCBP3 "Poly(rC)-binding protei 0.280 0.453 0.360 1.2e-19
TAIR|locus:2161413 644 AT5G46190 "AT5G46190" [Arabido 0.251 0.203 0.351 2.4e-19
UNIPROTKB|E2QUE1371 PCBP3 "Uncharacterized protein 0.280 0.393 0.360 3.9e-19
TAIR|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1420 (504.9 bits), Expect = 3.8e-150, Sum P(3) = 3.8e-150
 Identities = 302/442 (68%), Positives = 342/442 (77%)

Query:    75 EDHVPEDQVPEDHVPEDQVPEDIVPEDSQLQEKQENEVNLAVGSTEKKWPGWPGESVFRM 134
             +DH   D+V +D V ED   E+ +PE  +  +K E E +  VG  EK+WPGWPGE+VFRM
Sbjct:   138 QDH-NGDEV-QDKV-ED---EEGIPEHLESLQKSEPEEDATVGGEEKRWPGWPGETVFRM 191

Query:   135 LVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPPAMD 194
             LVPAQKVGSIIGRKG+ IKKIVEETRARIKILDGPPGTTERAVM+S KEEPESSLPP+MD
Sbjct:   192 LVPAQKVGSIIGRKGDVIKKIVEETRARIKILDGPPGTTERAVMVSGKEEPESSLPPSMD 251

Query:   195 GLLRVHKRIVDGLDSDSSHAPSGTGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCI 254
             GLLRVH RIVDGLD ++S AP  +  KVST+LLVPASQAGSLIGKQGGTVK+IQEAS CI
Sbjct:   252 GLLRVHMRIVDGLDGEASQAPPPS--KVSTRLLVPASQAGSLIGKQGGTVKAIQEASACI 309

Query:   255 VRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDRSIIPLFEMHMQMP 314
             VRVLG+EDLPVFALQDDRVVEVVG+ + VH+A+ELI SHLRKFLVDRSIIP FE  MQ P
Sbjct:   310 VRVLGSEDLPVFALQDDRVVEVVGEPTSVHRALELIASHLRKFLVDRSIIPFFENQMQKP 369

Query:   315 NPQMDHIXXXXXXXX--XXXXXXXXXXXXXHNPQ-YMPPPRQAESYYPPADL-PPPMEKQ 370
               QMDH+                       HNP  YM PP + +SYYPP ++  PPMEKQ
Sbjct:   370 TRQMDHMPPPHQSWGPPQGHAPSVGGGGYGHNPPPYMQPPPRHDSYYPPPEMRQPPMEKQ 429

Query:   371 PHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRS 430
             PHQGISAYGRE P+NVH SS   + P +  QVTQQMQIPLSYADAVIGT+G++ISY RR 
Sbjct:   430 PHQGISAYGREPPMNVHVSS---APPMVAQQVTQQMQIPLSYADAVIGTSGSNISYTRRL 486

Query:   431 SGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFMAEAAAPS--QAQMGASADQGY 488
             SGATVTIQETRGVPGEMTVE+SGT SQVQTA QLIQNFMAEA AP+  Q Q  A   QGY
Sbjct:   487 SGATVTIQETRGVPGEMTVEVSGTGSQVQTAVQLIQNFMAEAGAPAPAQPQTVAPEQQGY 546

Query:   489 NPYA---SMYGSPPSNP--GHA 505
             NPYA   S+Y + P+NP  G+A
Sbjct:   547 NPYATHGSVYAAAPTNPPGGYA 568
GO:0003676 "nucleic acid binding" evidence=ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005634 "nucleus" evidence=IDA
GO:0009911 "positive regulation of flower development" evidence=IMP
TAIR|locus:2120755 PEP "AT4G26000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFQ4 PCBP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYT9 PCBP2 "Poly(RC) binding protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3QT27 PCBP3 "Poly(rC)-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUE1 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 5e-19
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 7e-19
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 8e-14
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-12
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 5e-12
pfam0001359 pfam00013, KH_1, KH domain 2e-11
pfam0001359 pfam00013, KH_1, KH domain 5e-11
smart0032268 smart00322, KH, K homology RNA-binding domain 5e-11
pfam0001359 pfam00013, KH_1, KH domain 2e-10
smart0032268 smart00322, KH, K homology RNA-binding domain 2e-10
pfam1301442 pfam13014, KH_3, KH domain 2e-10
smart0032268 smart00322, KH, K homology RNA-binding domain 9e-07
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 2e-06
pfam1301442 pfam13014, KH_3, KH domain 8e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 4e-05
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 7e-05
pfam1301442 pfam13014, KH_3, KH domain 2e-04
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 0.001
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.002
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 0.003
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information 
 Score = 80.6 bits (200), Expect = 5e-19
 Identities = 29/71 (40%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 131 VFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDG-PPGTTERAVMISAKEEPESSL 189
             R+LVP+ + GSIIG+ G  IK+I EET A+I++     PG+TER V IS K       
Sbjct: 1   TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLPGSTERVVTISGK------P 54

Query: 190 PPAMDGLLRVH 200
                 LL + 
Sbjct: 55  SAVQKALLLIL 65

Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 521
KOG1676 600 consensus K-homology type RNA binding proteins [RN 100.0
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 100.0
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 100.0
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 100.0
KOG1676 600 consensus K-homology type RNA binding proteins [RN 99.98
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 99.97
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 99.95
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 99.89
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 99.89
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 99.83
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.65
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.6
PRK13763180 putative RNA-processing protein; Provisional 99.6
PRK13763180 putative RNA-processing protein; Provisional 99.57
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.39
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 99.26
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.26
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.24
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.24
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.2
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.17
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.09
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.05
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.01
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.96
PF1301443 KH_3: KH domain 98.89
smart0032269 KH K homology RNA-binding domain. 98.89
PF1301443 KH_3: KH domain 98.86
KOG2208 753 consensus Vigilin [Lipid transport and metabolism] 98.8
COG1094194 Predicted RNA-binding protein (contains KH domains 98.8
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 98.77
COG1094194 Predicted RNA-binding protein (contains KH domains 98.73
smart0032269 KH K homology RNA-binding domain. 98.66
KOG2208 753 consensus Vigilin [Lipid transport and metabolism] 98.54
KOG2113394 consensus Predicted RNA binding protein, contains 98.3
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.28
KOG2113 394 consensus Predicted RNA binding protein, contains 98.18
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.1
PRK08406140 transcription elongation factor NusA-like protein; 97.94
PRK08406140 transcription elongation factor NusA-like protein; 97.71
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.61
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.54
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.45
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 97.12
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.07
COG0195190 NusA Transcription elongation factor [Transcriptio 96.93
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 96.9
KOG0119554 consensus Splicing factor 1/branch point binding p 96.88
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.87
KOG1588259 consensus RNA-binding protein Sam68 and related KH 96.85
KOG0119 554 consensus Splicing factor 1/branch point binding p 96.73
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 96.7
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.56
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.54
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.47
PRK12328374 nusA transcription elongation factor NusA; Provisi 96.39
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 96.38
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 96.34
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.22
PRK12329449 nusA transcription elongation factor NusA; Provisi 96.21
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 96.19
TIGR01953341 NusA transcription termination factor NusA. This m 96.17
PRK12704 520 phosphodiesterase; Provisional 96.13
PRK00106 535 hypothetical protein; Provisional 96.13
KOG2814 345 consensus Transcription coactivator complex, P50 c 96.11
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 96.09
PRK12327362 nusA transcription elongation factor NusA; Provisi 96.05
COG0195190 NusA Transcription elongation factor [Transcriptio 95.89
PRK09202470 nusA transcription elongation factor NusA; Validat 95.83
KOG2814345 consensus Transcription coactivator complex, P50 c 95.79
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.76
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 95.7
PRK0046875 hypothetical protein; Provisional 95.46
KOG1588259 consensus RNA-binding protein Sam68 and related KH 95.45
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 95.41
PRK00106535 hypothetical protein; Provisional 95.21
PRK0282177 hypothetical protein; Provisional 95.19
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.17
COG5176269 MSL5 Splicing factor (branch point binding protein 95.07
COG5176269 MSL5 Splicing factor (branch point binding protein 95.02
PRK12704520 phosphodiesterase; Provisional 95.0
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.94
COG183776 Predicted RNA-binding protein (contains KH domain) 94.94
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 94.79
PRK12328374 nusA transcription elongation factor NusA; Provisi 94.68
TIGR01953341 NusA transcription termination factor NusA. This m 94.52
PRK0106478 hypothetical protein; Provisional 94.17
PRK09202470 nusA transcription elongation factor NusA; Validat 94.12
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 94.07
PRK12327362 nusA transcription elongation factor NusA; Provisi 94.06
PRK0046875 hypothetical protein; Provisional 93.92
PRK12705 508 hypothetical protein; Provisional 93.69
PRK12329449 nusA transcription elongation factor NusA; Provisi 93.65
PRK0282177 hypothetical protein; Provisional 93.13
COG183776 Predicted RNA-binding protein (contains KH domain) 92.77
PRK0106478 hypothetical protein; Provisional 92.38
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 92.15
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 90.2
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 89.93
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 89.52
PRK12705508 hypothetical protein; Provisional 89.42
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 89.38
KOG2874356 consensus rRNA processing protein [Translation, ri 89.28
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 88.28
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 87.39
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 87.16
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 86.96
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 86.81
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 86.01
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 85.84
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 84.86
COG1855604 ATPase (PilT family) [General function prediction 84.83
KOG2874356 consensus rRNA processing protein [Translation, ri 84.73
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 81.3
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 81.2
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=4.2e-37  Score=321.38  Aligned_cols=321  Identities=23%  Similarity=0.360  Sum_probs=229.9

Q ss_pred             CccccccccccccccccCCCCCCCCCCCC--CCcCccccCCCCCCCCCccchhhhhhhhhcccccCCCCCCCCC--CCCc
Q 009973           54 PESQVTKEQVTEDQLTEDQVPEDHVPEDQ--VPEDHVPEDQVPEDIVPEDSQLQEKQENEVNLAVGSTEKKWPG--WPGE  129 (521)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~p~--~~~~  129 (521)
                      .+-+|+|-+.-+..+.-+|.-+..++.+.  .+.|-+..+ +..+.+.++    .+...+.-...- .....+.  .+.+
T Consensus        65 VglvIGrgG~qI~~iqq~SgCrvq~~~~~s~~~~r~~~~~-G~pe~v~~a----K~li~evv~r~~-~~~~~~~~q~~~~  138 (600)
T KOG1676|consen   65 VGLVIGRGGSQIQAIQQKSGCRVQIAADPSGIGYRSVDLT-GSPENVEVA----KQLIGEVVSRGR-PPGGFPDNQGSVE  138 (600)
T ss_pred             ceeEeeccHHHhhhhhhhcCCccccCCCCCCccccccccc-CCcccHHHH----HHhhhhhhhccC-CCCCccccCCccc
Confidence            34457888888888888999887764443  357666666 444444433    333333322110 0011111  1457


Q ss_pred             eEEEEEeeccccccccccCchHHHHHHhhcCcEEEEeC-CCC-CCCccEEEEeccCCCCCCchhHHHHHHHHhhhhhcCC
Q 009973          130 SVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILD-GPP-GTTERAVMISAKEEPESSLPPAMDGLLRVHKRIVDGL  207 (521)
Q Consensus       130 ~~~rllVP~~~vG~IIGKgG~~Ik~I~e~Tga~I~i~~-~~~-~~~er~v~I~G~~e~~~~a~~a~~~l~~~~~~i~~~l  207 (521)
                      ++..|+||.+++|+||||+|++||+|++++||++.+.. +.. ....+.+.|+|.++.++.++..+-.|++   .-.+..
T Consensus       139 ttqeI~IPa~k~GlIIGKgGETikqlqe~sg~k~i~iqd~~~~~~~~KplritGdp~~ve~a~~lV~dil~---e~~~~~  215 (600)
T KOG1676|consen  139 TTQEILIPANKCGLIIGKGGETIKQLQEQSGVKMILVQDGSIATGADKPLRITGDPDKVEQAKQLVADILR---EEDDEV  215 (600)
T ss_pred             eeeeeccCccceeeEeccCccHHHHHHhhcCCceEEEecCCcCCCCCCceeecCCHHHHHHHHHHHHHHHH---hcccCC
Confidence            89999999999999999999999999999999988774 322 2367899999999865544333322221   100101


Q ss_pred             CCCCCCCCCCCCCceEEEEEeccccccccccCCchhHHHHHHHhcccEEEcCCCCCCcccCCCCeEEEEEcCHHHHHHHH
Q 009973          208 DSDSSHAPSGTGGKVSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAM  287 (521)
Q Consensus       208 ~~~~~~~~~~~~~~~t~~l~VP~~~vG~IIGk~G~~Ik~I~~~tGa~I~i~~~~~~P~~~~~~er~V~I~G~~~~V~~A~  287 (521)
                      ...............+.++.||+..||.||||+|++||+|+.+||++|+|.+ |+.|.   +.+|++.|.|+.+.|++|.
T Consensus       216 ~g~~~~~g~~~g~~~~~~V~VPr~~VG~IIGkgGE~IKklq~etG~KIQfkp-Dd~p~---speR~~~IiG~~d~ie~Aa  291 (600)
T KOG1676|consen  216 PGSGGHAGVRGGGSATREVKVPRSKVGIIIGKGGEMIKKLQNETGAKIQFKP-DDDPS---SPERPAQIIGTVDQIEHAA  291 (600)
T ss_pred             CccccccCcCccccceeEEeccccceeeEEecCchHHHHHhhccCceeEeec-CCCCC---CccceeeeecCHHHHHHHH
Confidence            1111111222344569999999999999999999999999999999999998 55553   6899999999999999999


Q ss_pred             HHHHHHHhhhcccCCccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 009973          288 ELIGSHLRKFLVDRSIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPM  367 (521)
Q Consensus       288 ~~I~~~l~~~~~~~~~~p~~e~~~~~~~p~~~~~~p~~~~~p~~~~~~~gg~g~~~~~~~~~~p~~~~~~~~~~~~~~~~  367 (521)
                      ++|.++|++...-.                                      +++                         
T Consensus       292 ~lI~eii~~~~~~~--------------------------------------~~~-------------------------  308 (600)
T KOG1676|consen  292 ELINEIIAEAEAGA--------------------------------------GGG-------------------------  308 (600)
T ss_pred             HHHHHHHHHHhccC--------------------------------------CCC-------------------------
Confidence            99999998742100                                      000                         


Q ss_pred             cCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccceEEEEEecCCCccceecCCCchHHHHHHHhCCeEEEccC--CCCCC
Q 009973          368 EKQPHQGISAYGREAPVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQET--RGVPG  445 (521)
Q Consensus       368 ~~~~~~g~~~~g~~~~~~~~g~~~~~~~~~~~~~~t~~i~VP~~~vG~IIGkgG~~Ik~Ir~~SGA~I~I~~~--~~~~~  445 (521)
                                ++    +   +.      +.  ....++|.||.+++|+||||+|+|||.|.++|||+|.+.+.  .....
T Consensus       309 ----------~~----~---G~------P~--~~~~fy~~VPa~KcGLvIGrGGEtIK~in~qSGA~~el~r~~p~~~~~  363 (600)
T KOG1676|consen  309 ----------MG----G---GA------PG--LVAQFYMKVPADKCGLVIGRGGETIKQINQQSGARCELSRQPPNGNPK  363 (600)
T ss_pred             ----------cC----C---CC------cc--ceeeEEEeccccccccccCCCccchhhhcccCCccccccCCCCCCCcc
Confidence                      00    0   00      00  11167899999999999999999999999999999999876  34567


Q ss_pred             ceEEEEEcCHHHHHHHHHHHHHHHHhccCC
Q 009973          446 EMTVEISGTASQVQTAQQLIQNFMAEAAAP  475 (521)
Q Consensus       446 er~VtI~Gt~e~V~~A~~lI~~~i~~~~~~  475 (521)
                      +++|+|+|++.+|+.|++||+.+|......
T Consensus       364 ektf~IrG~~~QIdhAk~LIr~kvg~~~~n  393 (600)
T KOG1676|consen  364 EKTFVIRGDKRQIDHAKQLIRDKVGDIAPN  393 (600)
T ss_pred             ceEEEEecCcccchHHHHHHHHHhcccCCC
Confidence            999999999999999999999999986543

>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
2jzx_A160 Pcbp2 Kh1-Kh2 Domains Length = 160 6e-13
2anr_A178 Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND 1e-10
2ann_A178 Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE 1e-10
3krm_A163 Imp1 Kh34 Length = 163 5e-08
1khm_A89 C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 1e-05
1j5k_A89 Complex Of The Kh3 Domain Of Hnrnp K With A Single_ 2e-05
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 2e-05
3vke_A76 Contribution Of The First K-Homology Domain Of Poly 1e-04
1ztg_A74 Human Alpha Polyc Binding Protein Kh1 Length = 74 2e-04
2axy_A73 Crystal Structure Of Kh1 Domain Of Human Poly(C)-Bi 8e-04
>pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 16/132 (12%)
Query: 132 FRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPESSLPP 191
            R+L+  ++VGSIIG+KGE +KK+ EE+ ARI I +G     ER +          +L  
Sbjct: 7   IRLLMHGKEVGSIIGKKGESVKKMREESGARINISEG--NCPERII----------TLAG 54
Query: 192 AMDGLLRVHKRIVDGLDSDSSHAPSGTGGK----VSTKLLVPASQAGSLIGKQGGTVKSI 247
             + + +    I+D L+ D S + + +       V+ +L+VPASQ GSLIGK G  +K I
Sbjct: 55  PTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEI 114
Query: 248 QEASNCIVRVLG 259
           +E++   V+V G
Sbjct: 115 RESTGAQVQVAG 126
>pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|3KRM|A Chain A, Imp1 Kh34 Length = 163 Back     alignment and structure
>pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 Back     alignment and structure
>pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 Back     alignment and structure
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 Back     alignment and structure
>pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 Back     alignment and structure
>pdb|2AXY|A Chain A, Crystal Structure Of Kh1 Domain Of Human Poly(C)-Binding Protein-2 With C-Rich Strand Of Human Telomeric Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-44
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-12
1j4w_A174 FUSE binding protein; single-stranded DNA binding 9e-12
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-11
1j4w_A174 FUSE binding protein; single-stranded DNA binding 7e-10
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-42
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-11
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-10
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-08
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-41
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 3e-13
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 1e-11
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-10
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 3e-09
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-39
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-10
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-10
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-09
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-36
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 6e-13
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-12
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-12
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-08
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 2e-22
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 3e-12
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-11
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 7e-22
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 1e-12
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 2e-12
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-21
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 4e-14
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-12
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-20
1x4n_A92 FAR upstream element binding protein 1; KH domain, 1e-10
1x4n_A92 FAR upstream element binding protein 1; KH domain, 3e-09
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 5e-20
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 7e-12
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 7e-12
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 3e-17
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 2e-12
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 9e-12
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 9e-17
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 2e-10
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-08
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 1e-16
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 1e-13
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 3e-10
1x4m_A94 FAR upstream element binding protein 1; KH domain, 1e-16
1x4m_A94 FAR upstream element binding protein 1; KH domain, 3e-13
1x4m_A94 FAR upstream element binding protein 1; KH domain, 1e-10
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-16
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-12
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-12
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 7e-16
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-13
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-11
1we8_A104 Tudor and KH domain containing protein; structural 8e-15
1we8_A104 Tudor and KH domain containing protein; structural 9e-09
1we8_A104 Tudor and KH domain containing protein; structural 1e-08
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 5e-13
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 2e-06
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 6e-13
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 4e-12
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 2e-11
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 1e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 8e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 3e-08
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 3e-08
1tua_A191 Hypothetical protein APE0754; structural genomics, 8e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 4e-08
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 3e-06
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 7e-06
2dgr_A83 Ring finger and KH domain-containing protein 1; st 5e-08
2dgr_A83 Ring finger and KH domain-containing protein 1; st 2e-07
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-06
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 1e-07
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 7e-07
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-06
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 6e-07
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 1e-06
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-06
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-06
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 7e-05
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 8e-06
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 7e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-05
2cxc_A144 NUSA; transcription termination, RNA binding prote 2e-04
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
 Score =  153 bits (388), Expect = 2e-44
 Identities = 43/176 (24%), Positives = 68/176 (38%), Gaps = 11/176 (6%)

Query: 128 GESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERAVMISAKEEPES 187
           G  +  + +P   VG +IGR GE IKKI  +   RI+       T ER   I+   +   
Sbjct: 1   GSHMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRAQ 60

Query: 188 SLPPAMDGLLRVHKRIVDGLDSDSSHA---------PSGTGGKVSTKLLVPASQAGSLIG 238
                +  LLR  +    G                     GG      +VP  + G +IG
Sbjct: 61  HAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIG 120

Query: 239 KQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHL 294
           K G T+KSI + S   + +    + P  A  + ++  + G    +  A +LI   +
Sbjct: 121 KGGETIKSISQQSGARIEL--QRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI 174
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Length = 144 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.92
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.92
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.92
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.92
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.91
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.91
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.91
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.91
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.9
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.9
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.87
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.76
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.74
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.66
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.65
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.59
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.57
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.56
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.55
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.55
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.55
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.54
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.52
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.5
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.5
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.49
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.46
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.45
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.44
1we8_A104 Tudor and KH domain containing protein; structural 99.44
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.42
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.41
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.41
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.41
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.39
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.39
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.35
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.35
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.34
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.34
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.34
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.34
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.34
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.33
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.31
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.31
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.31
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.29
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.26
1we8_A104 Tudor and KH domain containing protein; structural 99.25
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.22
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.22
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.2
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.2
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.19
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.12
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.09
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.09
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.08
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.96
2cpq_A91 FragIle X mental retardation syndrome related prot 98.85
2cpq_A91 FragIle X mental retardation syndrome related prot 98.69
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.61
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.57
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.4
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.3
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.05
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.9
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.86
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.78
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.72
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.54
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.5
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.93
2cxc_A144 NUSA; transcription termination, RNA binding prote 96.91
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.78
2asb_A251 Transcription elongation protein NUSA; protein-RNA 96.12
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.98
1hh2_P344 NUSA, N utilization substance protein A; transcrip 94.47
2asb_A251 Transcription elongation protein NUSA; protein-RNA 94.22
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 93.97
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 92.77
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 91.46
1hh2_P344 NUSA, N utilization substance protein A; transcrip 91.01
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 89.18
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 88.71
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=7.6e-25  Score=202.28  Aligned_cols=161  Identities=24%  Similarity=0.438  Sum_probs=129.9

Q ss_pred             eEEEEEeccccccccccCCchhHHHHHHHhcccEEEcCCCCCCcccCCCCeEEEEEcCHHHHHHHHHHHHHHHhhhcccC
Q 009973          222 VSTKLLVPASQAGSLIGKQGGTVKSIQEASNCIVRVLGAEDLPVFALQDDRVVEVVGDASGVHKAMELIGSHLRKFLVDR  301 (521)
Q Consensus       222 ~t~~l~VP~~~vG~IIGk~G~~Ik~I~~~tGa~I~i~~~~~~P~~~~~~er~V~I~G~~~~V~~A~~~I~~~l~~~~~~~  301 (521)
                      ++.+|+||..++|+||||+|++||+|+++|||+|+|.+....   ....+|.|+|+|++++|.+|+.+|.+++.+.... 
T Consensus         2 ~~~~~~Vp~~~~g~iIGk~G~~Ik~i~~~tg~~I~i~~~~~~---~~~~~r~v~I~G~~~~v~~A~~~I~~ii~e~~~~-   77 (164)
T 2jvz_A            2 TVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQ---NTNVDKPLRIIGDPYKVQQACEMVMDILRERDQG-   77 (164)
T ss_dssp             EEEEEEECTTCHHHHTCTTTHHHHHHHHTSCSEEEECCCTTS---SSSSCEEEEEEECHHHHHHHHHHHHHHTTCSSSC-
T ss_pred             eEEEEEechhheeEEECCChHHHHHHHHHhCCeEEEecCCCC---CCCCceEEEEEcCHHHHHHHHHHHHHHHHhccCC-
Confidence            578999999999999999999999999999999999763222   2357899999999999999999999988652100 


Q ss_pred             CccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCC
Q 009973          302 SIIPLFEMHMQMPNPQMDHIPPPQSWGPPQGLPPSGGPGYGHNPQYMPPPRQAESYYPPADLPPPMEKQPHQGISAYGRE  381 (521)
Q Consensus       302 ~~~p~~e~~~~~~~p~~~~~~p~~~~~p~~~~~~~gg~g~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~g~~~~g~~  381 (521)
                                                            +|...                               ..|+..
T Consensus        78 --------------------------------------~~~~~-------------------------------~~~~~~   88 (164)
T 2jvz_A           78 --------------------------------------GFGDR-------------------------------NEYGSR   88 (164)
T ss_dssp             --------------------------------------CCSSC-------------------------------SSCTTS
T ss_pred             --------------------------------------CCCCc-------------------------------cccCCC
Confidence                                                  00000                               000000


Q ss_pred             CCCCCCCCCCCCCCCCcccceEEEEEecCCCccceecCCCchHHHHHHHhCCeEEEccCCCCCCceEEEEEcCHHHHHHH
Q 009973          382 APVNVHGSSNAQSTPSMITQVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTA  461 (521)
Q Consensus       382 ~~~~~~g~~~~~~~~~~~~~~t~~i~VP~~~vG~IIGkgG~~Ik~Ir~~SGA~I~I~~~~~~~~er~VtI~Gt~e~V~~A  461 (521)
                                        ...+.+|.||.+++|+||||+|++|++|++.|||+|.|.+..+...++.|+|+|++++|+.|
T Consensus        89 ------------------~~~~~~i~vp~~~~g~iIGk~G~~I~~i~~~tg~~I~i~~~~~~~~~~~v~I~G~~~~v~~A  150 (164)
T 2jvz_A           89 ------------------IGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHA  150 (164)
T ss_dssp             ------------------CSSSBCCEEETTTHHHHHCSSSHHHHHHHHHTCCEEEECCCCTTSSEEEEEEESCHHHHHHH
T ss_pred             ------------------CCceEEEEEChhhccccCCCCcHhHHHHHHHHCCeEEEeCCCCCCCcEEEEEEcCHHHHHHH
Confidence                              01245688999999999999999999999999999999876655668999999999999999


Q ss_pred             HHHHHHHHHhcc
Q 009973          462 QQLIQNFMAEAA  473 (521)
Q Consensus       462 ~~lI~~~i~~~~  473 (521)
                      +.+|.+++.+..
T Consensus       151 ~~~I~~~i~~~~  162 (164)
T 2jvz_A          151 ARIINDLLQSLR  162 (164)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHhhhh
Confidence            999999998753
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 521
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 3e-16
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 1e-12
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 5e-12
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 3e-16
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 4e-12
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-11
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 6e-15
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-10
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 7e-08
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 7e-15
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 6e-13
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 3e-10
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 7e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 5e-13
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 5e-12
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 6e-13
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-12
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 6e-12
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 7e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 2e-11
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 2e-10
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-10
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-09
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 2e-12
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 6e-12
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 1e-10
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 4e-12
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 1e-09
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 3e-08
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 1e-11
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 4e-10
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 7e-09
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 3e-11
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 6e-11
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 8e-10
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-10
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-08
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-06
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 2e-10
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 6e-09
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 2e-07
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-09
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 3e-07
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 4e-06
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-09
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 0.002
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 0.003
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 3e-09
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 3e-06
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 5e-06
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-06
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 1e-05
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 8e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 8e-06
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 9e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 3e-05
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 8e-05
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 9e-05
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 7e-05
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 0.001
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 0.001
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 0.002
d1k1ga_122 d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s 0.004
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.4 bits (175), Expect = 3e-16
 Identities = 23/70 (32%), Positives = 37/70 (52%)

Query: 401 QVTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQT 460
           Q T ++ IP +    +IG  GA+I+ IR+ SGA + I           V I+G+A+ +  
Sbjct: 1   QTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISL 60

Query: 461 AQQLIQNFMA 470
           AQ LI   ++
Sbjct: 61  AQYLINARLS 70
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.62
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.57
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.54
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.54
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.52
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.52
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.49
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.49
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.48
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.46
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.45
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.45
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.45
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.45
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.38
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.36
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.23
d2cpqa178 Fragile X mental retardation syndrome related prot 99.22
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.2
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.06
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2cpqa178 Fragile X mental retardation syndrome related prot 99.05
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.86
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.77
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.7
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.7
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.67
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.55
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.51
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.49
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.38
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.31
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.01
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.69
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.46
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.35
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.77
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.76
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.42
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.15
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 85.25
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 84.25
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.62  E-value=2.9e-16  Score=122.20  Aligned_cols=68  Identities=32%  Similarity=0.477  Sum_probs=64.9

Q ss_pred             eEEEEEecCCCccceecCCCchHHHHHHHhCCeEEEccCCCCCCceEEEEEcCHHHHHHHHHHHHHHH
Q 009973          402 VTQQMQIPLSYADAVIGTAGASISYIRRSSGATVTIQETRGVPGEMTVEISGTASQVQTAQQLIQNFM  469 (521)
Q Consensus       402 ~t~~i~VP~~~vG~IIGkgG~~Ik~Ir~~SGA~I~I~~~~~~~~er~VtI~Gt~e~V~~A~~lI~~~i  469 (521)
                      +|.+|.||.+++|+||||+|.+|++|++.|||+|.|.++.+.+.+|.|+|+|++++|+.|+.||+++|
T Consensus         2 ~T~~i~VP~~~vg~iIGk~G~~I~~I~~~tga~I~i~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i   69 (70)
T d1wvna1           2 TTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARL   69 (70)
T ss_dssp             EEEEEEEEGGGHHHHHCGGGHHHHHHHHHHCCEEEECCCCTTCSEEEEEEEECHHHHHHHHHHHHHHT
T ss_pred             eEEEEEEChHhcceeECCCChHHHHHHHHcCcEEEEcCCCCCCCcEEEEEEeCHHHHHHHHHHHHHHc
Confidence            58899999999999999999999999999999999998877788999999999999999999999886
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure