Citrus Sinensis ID: 010130

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM
ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccEEEcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccc
cEEEHHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHccEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccEEEEcHHcccccccccccHHHHHHHHHHHHccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHccccccccccHccccccccccccccccccccccccccccccccccccEcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEEEEcHHHcc
mvlvsdfplqtiffgelypAETRKFVERLINYVIYkgtflplvipptvfqaGLWSVWLTVLCSLKMFQALARDRLERlnaspsatpwTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLhhsagnstncarsKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHlhaalpdatseELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLnemyscptcrkplfvgrreieansrpgevssdEQLARQLSMgldrqnntgqtlptgvfpnqtqppvegspwrnagldsswlhawpsqgvdgagpstamRSVGLSRVQMMMRHLASVGETYAQTAIedtswslwpmnpsqasasgspvppavpgrhpgntggaharstsrsaNENIANILAMAETVREVlphmpedlifqdlqrtnsatITVNNLLQM
mvlvsdfplqtiffgelypaETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEansrpgevssdeQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLifqdlqrtnsatitvnnllqm
MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNpsqasasgspvppavpgRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM
**LVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGR**********************************************************LDSSWLHAWP*****************LSRVQMMMRHLASVGETYAQTAIEDTSWSLW*****************************************IANILAMAETVREVLPHMPEDLIFQDLQRTN*ATIT*******
MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRK***********************************************************************************************************************************************************************************H*PEDLIFQDLQRTNSATITVNNLLQM
MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIE**************ARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNP*************VPGRH*************RSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM
MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFV**************************************************************************************GLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMN*****************************STSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQ*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query517 2.2.26 [Sep-21-2011]
Q8VYC8578 E3 ubiquitin protein liga yes no 0.969 0.866 0.724 0.0
Q8W4Q5577 E3 ubiquitin protein liga no no 0.970 0.870 0.700 0.0
Q9R049643 E3 ubiquitin-protein liga yes no 0.582 0.468 0.295 1e-26
Q9UKV5643 E3 ubiquitin-protein liga yes no 0.582 0.468 0.292 1e-26
Q803I8625 E3 ubiquitin-protein liga no no 0.504 0.417 0.263 4e-20
Q5XHH7595 E3 ubiquitin-protein liga N/A no 0.499 0.433 0.262 3e-19
Q6NRL6605 E3 ubiquitin-protein liga N/A no 0.499 0.426 0.262 6e-19
Q9DBY1612 E3 ubiquitin-protein liga no no 0.537 0.454 0.265 2e-18
Q86TM6617 E3 ubiquitin-protein liga no no 0.537 0.450 0.265 3e-18
Q20798610 E3 ubiquitin-protein liga yes no 0.528 0.447 0.260 7e-15
>sp|Q8VYC8|RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana GN=RIN2 PE=1 SV=1 Back     alignment and function desciption
 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/509 (72%), Positives = 429/509 (84%), Gaps = 8/509 (1%)

Query: 9   LQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQ 68
           L+T+FFG+LY  ET+K VERL NY+IYKGTFLPLVIPPT+FQ  LW+VWLTVLC+LKMFQ
Sbjct: 78  LKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQGVLWTVWLTVLCTLKMFQ 137

Query: 69  ALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFE 128
           ALARDRLERLNASPS+TPWTYFRV+S L  VL+VD+FWI++ L+ + T+ S+++LLL FE
Sbjct: 138 ALARDRLERLNASPSSTPWTYFRVYSVLFLVLSVDMFWIKLSLMTYNTIGSAVYLLLLFE 197

Query: 129 PLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFG 188
           P S+AFET+QA+L+HGFQLLD+W++H A  +++C RSKF D++ AGSLLEWKG+L RN G
Sbjct: 198 PCSIAFETLQALLIHGFQLLDMWINHLAVKNSDCQRSKFIDSMTAGSLLEWKGLLNRNLG 257

Query: 189 FFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGH 248
           FFLDMATL+MALGHY+HIWWL G+AFHLVDA+LFLNIRALLSAI+KRIKG+IKLRIALG 
Sbjct: 258 FFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLSAILKRIKGYIKLRIALGA 317

Query: 249 LHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPT 308
           LHAALPDATSEELRAYDDECAICREPMAKAK+L CNHLFHL CLRSWLDQGLNE+YSCPT
Sbjct: 318 LHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHLFHLGCLRSWLDQGLNEVYSCPT 377

Query: 309 CRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEG 368
           CRKPLFVGR E E N R  EVSSDEQLARQ    L+RQNN    L TG+FP +    VE 
Sbjct: 378 CRKPLFVGRTENEVNPRTVEVSSDEQLARQ----LERQNNPVHALATGLFPAEVPDSVEN 433

Query: 369 SPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDT 428
              RN GLD SWL  W SQG D AGPST  R+VGL RVQMMMRHLASVGE+YAQTA++D 
Sbjct: 434 DTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDA 493

Query: 429 SWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREV 488
           +WSLWPMNPSQAS S + VPP   GR    TGG H R+ S + NE++ NILAMAETVREV
Sbjct: 494 AWSLWPMNPSQASTSSTTVPPGNGGR----TGGLHLRTVSNTTNESLTNILAMAETVREV 549

Query: 489 LPHMPEDLIFQDLQRTNSATITVNNLLQM 517
           +PH+P+++IFQDLQRTNS  +TVNNLLQM
Sbjct: 550 MPHVPDEIIFQDLQRTNSVAVTVNNLLQM 578
E3 ubiquitin protein ligase that acts as positive regulator of RPM1- and RPS2-dependent hypersensitive response (HR), in association with RIN3. Probably not required for RPM1 degradation during HR.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8W4Q5|RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana GN=RIN3 PE=1 SV=2 Back     alignment and function description
>sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 Back     alignment and function description
>sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 Back     alignment and function description
>sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 Back     alignment and function description
>sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 Back     alignment and function description
>sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 Back     alignment and function description
>sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 Back     alignment and function description
>sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 Back     alignment and function description
>sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
255539769585 protein binding protein, putative [Ricin 0.986 0.871 0.800 0.0
224125224571 predicted protein [Populus trichocarpa] 0.982 0.889 0.793 0.0
225466103587 PREDICTED: E3 ubiquitin protein ligase R 0.984 0.867 0.795 0.0
224071523581 predicted protein [Populus trichocarpa] 0.978 0.870 0.772 0.0
357455727589 E3 ubiquitin-protein ligase synoviolin [ 0.984 0.864 0.755 0.0
356508268586 PREDICTED: E3 ubiquitin protein ligase R 0.982 0.866 0.760 0.0
356517740586 PREDICTED: E3 ubiquitin protein ligase R 0.982 0.866 0.760 0.0
297792453577 predicted protein [Arabidopsis lyrata su 0.967 0.866 0.728 0.0
22328916578 E3 ubiquitin protein ligase RIN2 [Arabid 0.969 0.866 0.724 0.0
449444639586 PREDICTED: E3 ubiquitin protein ligase R 0.982 0.866 0.760 0.0
>gi|255539769|ref|XP_002510949.1| protein binding protein, putative [Ricinus communis] gi|223550064|gb|EEF51551.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/512 (80%), Positives = 454/512 (88%), Gaps = 2/512 (0%)

Query: 6   DFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLK 65
           +  L+TIFF ELYP+ETRK +ERL+NYVIYKGTFLPLVIP T+FQAGLWS WLTVLCSLK
Sbjct: 76  NLSLKTIFFAELYPSETRKLMERLVNYVIYKGTFLPLVIPATIFQAGLWSSWLTVLCSLK 135

Query: 66  MFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLL 125
           MFQALARDRLERLNASPSA PWTYFRV+S LL VL+VD FWIR+C L+++TLD+SMF+LL
Sbjct: 136 MFQALARDRLERLNASPSAMPWTYFRVYSVLLLVLSVDFFWIRLCWLIYRTLDTSMFMLL 195

Query: 126 FFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIR 185
           F+EP S+AFETMQA+LVHGFQLLDIW HHSAGN  NC R KFFD +AAGSL EWKGILIR
Sbjct: 196 FYEPFSIAFETMQAMLVHGFQLLDIWFHHSAGNDANCQRFKFFDPIAAGSLSEWKGILIR 255

Query: 186 NFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIA 245
           N GF LDMATLLMALGHY+HIWWL G+AFHLVDA+LFLNIRALLSAIIKR++GF+KLRIA
Sbjct: 256 NLGFSLDMATLLMALGHYMHIWWLHGVAFHLVDAVLFLNIRALLSAIIKRVRGFVKLRIA 315

Query: 246 LGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYS 305
           LG LHAALPDATSEELRAYDDECAICREPMAKAKKL C+HLFHLACLRSWLDQGLNEMYS
Sbjct: 316 LGALHAALPDATSEELRAYDDECAICREPMAKAKKLHCSHLFHLACLRSWLDQGLNEMYS 375

Query: 306 CPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPP 365
           CPTCRKPLFVGR + E +    +VS+DEQLARQ+S GLD+QN    TLP GVFPNQ +  
Sbjct: 376 CPTCRKPLFVGRPDNEPSRHRRDVSADEQLARQISEGLDQQN--APTLPAGVFPNQMRNS 433

Query: 366 VEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAI 425
           +EGSPWR+AGLDSSWLH W  QGVDGAGPSTAMRSVGL RVQMMMRHLASVGETYAQTA+
Sbjct: 434 IEGSPWRSAGLDSSWLHTWQGQGVDGAGPSTAMRSVGLGRVQMMMRHLASVGETYAQTAL 493

Query: 426 EDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETV 485
           ED++WSLWPMNP Q  ASGS VPPA  GR  G TGG H RS SRSAN+N+AN+LAMAETV
Sbjct: 494 EDSAWSLWPMNPPQGVASGSLVPPATGGRSAGGTGGLHMRSPSRSANDNVANLLAMAETV 553

Query: 486 REVLPHMPEDLIFQDLQRTNSATITVNNLLQM 517
           REVLPH+P++LI QDLQRTNS T+TVNNLLQM
Sbjct: 554 REVLPHIPDELILQDLQRTNSVTVTVNNLLQM 585

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125224|ref|XP_002329924.1| predicted protein [Populus trichocarpa] gi|222871161|gb|EEF08292.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225466103|ref|XP_002266334.1| PREDICTED: E3 ubiquitin protein ligase RIN2 [Vitis vinifera] gi|296084203|emb|CBI24591.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224071523|ref|XP_002303501.1| predicted protein [Populus trichocarpa] gi|222840933|gb|EEE78480.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357455727|ref|XP_003598144.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] gi|355487192|gb|AES68395.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] Back     alignment and taxonomy information
>gi|356508268|ref|XP_003522880.1| PREDICTED: E3 ubiquitin protein ligase RIN2-like [Glycine max] Back     alignment and taxonomy information
>gi|356517740|ref|XP_003527544.1| PREDICTED: E3 ubiquitin protein ligase RIN2-like [Glycine max] Back     alignment and taxonomy information
>gi|297792453|ref|XP_002864111.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309946|gb|EFH40370.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22328916|ref|NP_194253.2| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] gi|30686808|ref|NP_849552.1| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] gi|75304438|sp|Q8VYC8.1|RIN2_ARATH RecName: Full=E3 ubiquitin protein ligase RIN2; AltName: Full=AMF receptor-like protein 1A; AltName: Full=RPM1-interacting protein 2 gi|18176187|gb|AAL60000.1| unknown protein [Arabidopsis thaliana] gi|332659628|gb|AEE85028.1| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] gi|332659629|gb|AEE85029.1| E3 ubiquitin protein ligase RIN2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449444639|ref|XP_004140081.1| PREDICTED: E3 ubiquitin protein ligase RIN2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
TAIR|locus:2122674578 RIN2 "RPM1 interacting protein 0.969 0.866 0.705 4.7e-199
RGD|1311551643 Amfr "autocrine motility facto 0.286 0.230 0.325 4.1e-26
UNIPROTKB|F1MWZ9646 AMFR "Uncharacterized protein" 0.295 0.236 0.348 5.3e-23
TAIR|locus:2093422492 Hrd1A "homolog of yeast Hrd1" 0.301 0.317 0.341 6.4e-23
ZFIN|ZDB-GENE-040426-2190620 amfr "autocrine motility facto 0.257 0.214 0.374 1.1e-22
MGI|MGI:1345634643 Amfr "autocrine motility facto 0.295 0.237 0.348 1.6e-22
UNIPROTKB|F1PK72560 AMFR "Uncharacterized protein" 0.295 0.273 0.335 4.1e-22
UNIPROTKB|Q9UKV5643 AMFR "E3 ubiquitin-protein lig 0.295 0.237 0.341 4.4e-22
TAIR|locus:2014993460 Hrd1B "homolog of yeast Hrd1" 0.332 0.373 0.305 1.2e-21
UNIPROTKB|H3BRK9288 AMFR "E3 ubiquitin-protein lig 0.222 0.399 0.375 2.3e-21
TAIR|locus:2122674 RIN2 "RPM1 interacting protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1927 (683.4 bits), Expect = 4.7e-199, P = 4.7e-199
 Identities = 359/509 (70%), Positives = 419/509 (82%)

Query:     9 LQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQ 68
             L+T+FFG+LY  ET+K VERL NY+IYKGTFLPLVIPPT+FQ  LW+VWLTVLC+LKMFQ
Sbjct:    78 LKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQGVLWTVWLTVLCTLKMFQ 137

Query:    69 ALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFE 128
             ALARDRLERLNASPS+TPWTYFRV+S L  VL+VD+FWI++ L+ + T+ S+++LLL FE
Sbjct:   138 ALARDRLERLNASPSSTPWTYFRVYSVLFLVLSVDMFWIKLSLMTYNTIGSAVYLLLLFE 197

Query:   129 PLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFG 188
             P S+AFET+QA+L+HGFQLLD+W++H A  +++C RSKF D++ AGSLLEWKG+L RN G
Sbjct:   198 PCSIAFETLQALLIHGFQLLDMWINHLAVKNSDCQRSKFIDSMTAGSLLEWKGLLNRNLG 257

Query:   189 FFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGH 248
             FFLDMATL+MALGHY+HIWWL G+AFHLVDA+LFLNIRALLSAI+KRIKG+IKLRIALG 
Sbjct:   258 FFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLSAILKRIKGYIKLRIALGA 317

Query:   249 LHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPT 308
             LHAALPDATSEELRAYDDECAICREPMAKAK+L CNHLFHL CLRSWLDQGLNE+YSCPT
Sbjct:   318 LHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHLFHLGCLRSWLDQGLNEVYSCPT 377

Query:   309 CRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEG 368
             CRKPLFVGR E E N R  EVSSDEQLARQL    +RQNN    L TG+FP +    VE 
Sbjct:   378 CRKPLFVGRTENEVNPRTVEVSSDEQLARQL----ERQNNPVHALATGLFPAEVPDSVEN 433

Query:   369 SPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDT 428
                RN GLD SWL  W SQG D AGPST  R+VGL RVQMMMRHLASVGE+YAQTA++D 
Sbjct:   434 DTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDA 493

Query:   429 SWSLWPMNXXXXXXXXXXXXXXXXXRHPGNTGGAHARSTSRSANENIANILAMAETVREV 488
             +WSLWPMN                  + G TGG H R+ S + NE++ NILAMAETVREV
Sbjct:   494 AWSLWPMNPSQASTSSTTVPPG----NGGRTGGLHLRTVSNTTNESLTNILAMAETVREV 549

Query:   489 LPHMPEDLIFQDLQRTNSATITVNNLLQM 517
             +PH+P+++IFQDLQRTNS  +TVNNLLQM
Sbjct:   550 MPHVPDEIIFQDLQRTNSVAVTVNNLLQM 578
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0034052 "positive regulation of plant-type hypersensitive response" evidence=IGI
RGD|1311551 Amfr "autocrine motility factor receptor, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWZ9 AMFR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2093422 Hrd1A "homolog of yeast Hrd1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2190 amfr "autocrine motility factor receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1345634 Amfr "autocrine motility factor receptor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK72 AMFR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKV5 AMFR "E3 ubiquitin-protein ligase AMFR" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2014993 Hrd1B "homolog of yeast Hrd1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H3BRK9 AMFR "E3 ubiquitin-protein ligase AMFR" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYC8RIN2_ARATH6, ., 3, ., 2, ., -0.72490.96900.8667yesno
Q8W4Q5RIN3_ARATH6, ., 3, ., 2, ., -0.70050.97090.8700nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01270083
hypothetical protein (571 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 9e-17
cd0016245 cd00162, RING, RING-finger (Really Interesting New 9e-13
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 9e-13
smart0018440 smart00184, RING, Ring finger 2e-09
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 5e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-08
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-06
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 4e-05
smart0054643 smart00546, CUE, Domain that may be involved in bi 1e-04
pfam0284542 pfam02845, CUE, CUE domain 1e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 6e-04
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 0.004
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 82.7 bits (204), Expect = 9e-17
 Identities = 103/499 (20%), Positives = 166/499 (33%), Gaps = 97/499 (19%)

Query: 9   LQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGL---WSVWLTVLCSLK 65
           L+T+ FG L   E     E+L   +      L  +   +VF+  +   + + L+ L   K
Sbjct: 61  LKTLLFGSLRTFELELLYEQLWITLT---EILLAI---SVFREAISFSFFMLLSTLLFAK 114

Query: 66  MFQALARDRLERLNASPSATPWTYFRVFSALLFVLAV-DIFWIRMCLLLFKTLDSSMFLL 124
           +F  +   R ERL    +   +  F  FS   F+L++ D   I +C+     +D S  L 
Sbjct: 115 VFHWILSFRTERLQIQSTDQRFHIFSRFSCAYFLLSILDASLIYLCISSEHLIDKST-LF 173

Query: 125 LFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILI 184
           LF    SV    + +                   ST                        
Sbjct: 174 LFVCEFSVLLLNLTSEANKLCVYNYEARDDDDERST------------------------ 209

Query: 185 RNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAI-------LFLNIRALLSAIIKRIK 237
             + F L++         Y  +  L      +           L   +     A+ +RI+
Sbjct: 210 --YLFRLEVC--------YDGLTLLAYSLLFMYQFPYVRVPIYLIRQMYTCFYALFRRIR 259

Query: 238 GFIKLRIALGHLHAALPDATSEELRAYDDECAICREPM-------------AKAKKLLCN 284
              + R A   L+A  P AT E+L   D  C IC + M                K+L C 
Sbjct: 260 EHARFRRATKDLNAMYPTATEEQLTNSDRTCTICMDEMFHPDHEPLPRGLDMTPKRLPCG 319

Query: 285 HLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLD 344
           H+ HL CL++WL++      +CP CR+P+   +    + +       + Q+A Q+     
Sbjct: 320 HILHLHCLKNWLER----QQTCPICRRPVIFDQS---SPTPASPNVRNTQIATQVPN--- 369

Query: 345 RQNNTGQTLPTGVFPNQTQ--PPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVG 402
             +NT  T       N +    P   +            +  P+    G     A  +  
Sbjct: 370 -PDNTPTTTAVPGITNSSNQGDPQASTF-----------NGVPNANSSG----FAAHTQD 413

Query: 403 LSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVP--GRHPG-NT 459
           LS V      L   G      +   T+ S  P      S S    P   P  G +P  N 
Sbjct: 414 LSSVIPGWTMLPIPGTRRISQSTSTTNPSATPTT-GDPSNSTYGGPQTFPNSGNNPNFNR 472

Query: 460 GGAHARSTSRSANENIANI 478
           G A      R  + N  ++
Sbjct: 473 GIAGIVPPWRLVSSNTQSL 491

Length = 491
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214715 smart00546, CUE, Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>gnl|CDD|202430 pfam02845, CUE, CUE domain Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 517
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 100.0
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 100.0
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.32
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.19
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.08
PHA02929238 N1R/p28-like protein; Provisional 99.06
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.06
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.01
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.0
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.99
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.84
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.83
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.77
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.76
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.71
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.7
PHA02926242 zinc finger-like protein; Provisional 98.63
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.61
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.61
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.57
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.56
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.51
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.51
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.49
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.49
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.48
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.42
PF1463444 zf-RING_5: zinc-RING finger domain 98.3
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.26
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.24
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.09
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.09
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.06
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 98.05
smart0054643 CUE Domain that may be involved in binding ubiquit 98.04
COG52191525 Uncharacterized conserved protein, contains RING Z 97.93
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.92
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.91
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.84
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.83
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.81
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.76
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
PF13705508 TRC8_N: TRC8 N-terminal domain 97.72
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.69
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.57
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.54
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.5
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.38
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.37
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.17
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.0
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.99
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.95
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.87
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.82
COG5152259 Uncharacterized conserved protein, contains RING a 96.81
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.79
KOG1941518 consensus Acetylcholine receptor-associated protei 96.74
KOG4445368 consensus Uncharacterized conserved protein, conta 96.61
COG5222427 Uncharacterized conserved protein, contains RING Z 96.49
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.42
KOG2660331 consensus Locus-specific chromosome binding protei 96.29
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.27
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.18
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.16
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.54
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.41
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.28
PHA02825162 LAP/PHD finger-like protein; Provisional 95.23
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 94.98
PF1154753 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro 94.85
PHA02862156 5L protein; Provisional 94.6
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.58
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.51
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.47
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.42
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.28
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.08
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.99
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.52
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.41
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 92.98
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 92.91
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.45
KOG1001674 consensus Helicase-like transcription factor HLTF/ 92.36
PHA03096284 p28-like protein; Provisional 92.13
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.13
KOG1940276 consensus Zn-finger protein [General function pred 90.86
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 89.83
KOG4367 699 consensus Predicted Zn-finger protein [Function un 89.74
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 89.65
KOG4739233 consensus Uncharacterized protein involved in syna 89.29
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 89.29
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 89.02
KOG3002299 consensus Zn finger protein [General function pred 88.67
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 88.31
PF04641260 Rtf2: Rtf2 RING-finger 88.2
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 87.8
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.72
KOG02981394 consensus DEAD box-containing helicase-like transc 87.35
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 86.92
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 86.46
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 85.67
KOG3053293 consensus Uncharacterized conserved protein [Funct 85.6
KOG3899381 consensus Uncharacterized conserved protein [Funct 84.92
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 83.82
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 83.21
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 81.2
KOG0825 1134 consensus PHD Zn-finger protein [General function 80.12
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.6e-38  Score=309.06  Aligned_cols=279  Identities=24%  Similarity=0.399  Sum_probs=201.2

Q ss_pred             CccchhhhhhHhhcccCcHHHHHHHHHHHHHHHHHHhhhcccccCcchhhhhHHHHHHHHHHHHHHHHHHHHHHhhhhhc
Q 010130            1 MVLVSDFPLQTIFFGELYPAETRKFVERLINYVIYKGTFLPLVIPPTVFQAGLWSVWLTVLCSLKMFQALARDRLERLNA   80 (517)
Q Consensus         1 ~~~~~~~~lq~lfFG~Lr~~E~e~l~er~~~~~~~k~~fl~~vi~~~~~~~~~w~~wf~~L~~lK~fh~l~~dR~e~l~~   80 (517)
                      ||.+++.++++++||+||..|.|+++|++| |++ +++.++..++++.... .+...+..|+|+|+||||+++|.|...-
T Consensus        53 ~~~l~~~~l~~llFGsLr~~E~e~~~E~l~-~tl-t~~ll~iS~F~e~i~f-s~~~l~~~Ll~~kvfhwil~~R~er~~~  129 (491)
T COG5243          53 LFFLIANALKTLLFGSLRTFELELLYEQLW-ITL-TEILLAISVFREAISF-SFFMLLSTLLFAKVFHWILSFRTERLQI  129 (491)
T ss_pred             HHHHHHHHHHHHhhhhhHHHHHHHHHHhhH-HHH-HHHHHHHHHHHhhHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            466788999999999999999999999998 444 3555555556653221 2356788889999999999999997642


Q ss_pred             CCCCCcchH--HHHHHHHHHHHHHHHHHHHHHHHHHhhCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCC
Q 010130           81 SPSATPWTY--FRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGN  158 (517)
Q Consensus        81 sp~~~~~~h--~R~~~lL~~ll~~d~~~i~~~~~~~~~~g~s~~ll~~fE~~~l~~~~l~~~l~~~~~l~d~~~~~~~~~  158 (517)
                       .++..++|  -|+.+++.++.++|..+|..|+..-...+.++..++.+|+..+. ..+++                ..+
T Consensus       130 -~st~~~~~ifSrfS~~~~lL~ild~~li~~CiSs~~liD~~~lfL~~c~F~~~l-l~l~s----------------~~n  191 (491)
T COG5243         130 -QSTDQRFHIFSRFSCAYFLLSILDASLIYLCISSEHLIDKSTLFLFVCEFSVLL-LNLTS----------------EAN  191 (491)
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHhhhHhhhhhhHHHHHHHHHHHHH-HHHHH----------------hhc
Confidence             23444444  69999999999999999999996433333333223334432211 11111                111


Q ss_pred             CcccccchhhhhhhccchhhhhhHHHHHHHHHHHHHHHHHHHhhHHHHHHhcchhhHHHHHHHHHHHHHHHHHHHHHHHH
Q 010130          159 STNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKG  238 (517)
Q Consensus       159 ~~~~~~~~~~~~~~~g~~we~kg~~i~~~~f~~dl~~~~~~l~~~~~~~~~~g~~~~l~~~vl~~~l~~~~~~~~~~~~~  238 (517)
                       ..+...  ++.+.   .-+.|..+.++.++..|=++++.+-..+...+..+.+|+.+++.++ -.    +..+.++++.
T Consensus       192 -~~cV~n--~~~~d---dDd~rs~~~f~~~v~y~g~tllays~l~~~~~~~~r~Pi~l~r~~~-t~----~~AL~~~i~~  260 (491)
T COG5243         192 -KLCVYN--YEARD---DDDERSTYLFRLEVCYDGLTLLAYSLLFMYQFPYVRVPIYLIRQMY-TC----FYALFRRIRE  260 (491)
T ss_pred             -ccceee--ccccc---ccccceeeeeeeehHHHHHHHHHHHHHHHhhccchhchHHHHHHHH-HH----HHHHHHHHHH
Confidence             111100  00000   0134555556677777878888777777777777888988887643 23    3456788999


Q ss_pred             HHHHHHHHHHHHhhCCCCChhhhhcCCCCCccccccc-c------------ccccccccCccchhhHHHHHHhCCCCCCC
Q 010130          239 FIKLRIALGHLHAALPDATSEELRAYDDECAICREPM-A------------KAKKLLCNHLFHLACLRSWLDQGLNEMYS  305 (517)
Q Consensus       239 ~~~~r~~~~~~~~~l~~~~~~~l~~~~~~C~IC~~~~-~------------~~~~l~C~H~Fh~~Cl~~wl~~~~~~~~~  305 (517)
                      +.+++++.|++++.+|.++.|++.+.|..|.||+|++ .            .|++|||||.+|.+|++.|+++    +++
T Consensus       261 ~~~~~r~~kdl~~~~~t~t~eql~n~D~~C~ICmde~~h~~~~~~~~~~~~~pKrLpCGHilHl~CLknW~ER----qQT  336 (491)
T COG5243         261 HARFRRATKDLNAMYPTATEEQLTNSDRTCTICMDEMFHPDHEPLPRGLDMTPKRLPCGHILHLHCLKNWLER----QQT  336 (491)
T ss_pred             HHHHHHHhhHHHhhcchhhhhhhcCCCCeEEEecccccCCCCccCcccccCCcccccccceeeHHHHHHHHHh----ccC
Confidence            9999999999999999999999999999999999994 3            3589999999999999999999    799


Q ss_pred             CCccccCCcC
Q 010130          306 CPTCRKPLFV  315 (517)
Q Consensus       306 CP~CR~~~~~  315 (517)
                      ||+||.++.-
T Consensus       337 CPICr~p~if  346 (491)
T COG5243         337 CPICRRPVIF  346 (491)
T ss_pred             CCcccCcccc
Confidence            9999999643

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13705 TRC8_N: TRC8 N-terminal domain Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 1e-06
4g3o_A58 Crystal Structure Of The Cue Domain Of The E3 Ubiqu 9e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 7/50 (14%)
Query: 267 ECAICREPMA---KAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPL 313
           EC +C+E  A     ++L CNHLFH +C+  WL+Q      SCP CRK L
Sbjct: 17  ECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQ----HDSCPVCRKSL 62
>pdb|4G3O|A Chain A, Crystal Structure Of The Cue Domain Of The E3 Ubiquitin Ligase Amfr (Gp78) Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
2ejs_A58 Autocrine motility factor receptor, isoform 2; CUE 5e-15
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-14
2ekf_A61 Ancient ubiquitous protein 1; CUE, ubiquitin ligas 8e-14
4g3o_A58 E3 ubiquitin-protein ligase AMFR; all-helical stru 1e-13
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-13
2ect_A78 Ring finger protein 126; metal binding protein, st 5e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-12
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-12
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-11
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-11
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 6e-11
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-10
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-10
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 4e-10
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 5e-10
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-09
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-09
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 8e-09
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-08
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-08
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 5e-08
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 7e-08
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 9e-08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-07
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-07
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 3e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 4e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 4e-07
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 6e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 8e-07
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 4e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 7e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 6e-06
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 6e-06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 6