Citrus Sinensis ID: 010031


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520
MKGHVFNRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQKGDGRTWRE
ccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHcccccccccccEEEHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHcHHcccccccccHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccc
ccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEcHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccc
mkghvfnrlttaiapttniksshkpsnniteTHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSifdhftpknLHIFNVLIRGlaenshfqsCISHFVFMLRlsvrpnrltypfvSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGktrgafkvfdetpeknksESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRvhnyiscndfglkgAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMmysgtepdgTVFLAILTACWYSGQVKLALNFFdsmrfdyfiepsvkHHTVVVNLLSRVGQVDKALNFinkmpetpdfvIWGALFCACRTHKDTKIAKIALQsscslnlsiPQAMSYCQTFMQqkgdgrtwre
MKGHVFNRlttaiapttniksshkpsnnITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVfdetpeknksesvLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMqqkgdgrtwre
MKGHVFNRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFvsksvaslsllslgrglHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQKGDGRTWRE
******************************ETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDE*******ESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFM***********
MKGHVFNRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQKGDGRTWRE
MKGHVFNRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFM***********
MKGHVFNRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQKGDGRT***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGHVFNRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQKGDGRTWRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query520 2.2.26 [Sep-21-2011]
Q9MAT2 665 Pentatricopeptide repeat- yes no 0.892 0.697 0.507 1e-141
Q9LS72600 Pentatricopeptide repeat- no no 0.901 0.781 0.341 3e-85
Q56X05577 Pentatricopeptide repeat- no no 0.95 0.856 0.335 6e-79
Q9LTV8 694 Pentatricopeptide repeat- no no 0.894 0.670 0.319 4e-78
Q9SJG6559 Pentatricopeptide repeat- no no 0.821 0.763 0.366 2e-77
Q9CA54 643 Pentatricopeptide repeat- no no 0.871 0.704 0.329 3e-76
Q9SIL5534 Pentatricopeptide repeat- no no 0.836 0.814 0.327 2e-75
Q9LN01 741 Pentatricopeptide repeat- no no 0.886 0.622 0.331 4e-74
O49399545 Pentatricopeptide repeat- no no 0.925 0.882 0.327 2e-73
O82380 738 Pentatricopeptide repeat- no no 0.903 0.636 0.307 4e-73
>sp|Q9MAT2|PPR10_ARATH Pentatricopeptide repeat-containing protein At1g04840 OS=Arabidopsis thaliana GN=PCMP-H64 PE=2 SV=1 Back     alignment and function desciption
 Score =  503 bits (1296), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 236/465 (50%), Positives = 326/465 (70%), Gaps = 1/465 (0%)

Query: 31  ETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFT 90
           E+H ISLIH+   T  LR +HAQI+   +  SSR+  QL+S +SL KS DY+LSIF +  
Sbjct: 29  ESHFISLIHACKDTASLRHVHAQILRRGVL-SSRVAAQLVSCSSLLKSPDYSLSIFRNSE 87

Query: 91  PKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRG 150
            +N  + N LIRGL EN+ F+S + HF+ MLRL V+P+RLT+PFV KS + L    LGR 
Sbjct: 88  ERNPFVLNALIRGLTENARFESSVRHFILMLRLGVKPDRLTFPFVLKSNSKLGFRWLGRA 147

Query: 151 LHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCS 210
           LH   +K+ V+ D+FVR+ L DMY + G+ + AF+VF+E+P++ K ES+L+WNVLING  
Sbjct: 148 LHAATLKNFVDCDSFVRLSLVDMYAKTGQLKHAFQVFEESPDRIKKESILIWNVLINGYC 207

Query: 211 KIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMING 270
           +   +  A  LF  MP++N  SW +LI G++  G+L +A +LFE MPEK VVSWT +ING
Sbjct: 208 RAKDMHMATTLFRSMPERNSGSWSTLIKGYVDSGELNRAKQLFELMPEKNVVSWTTLING 267

Query: 271 FSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLK 330
           FSQ G+ E A++ +F+ML+ G++ N++T+ + LSAC+K GAL +G+R+H YI  N   L 
Sbjct: 268 FSQTGDYETAISTYFEMLEKGLKPNEYTIAAVLSACSKSGALGSGIRIHGYILDNGIKLD 327

Query: 331 GAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMY 390
            AIGTALVDMYAKCG ++ A+ VF     KD+L+WTAMI G A+HGR+ QAIQ F++MMY
Sbjct: 328 RAIGTALVDMYAKCGELDCAATVFSNMNHKDILSWTAMIQGWAVHGRFHQAIQCFRQMMY 387

Query: 391 SGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVD 450
           SG +PD  VFLA+LTAC  S +V L LNFFDSMR DY IEP++KH+ +VV+LL R G+++
Sbjct: 388 SGEKPDEVVFLAVLTACLNSSEVDLGLNFFDSMRLDYAIEPTLKHYVLVVDLLGRAGKLN 447

Query: 451 KALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLN 495
           +A   +  MP  PD   W AL+ AC+ HK  + A+   Q+   L+
Sbjct: 448 EAHELVENMPINPDLTTWAALYRACKAHKGYRRAESVSQNLLELD 492





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protein At3g29230 OS=Arabidopsis thaliana GN=PCMP-E27 PE=2 SV=1 Back     alignment and function description
>sp|Q56X05|PPR15_ARATH Pentatricopeptide repeat-containing protein At1g06145 OS=Arabidopsis thaliana GN=EMB1444 PE=2 SV=2 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protein At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protein At2g20540 OS=Arabidopsis thaliana GN=PCMP-E78 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|O49399|PP321_ARATH Pentatricopeptide repeat-containing protein At4g18840 OS=Arabidopsis thaliana GN=PCMP-E101 PE=3 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
224060371 719 predicted protein [Populus trichocarpa] 0.921 0.666 0.612 1e-174
359477907 677 PREDICTED: pentatricopeptide repeat-cont 0.917 0.704 0.619 1e-174
449442481 679 PREDICTED: pentatricopeptide repeat-cont 0.901 0.690 0.607 1e-167
15220333 665 pentatricopeptide repeat-containing prot 0.892 0.697 0.507 1e-140
297848728 664 pentatricopeptide repeat-containing prot 0.890 0.697 0.511 1e-140
255554062404 pentatricopeptide repeat-containing prot 0.623 0.801 0.601 1e-131
357516905 758 Pentatricopeptide repeat-containing prot 0.909 0.624 0.368 6e-90
225423995 623 PREDICTED: pentatricopeptide repeat-cont 0.915 0.764 0.356 9e-90
449531466610 PREDICTED: pentatricopeptide repeat-cont 0.917 0.781 0.351 3e-87
449441542 652 PREDICTED: pentatricopeptide repeat-cont 0.915 0.730 0.350 7e-87
>gi|224060371|ref|XP_002300166.1| predicted protein [Populus trichocarpa] gi|222847424|gb|EEE84971.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  619 bits (1596), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 294/480 (61%), Positives = 367/480 (76%), Gaps = 1/480 (0%)

Query: 10  TTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQL 69
           T+   P +++ +   P    TE H ISLIH S +  QL QIHAQII+HNL +SS ITTQL
Sbjct: 60  TSENKPKSSLSALFIPPTTPTEAHFISLIHGSKTILQLHQIHAQIIIHNLSSSSLITTQL 119

Query: 70  ISSASLHKSIDYALSIFDHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNR 129
           ISS+SL KSI+++L++F+H  PKNL  FN LIRGL  NSHF + I HF  MLR  ++P+R
Sbjct: 120 ISSSSLRKSINHSLAVFNHHKPKNLFTFNALIRGLTTNSHFFNAIFHFRLMLRSGIKPDR 179

Query: 130 LTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDE 189
           LTYPFV KS+A L    LG  +HC+I++ G+E D+FVRV L DMYV++ K   AFKVFDE
Sbjct: 180 LTYPFVLKSMAGLFSTELGMAIHCMILRCGIELDSFVRVSLVDMYVKVEKLGSAFKVFDE 239

Query: 190 TPEK-NKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKK 248
           +PE+ +   S LLWNVLI GC K G ++KAV+LF  MPKK   SW +LIDGF + GD+ +
Sbjct: 240 SPERFDSGSSALLWNVLIKGCCKAGSMKKAVKLFKAMPKKENVSWSTLIDGFAKNGDMDR 299

Query: 249 AGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAK 308
           A ELF+QMPEK VVSWT M++GFS+NG++EKAL+MF +ML+ GVR N FT+VSALSACAK
Sbjct: 300 AMELFDQMPEKNVVSWTTMVDGFSRNGDSEKALSMFSKMLEEGVRPNAFTIVSALSACAK 359

Query: 309 VGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAM 368
           +G LEAG+R+H YI  N   L  A+GTALVDMYAKCGNIE+AS VFGET++K + TWT M
Sbjct: 360 IGGLEAGLRIHKYIKDNGLHLTEALGTALVDMYAKCGNIESASEVFGETEQKSIRTWTVM 419

Query: 369 IWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYF 428
           IWG AIHG  EQAI  FK+MM++G +PD  VFLA+LTAC +SGQV + LNFFDSMR DY 
Sbjct: 420 IWGWAIHGHSEQAIACFKQMMFAGIKPDEVVFLALLTACMHSGQVDIGLNFFDSMRLDYC 479

Query: 429 IEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIAL 488
           IEPS+KH+T++V++L R GQ+ +AL FI +MP  PDFVIWGALFCACR HK TK+AK AL
Sbjct: 480 IEPSMKHYTLIVDMLGRSGQLKEALRFIERMPMNPDFVIWGALFCACRAHKKTKMAKFAL 539




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359477907|ref|XP_002270439.2| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442481|ref|XP_004139010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Cucumis sativus] gi|449505311|ref|XP_004162432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15220333|ref|NP_171976.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75192500|sp|Q9MAT2.1|PPR10_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g04840 gi|7211995|gb|AAF40466.1|AC004809_24 F13M7.17 [Arabidopsis thaliana] gi|332189629|gb|AEE27750.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848728|ref|XP_002892245.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338087|gb|EFH68504.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255554062|ref|XP_002518071.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542667|gb|EEF44204.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357516905|ref|XP_003628741.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522763|gb|AET03217.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225423995|ref|XP_002279343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449531466|ref|XP_004172707.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441542|ref|XP_004138541.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
TAIR|locus:2010652 665 AT1G04840 "AT1G04840" [Arabido 0.892 0.697 0.490 4.4e-123
TAIR|locus:2019160 643 AT1G74630 [Arabidopsis thalian 0.863 0.698 0.319 1.2e-67
TAIR|locus:2117084545 AT4G18840 "AT4G18840" [Arabido 0.930 0.888 0.317 2e-65
TAIR|locus:2150996548 AT5G15300 "AT5G15300" [Arabido 0.871 0.826 0.322 1.4e-64
TAIR|locus:2094812600 AT3G29230 "AT3G29230" [Arabido 0.609 0.528 0.362 9e-61
TAIR|locus:2154389 646 LPA66 "LOW PSII ACCUMULATION 6 0.875 0.704 0.327 1.3e-59
TAIR|locus:2010012474 AT1G13410 "AT1G13410" [Arabido 0.592 0.649 0.398 1.2e-58
TAIR|locus:505006130 970 AT1G18485 [Arabidopsis thalian 0.544 0.291 0.342 1.3e-58
TAIR|locus:2060640 738 OTP81 "ORGANELLE TRANSCRIPT PR 0.569 0.401 0.362 4.8e-58
TAIR|locus:2041198681 SLO1 "SLOW GROWTH 1" [Arabidop 0.661 0.505 0.345 1.4e-57
TAIR|locus:2010652 AT1G04840 "AT1G04840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1210 (431.0 bits), Expect = 4.4e-123, P = 4.4e-123
 Identities = 228/465 (49%), Positives = 317/465 (68%)

Query:    31 ETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIFDHFT 90
             E+H ISLIH+   T  LR +HAQI+   +  SSR+  QL+S +SL KS DY+LSIF +  
Sbjct:    29 ESHFISLIHACKDTASLRHVHAQILRRGVL-SSRVAAQLVSCSSLLKSPDYSLSIFRNSE 87

Query:    91 PKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFXXXXXXXXXXXXXXXX 150
              +N  + N LIRGL EN+ F+S + HF+ MLRL V+P+RLT+PF                
Sbjct:    88 ERNPFVLNALIRGLTENARFESSVRHFILMLRLGVKPDRLTFPFVLKSNSKLGFRWLGRA 147

Query:   151 XHCLIVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCS 210
              H   +K+ V+ D+FVR+ L DMY + G+ + AF+VF+E+P++ K ES+L+WNVLING  
Sbjct:   148 LHAATLKNFVDCDSFVRLSLVDMYAKTGQLKHAFQVFEESPDRIKKESILIWNVLINGYC 207

Query:   211 KIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMING 270
             +   +  A  LF  MP++N  SW +LI G++  G+L +A +LFE MPEK VVSWT +ING
Sbjct:   208 RAKDMHMATTLFRSMPERNSGSWSTLIKGYVDSGELNRAKQLFELMPEKNVVSWTTLING 267

Query:   271 FSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLK 330
             FSQ G+ E A++ +F+ML+ G++ N++T+ + LSAC+K GAL +G+R+H YI  N   L 
Sbjct:   268 FSQTGDYETAISTYFEMLEKGLKPNEYTIAAVLSACSKSGALGSGIRIHGYILDNGIKLD 327

Query:   331 GAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMY 390
              AIGTALVDMYAKCG ++ A+ VF     KD+L+WTAMI G A+HGR+ QAIQ F++MMY
Sbjct:   328 RAIGTALVDMYAKCGELDCAATVFSNMNHKDILSWTAMIQGWAVHGRFHQAIQCFRQMMY 387

Query:   391 SGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVD 450
             SG +PD  VFLA+LTAC  S +V L LNFFDSMR DY IEP++KH+ +VV+LL R G+++
Sbjct:   388 SGEKPDEVVFLAVLTACLNSSEVDLGLNFFDSMRLDYAIEPTLKHYVLVVDLLGRAGKLN 447

Query:   451 KALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLN 495
             +A   +  MP  PD   W AL+ AC+ HK  + A+   Q+   L+
Sbjct:   448 EAHELVENMPINPDLTTWAALYRACKAHKGYRRAESVSQNLLELD 492




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2019160 AT1G74630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117084 AT4G18840 "AT4G18840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150996 AT5G15300 "AT5G15300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094812 AT3G29230 "AT3G29230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010012 AT1G13410 "AT1G13410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041198 SLO1 "SLOW GROWTH 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MAT2PPR10_ARATHNo assigned EC number0.50750.89230.6977yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.I.3444.1
hypothetical protein (656 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-64
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-50
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-37
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-29
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-15
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
pfam0153531 pfam01535, PPR, PPR repeat 4e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 5e-05
pfam0153531 pfam01535, PPR, PPR repeat 5e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  222 bits (567), Expect = 1e-64
 Identities = 112/372 (30%), Positives = 185/372 (49%), Gaps = 43/372 (11%)

Query: 155 IVKSGVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGY 214
           +  SG E D ++   +  M+V+ G    A ++FDE PE+N    +  W  +I G    G 
Sbjct: 149 VESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDEMPERN----LASWGTIIGGLVDAGN 204

Query: 215 LRKAVELFGMM-------PKKNVASWV--------------------------------S 235
            R+A  LF  M         +     +                                +
Sbjct: 205 YREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCA 264

Query: 236 LIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRAN 295
           LID + + GD++ A  +F+ MPEK  V+W +M+ G++ +G +E+AL ++++M D+GV  +
Sbjct: 265 LIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSID 324

Query: 296 DFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFG 355
            FT    +   +++  LE   + H  +    F L     TALVD+Y+K G +E A  VF 
Sbjct: 325 QFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFD 384

Query: 356 ETKEKDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKL 415
               K+L++W A+I G   HGR  +A++ F++M+  G  P+   FLA+L+AC YSG  + 
Sbjct: 385 RMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQ 444

Query: 416 ALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPETPDFVIWGALFCAC 475
               F SM  ++ I+P   H+  ++ LL R G +D+A   I + P  P   +W AL  AC
Sbjct: 445 GWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTAC 504

Query: 476 RTHKDTKIAKIA 487
           R HK+ ++ ++A
Sbjct: 505 RIHKNLELGRLA 516


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 520
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.85
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.83
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.83
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG2003 840 consensus TPR repeat-containing protein [General f 99.79
KOG2076895 consensus RNA polymerase III transcription factor 99.75
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.75
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.73
KOG2076 895 consensus RNA polymerase III transcription factor 99.73
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
KOG1915677 consensus Cell cycle control protein (crooked neck 99.69
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.66
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.65
KOG0547606 consensus Translocase of outer mitochondrial membr 99.64
KOG2003840 consensus TPR repeat-containing protein [General f 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
KOG1126638 consensus DNA-binding cell division cycle control 99.6
KOG0547606 consensus Translocase of outer mitochondrial membr 99.6
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.57
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.54
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.54
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.52
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.52
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.5
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.48
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.48
KOG1129478 consensus TPR repeat-containing protein [General f 99.43
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.41
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.4
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.39
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.38
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.37
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.34
PRK12370553 invasion protein regulator; Provisional 99.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.31
PF1304150 PPR_2: PPR repeat family 99.29
PRK11189296 lipoprotein NlpI; Provisional 99.28
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.28
PF1304150 PPR_2: PPR repeat family 99.27
PRK12370553 invasion protein regulator; Provisional 99.26
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.26
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.25
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.24
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.24
KOG1129478 consensus TPR repeat-containing protein [General f 99.22
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.2
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.2
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.19
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.15
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.14
PRK11189296 lipoprotein NlpI; Provisional 99.13
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.08
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.08
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.06
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.03
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.02
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.01
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.01
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.01
PRK15359144 type III secretion system chaperone protein SscB; 98.98
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.98
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.96
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.91
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.91
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.91
PRK04841903 transcriptional regulator MalT; Provisional 98.91
PRK04841 903 transcriptional regulator MalT; Provisional 98.89
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.89
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.83
KOG1125579 consensus TPR repeat-containing protein [General f 98.82
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.8
KOG1125579 consensus TPR repeat-containing protein [General f 98.8
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.79
PRK10370198 formate-dependent nitrite reductase complex subuni 98.75
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.71
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.71
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.69
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.69
PLN02789320 farnesyltranstransferase 98.68
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.64
PLN02789320 farnesyltranstransferase 98.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.62
PF1285434 PPR_1: PPR repeat 98.61
PF1285434 PPR_1: PPR repeat 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.59
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.58
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.57
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.56
KOG1128777 consensus Uncharacterized conserved protein, conta 98.55
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.51
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.5
KOG0553304 consensus TPR repeat-containing protein [General f 98.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.48
PRK15359144 type III secretion system chaperone protein SscB; 98.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.48
PRK10370198 formate-dependent nitrite reductase complex subuni 98.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.44
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.4
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.38
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.32
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.32
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.31
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.31
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.26
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.26
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.23
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.22
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.2
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.17
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.13
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.11
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.1
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.1
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.07
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.06
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.05
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.05
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.0
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.0
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.94
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.91
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.88
PF1342844 TPR_14: Tetratricopeptide repeat 97.88
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.87
PF1337173 TPR_9: Tetratricopeptide repeat 97.83
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.82
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.82
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.78
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.77
KOG20411189 consensus WD40 repeat protein [General function pr 97.76
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.75
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.74
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.73
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.73
KOG0553304 consensus TPR repeat-containing protein [General f 97.72
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.72
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.7
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.69
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.66
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.63
PRK10803263 tol-pal system protein YbgF; Provisional 97.6
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.6
KOG1258577 consensus mRNA processing protein [RNA processing 97.59
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.58
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.55
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.54
COG4700251 Uncharacterized protein conserved in bacteria cont 97.52
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.52
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.51
KOG20411189 consensus WD40 repeat protein [General function pr 97.49
COG3898531 Uncharacterized membrane-bound protein [Function u 97.48
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.45
PRK15331165 chaperone protein SicA; Provisional 97.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.42
COG4700251 Uncharacterized protein conserved in bacteria cont 97.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.39
PF12688120 TPR_5: Tetratrico peptide repeat 97.38
PF1343134 TPR_17: Tetratricopeptide repeat 97.38
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.38
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.37
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.29
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.27
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.26
PF12688120 TPR_5: Tetratrico peptide repeat 97.25
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.21
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.19
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.19
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.18
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.12
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.1
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.1
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.1
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.08
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.04
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.02
PRK10803263 tol-pal system protein YbgF; Provisional 96.94
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.93
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.92
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.86
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.83
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.83
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.8
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.8
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.79
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.77
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.69
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.67
PF13512142 TPR_18: Tetratricopeptide repeat 96.63
PRK15331165 chaperone protein SicA; Provisional 96.61
KOG4555175 consensus TPR repeat-containing protein [Function 96.58
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.47
PF1337173 TPR_9: Tetratricopeptide repeat 96.44
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.43
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.37
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.37
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.36
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.29
PRK11906458 transcriptional regulator; Provisional 96.29
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.28
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.28
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.26
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.18
PF13512142 TPR_18: Tetratricopeptide repeat 96.17
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.15
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.05
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.04
smart00299140 CLH Clathrin heavy chain repeat homology. 96.04
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.96
KOG1258577 consensus mRNA processing protein [RNA processing 95.92
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.89
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.79
smart00299140 CLH Clathrin heavy chain repeat homology. 95.74
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.72
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.57
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.55
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.49
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.45
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.43
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.4
PRK11906458 transcriptional regulator; Provisional 95.3
PRK09687280 putative lyase; Provisional 95.2
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.13
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.11
KOG1585308 consensus Protein required for fusion of vesicles 95.1
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.03
KOG1585308 consensus Protein required for fusion of vesicles 95.02
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.01
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.98
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.97
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.95
KOG2062 929 consensus 26S proteasome regulatory complex, subun 94.94
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 94.85
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 94.79
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.74
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.65
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.64
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.49
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.45
KOG3941406 consensus Intermediate in Toll signal transduction 94.44
PRK11619 644 lytic murein transglycosylase; Provisional 94.38
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.33
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.14
KOG4555175 consensus TPR repeat-containing protein [Function 94.13
KOG3941 406 consensus Intermediate in Toll signal transduction 94.09
KOG4234271 consensus TPR repeat-containing protein [General f 94.08
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.07
PF1342844 TPR_14: Tetratricopeptide repeat 94.0
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.93
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.91
KOG1586288 consensus Protein required for fusion of vesicles 93.87
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.77
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 93.72
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.59
KOG3364149 consensus Membrane protein involved in organellar 93.22
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.18
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.15
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.98
PRK09687280 putative lyase; Provisional 92.98
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.98
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.92
KOG1586288 consensus Protein required for fusion of vesicles 92.9
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.73
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.62
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.47
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.45
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.42
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.38
KOG2610 491 consensus Uncharacterized conserved protein [Funct 92.2
COG3629280 DnrI DNA-binding transcriptional activator of the 92.2
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.17
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.16
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.15
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 92.06
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.88
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.86
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.49
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.47
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.12
KOG4570418 consensus Uncharacterized conserved protein [Funct 90.88
KOG1550552 consensus Extracellular protein SEL-1 and related 90.25
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.18
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.14
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.03
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.93
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.62
PF1343134 TPR_17: Tetratricopeptide repeat 89.03
PRK11619 644 lytic murein transglycosylase; Provisional 89.0
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.9
KOG4234271 consensus TPR repeat-containing protein [General f 88.85
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.7
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 88.68
KOG1550552 consensus Extracellular protein SEL-1 and related 88.66
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 88.53
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 88.53
COG3629280 DnrI DNA-binding transcriptional activator of the 88.33
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.29
PF06552186 TOM20_plant: Plant specific mitochondrial import r 88.2
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.69
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 87.38
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 86.75
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.62
PRK10941269 hypothetical protein; Provisional 86.6
COG4455 273 ImpE Protein of avirulence locus involved in tempe 86.49
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.99
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 85.81
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.75
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 85.45
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.29
PRK10941269 hypothetical protein; Provisional 85.23
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.14
PRK12798 421 chemotaxis protein; Reviewed 84.98
KOG4507 886 consensus Uncharacterized conserved protein, conta 84.59
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 84.07
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.93
KOG4570 418 consensus Uncharacterized conserved protein [Funct 83.91
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.75
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.62
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 82.35
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 81.88
COG5159 421 RPN6 26S proteasome regulatory complex component [ 81.86
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 81.74
cd00280200 TRFH Telomeric Repeat binding Factor or TTAGGG Rep 81.59
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 81.53
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 81.2
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.2e-73  Score=588.34  Aligned_cols=504  Identities=31%  Similarity=0.501  Sum_probs=478.8

Q ss_pred             cchhhhhhcccccccCCCCCCCCCHHHHHHHHHhccCchHHHHHHHHHHHhCCCCChHHHHHHHHHHhcCCChHHHHHHh
Q 010031            7 NRLTTAIAPTTNIKSSHKPSNNITETHIISLIHSSNSTKQLRQIHAQIILHNLFASSRITTQLISSASLHKSIDYALSIF   86 (520)
Q Consensus         7 ~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~   86 (520)
                      +++++|..+|..|...++.|+..+++.++..+...+++..+.+++..+.+.|+.|+..++++++.+|++.|+++.|.++|
T Consensus       166 g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf  245 (857)
T PLN03077        166 GYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVF  245 (857)
T ss_pred             CCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHH
Confidence            67888888888888888888888888888888888888888888888888899999999999999999999999999999


Q ss_pred             cccCCCCcchHHHHHHHHHhCCChhHHHHHHHHhhhCCCCCCcccHHHHHHHHhccCChhhHHHHHHHHHHhCCCCChhH
Q 010031           87 DHFTPKNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFV  166 (520)
Q Consensus        87 ~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~  166 (520)
                      ++|+++|..+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+.+.+.+++..+.+.|+.||..+
T Consensus       246 ~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~  325 (857)
T PLN03077        246 DRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSV  325 (857)
T ss_pred             hcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCChhHHHHHhccCCCCCCCCCchhHHHHHHHHHhcCChhHHHHHHhhCCC-------------------
Q 010031          167 RVHLADMYVQLGKTRGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPK-------------------  227 (520)
Q Consensus       167 ~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~-------------------  227 (520)
                      |+.|+.+|++.|++++|.++|++|.    .||..+|+.++.+|++.|++++|.++|++|.+                   
T Consensus       326 ~n~Li~~y~k~g~~~~A~~vf~~m~----~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~  401 (857)
T PLN03077        326 CNSLIQMYLSLGSWGEAEKVFSRME----TKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACAC  401 (857)
T ss_pred             HHHHHHHHHhcCCHHHHHHHHhhCC----CCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhc
Confidence            9999999999999999999999997    45788888888888888888888888888742                   


Q ss_pred             --------------------CCHHHHHHHHHHHHhcCCHHHHHHHHhcCCCCCcccHHHHHHHHHhCCChhHHHHHHHHH
Q 010031          228 --------------------KNVASWVSLIDGFMRKGDLKKAGELFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQM  287 (520)
Q Consensus       228 --------------------~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m  287 (520)
                                          ++..+|+.|+.+|++.|++++|.++|++|.++|+++|+.++.+|++.|+.++|+.+|++|
T Consensus       402 ~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m  481 (857)
T PLN03077        402 LGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQM  481 (857)
T ss_pred             cchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHH
Confidence                                345566888889999999999999999999999999999999999999999999999999


Q ss_pred             HHcCCCCCHHHHHHHHHHhhccCChHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCCHHHHHHHHhcCCCCChhHHHH
Q 010031          288 LDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKEKDLLTWTA  367 (520)
Q Consensus       288 ~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~  367 (520)
                      .. ++.||..||+.++.+|++.|+++.+.+++..+.+.|+.++..++++|+++|+++|++++|.++|+.+ .+|..+||+
T Consensus       482 ~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~  559 (857)
T PLN03077        482 LL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNI  559 (857)
T ss_pred             Hh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHH
Confidence            86 5899999999999999999999999999999999999999999999999999999999999999999 899999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCcHHHHHHHHHHcHhhcCCCCChhHHHHHHHHHhccC
Q 010031          368 MIWGLAIHGRYEQAIQYFKKMMYSGTEPDGTVFLAILTACWYSGQVKLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVG  447 (520)
Q Consensus       368 l~~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g  447 (520)
                      +|.+|++.|+.++|.++|++|.+.|+.||..||+.++.+|.+.|++++|.++|+.|.+..|+.|+..+|+.++.+|.+.|
T Consensus       560 lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G  639 (857)
T PLN03077        560 LLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAG  639 (857)
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999999999999999999999999999999977899999999999999999999


Q ss_pred             ChHHHHHHHhhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHhcCCCCCcchhHHHHhhhhhccCCC
Q 010031          448 QVDKALNFINKMPETPDFVIWGALFCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQKGDGR  516 (520)
Q Consensus       448 ~~~~A~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~  516 (520)
                      ++++|.+++++|..+||..+|++|+.+|..+|+.+.|+...+++++++|+++..+..++++|...|+.+
T Consensus       640 ~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~  708 (857)
T PLN03077        640 KLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWD  708 (857)
T ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChH
Confidence            999999999999889999999999999999999999999999999999999999999999999998854



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 9e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 56.4 bits (134), Expect = 2e-08
 Identities = 18/178 (10%), Positives = 55/178 (30%), Gaps = 8/178 (4%)

Query: 120 MLRLSVRPNRLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGK 179
             +    P       + +       L + +       ++ +       +      +   +
Sbjct: 83  TRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQ 142

Query: 180 TRGAFKVFD---ETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKK----NVAS 232
              A  +        +K K  ++ ++N ++ G ++ G  ++ V +  M+       ++ S
Sbjct: 143 LPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLS 202

Query: 233 WVSLIDGFMRKGDLKKAGE-LFEQMPEKGVVSWTAMINGFSQNGEAEKALAMFFQMLD 289
           + + +    R+       E   EQM ++G+              +    L    ++  
Sbjct: 203 YAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKP 260


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.82
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.82
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.76
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
3u4t_A272 TPR repeat-containing protein; structural genomics 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.67
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.63
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.63
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.54
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.52
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.49
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.49
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.49
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.47
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.43
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.4
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.4
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.31
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.3
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.29
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.27
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.25
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.16
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.1
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.1
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.07
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.07
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.01
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.01
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.98
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.97
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.97
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.97
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.96
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.96
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.95
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.95
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.92
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.91
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.91
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.89
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.86
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.84
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.83
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.82
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.81
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.79
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.78
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.76
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.75
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.7
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.7
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.7
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.69
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.65
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.61
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.58
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.58
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.57
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.56
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.56
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.55
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.5
3k9i_A117 BH0479 protein; putative protein binding protein, 98.49
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.48
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.47
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.47
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.46
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.45
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.45
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.45
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.42
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.41
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.4
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.38
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.37
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.28
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.25
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.25
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.24
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.24
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.17
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.15
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.07
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.01
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.96
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.91
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.89
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.82
3k9i_A117 BH0479 protein; putative protein binding protein, 97.8
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.76
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.7
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.57
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.57
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.56
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.46
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.43
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.42
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.41
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.39
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.32
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.02
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.98
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.73
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.71
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.53
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.53
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.43
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.32
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.64
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.6
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.53
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.45
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.42
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.09
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.8
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.36
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.02
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.53
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.01
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.76
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.62
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.57
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.38
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 92.23
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 91.11
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.94
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 90.83
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 90.78
2uwj_G115 Type III export protein PSCG; virulence, chaperone 89.96
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.71
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.67
2p58_C116 Putative type III secretion protein YSCG; type III 89.63
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.02
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.32
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.01
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.83
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 87.2
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 86.35
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 86.01
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 85.93
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.98
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.24
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 82.87
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 82.69
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.84
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.16
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 80.58
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1e-41  Score=343.74  Aligned_cols=446  Identities=12%  Similarity=0.049  Sum_probs=347.5

Q ss_pred             CChHHHHHHHHHHhcCCChHHHHHHhcccCC--CCcchHHHHHHHHHhCCChhHHHHHHHHhhhCCCCCCcccHHHHHHH
Q 010031           61 ASSRITTQLISSASLHKSIDYALSIFDHFTP--KNLHIFNVLIRGLAENSHFQSCISHFVFMLRLSVRPNRLTYPFVSKS  138 (520)
Q Consensus        61 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~ll~~  138 (520)
                      ++...++.++..|.+.|++++|+.+|+++..  |+..++..++.+|.+.|++++|+.+|+++..  .+++..+++.++.+
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~--~~~~~~~~~~l~~~  159 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDL--YNRSSACRYLAAFC  159 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCG--GGTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhc--cccchhHHHHHHHH
Confidence            3455555556666666666666665555532  4445555555566666666666666655543  23455555555556


Q ss_pred             HhccCChhhHHHHHHHHHHh---------------CCCCChhHHHHHHHHHHhcCChhHHHHHhccCCCCC---------
Q 010031          139 VASLSLLSLGRGLHCLIVKS---------------GVEYDAFVRVHLADMYVQLGKTRGAFKVFDETPEKN---------  194 (520)
Q Consensus       139 ~~~~~~~~~a~~~~~~~~~~---------------~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~---------  194 (520)
                      +.+.|++++|.++|+++...               +.+++..+|+.++.+|.+.|++++|.++|++|.+.+         
T Consensus       160 ~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~  239 (597)
T 2xpi_A          160 LVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQ  239 (597)
T ss_dssp             HHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHH
T ss_pred             HHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHH
Confidence            66666666666555532111               112245556666666666666666666666555442         


Q ss_pred             ----------------------------CCCCchhHHHHHHHHHhcCChhHHHHHHhhCCC--CCHHHHHHHHHHHHhcC
Q 010031          195 ----------------------------KSESVLLWNVLINGCSKIGYLRKAVELFGMMPK--KNVASWVSLIDGFMRKG  244 (520)
Q Consensus       195 ----------------------------~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~--~~~~~~~~l~~~~~~~~  244 (520)
                                                  ..+...+|+.++..|.+.|++++|..+|+++.+  ++..+++.++.+|.+.|
T Consensus       240 l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g  319 (597)
T 2xpi_A          240 LVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRS  319 (597)
T ss_dssp             HHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTT
T ss_pred             HHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhc
Confidence                                        111222333445667788999999999999998  89999999999999999


Q ss_pred             CHHHHHHHHhcCCC---CCcccHHHHHHHHHhCCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHhhccCChHHHHHHHHH
Q 010031          245 DLKKAGELFEQMPE---KGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNY  321 (520)
Q Consensus       245 ~~~~a~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~  321 (520)
                      ++++|.++|+++.+   .+..+|..++.+|.+.|++++|..+++++.... +.+..++..++..|.+.|++++|..+|++
T Consensus       320 ~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  398 (597)
T 2xpi_A          320 RFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSK  398 (597)
T ss_dssp             CHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHH
Confidence            99999999999863   357889999999999999999999999998763 56788999999999999999999999999


Q ss_pred             HHHcCCCCChhHHHHHHHHHHhcCCHHHHHHHHhcCCC---CChhHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHH
Q 010031          322 ISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFGETKE---KDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPDGT  398 (520)
Q Consensus       322 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~p~~~  398 (520)
                      +.+.. +.+..+++.++.+|.+.|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|.++|+++.+.. ..+..
T Consensus       399 ~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~  476 (597)
T 2xpi_A          399 SSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPL  476 (597)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHH
T ss_pred             HHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChH
Confidence            98764 34678999999999999999999999998754   477899999999999999999999999999853 33677


Q ss_pred             HHHHHHHHHHccCcHHHHHHHHHHcHhhc---CCCCC--hhHHHHHHHHHhccCChHHHHHHHhhCCC--CCCHHHHHHH
Q 010031          399 VFLAILTACWYSGQVKLALNFFDSMRFDY---FIEPS--VKHHTVVVNLLSRVGQVDKALNFINKMPE--TPDFVIWGAL  471 (520)
Q Consensus       399 ~~~~l~~~~~~~g~~~~a~~~~~~~~~~~---~~~~~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~~--~~~~~~~~~l  471 (520)
                      +|..++..|.+.|++++|.++|+++.+..   +..|+  ..+|..++.+|.+.|++++|++.++++..  +.+..+|..+
T Consensus       477 ~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l  556 (597)
T 2xpi_A          477 LLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAI  556 (597)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHH
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHH
Confidence            99999999999999999999999997532   55777  67999999999999999999999999765  4578899999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHhcCCCCCcchhHHHHhhhhh
Q 010031          472 FCACRTHKDTKIAKIALQSSCSLNLSIPQAMSYCQTFMQQ  511 (520)
Q Consensus       472 ~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~  511 (520)
                      ..+|.+.|++++|.+.++++++++|+++.++..++.+|.+
T Consensus       557 ~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          557 ALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC-
T ss_pred             HHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhc
Confidence            9999999999999999999999999999999999998864



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 520
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.7 bits (99), Expect = 7e-05
 Identities = 25/204 (12%), Positives = 71/204 (34%), Gaps = 13/204 (6%)

Query: 194 NKSESVLLWNVLINGCSKIGYLRKAVELFGMMPK---KNVASWVSLIDGFMRKGDLKKAG 250
            +    + W+ L    +  G +  A+  F          + ++++L +         +A 
Sbjct: 164 TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAV 223

Query: 251 ELFEQMPEKGVVSWTAMIN---GFSQNGEAEKALAMFFQMLDAGVRANDFTVVSAL-SAC 306
             + +             N    + + G  + A+  + + ++  ++ +       L +A 
Sbjct: 224 AAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANAL 281

Query: 307 AKVGALEAGVRVHNYISCNDFGLKGAIGTALVDMYAKCGNIEAASLVFG---ETKEKDLL 363
            + G++      +N                L ++  + GNIE A  ++    E   +   
Sbjct: 282 KEKGSVAEAEDCYNTALRLCPT-HADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAA 340

Query: 364 TWTAMIWGLAIHGRYEQAIQYFKK 387
             + +   L   G+ ++A+ ++K+
Sbjct: 341 AHSNLASVLQQQGKLQEALMHYKE 364


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.68
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.58
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.27
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.25
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.24
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.2
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.14
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.14
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.0
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.99
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.94
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.85
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.8
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.78
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.77
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.75
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.72
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.59
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 98.53
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.4
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.37
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.28
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.28
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.23
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.22
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.15
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.15
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.06
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.05
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.03
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.93
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.84
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.77
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.72
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.53
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.48
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.35
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.21
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.03
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.92
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.78
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.95
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.56
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.34
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.98
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.6
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.88
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.55
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 83.01
d3bqoa1204 TRF1 {Human (Homo sapiens) [TaxId: 9606]} 80.02
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=6.6e-25  Score=205.88  Aligned_cols=372  Identities=12%  Similarity=0.100  Sum_probs=254.7

Q ss_pred             HHHHhCCChhHHHHHHHHhhhCCCCCC-cccHHHHHHHHhccCChhhHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCCh
Q 010031          102 RGLAENSHFQSCISHFVFMLRLSVRPN-RLTYPFVSKSVASLSLLSLGRGLHCLIVKSGVEYDAFVRVHLADMYVQLGKT  180 (520)
Q Consensus       102 ~~~~~~~~~~~A~~~~~~m~~~~~~p~-~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~  180 (520)
                      ..+.+.|++++|.+.|+++.+.  .|+ ...+..+...+...|++++|...++.+++... .+..++..+..+|.+.|++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~--~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p-~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQ--EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-LLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHhhhhccc
Confidence            3445555666666666555542  232 33444444555555555555555555555431 2344555555555555555


Q ss_pred             hHHHHHhccCCCCCCCCCchhHHHHHHHHHhcCChhHHHHHHhhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHhcC---C
Q 010031          181 RGAFKVFDETPEKNKSESVLLWNVLINGCSKIGYLRKAVELFGMMPKKNVASWVSLIDGFMRKGDLKKAGELFEQM---P  257 (520)
Q Consensus       181 ~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~---~  257 (520)
                      ++|...+....... +.+...+........                               ..+....+.......   .
T Consensus        84 ~~A~~~~~~~~~~~-~~~~~~~~~~~~~~~-------------------------------~~~~~~~~~~~~~~~~~~~  131 (388)
T d1w3ba_          84 QEAIEHYRHALRLK-PDFIDGYINLAAALV-------------------------------AAGDMEGAVQAYVSALQYN  131 (388)
T ss_dssp             HHHHHHHHHHHHHC-TTCHHHHHHHHHHHH-------------------------------HHSCSSHHHHHHHHHHHHC
T ss_pred             cccccccccccccc-ccccccccccccccc-------------------------------ccccccccccccccccccc
Confidence            55555555444332 222222222222222                               222222222222111   1


Q ss_pred             CCCcccHHHHHHHHHhCCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHhhccCChHHHHHHHHHHHHcCCCCChhHHHHH
Q 010031          258 EKGVVSWTAMINGFSQNGEAEKALAMFFQMLDAGVRANDFTVVSALSACAKVGALEAGVRVHNYISCNDFGLKGAIGTAL  337 (520)
Q Consensus       258 ~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l  337 (520)
                      .................+....+...+....... +.+...+..+...+...|+++.|...++...+.. +.+...+..+
T Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l  209 (388)
T d1w3ba_         132 PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINL  209 (388)
T ss_dssp             TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHH
T ss_pred             cccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHH
Confidence            1223334445555666677777777777666553 3345666677777778888888888888877654 2355677778


Q ss_pred             HHHHHhcCCHHHHHHHHhcCCC---CChhHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHccCcH
Q 010031          338 VDMYAKCGNIEAASLVFGETKE---KDLLTWTAMIWGLAIHGRYEQAIQYFKKMMYSGTEPD-GTVFLAILTACWYSGQV  413 (520)
Q Consensus       338 ~~~~~~~~~~~~a~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~p~-~~~~~~l~~~~~~~g~~  413 (520)
                      ...+...|++++|...++....   .+...+..+...+...|++++|+..|+++.+  +.|+ ..++..+...+...|++
T Consensus       210 ~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~  287 (388)
T d1w3ba_         210 GNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSV  287 (388)
T ss_dssp             HHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSCH
T ss_pred             hhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCH
Confidence            8888888888888888876554   4556778888999999999999999999988  4565 45888899999999999


Q ss_pred             HHHHHHHHHcHhhcCCCCChhHHHHHHHHHhccCChHHHHHHHhhCCC-CC-CHHHHHHHHHHHHHcCCHHHHHHHHHHH
Q 010031          414 KLALNFFDSMRFDYFIEPSVKHHTVVVNLLSRVGQVDKALNFINKMPE-TP-DFVIWGALFCACRTHKDTKIAKIALQSS  491 (520)
Q Consensus       414 ~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~-~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~  491 (520)
                      ++|.+.++.....  .+.+...+..+..++.+.|++++|++.+++... .| +..++..+..++...|++++|+..++++
T Consensus       288 ~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a  365 (388)
T d1w3ba_         288 AEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEA  365 (388)
T ss_dssp             HHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHH
T ss_pred             HHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            9999999998753  356677888999999999999999999999765 44 5778999999999999999999999999


Q ss_pred             hcCCCCCcchhHHHHhhhhhccC
Q 010031          492 CSLNLSIPQAMSYCQTFMQQKGD  514 (520)
Q Consensus       492 ~~~~p~~~~~~~~l~~~~~~~g~  514 (520)
                      ++++|+++.++..+|.+|.+.||
T Consensus       366 l~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         366 IRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHhCCCCHHHHHHHHHHHHHcCC
Confidence            99999999999999999999997



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3bqoa1 a.146.1.1 (A:62-265) TRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure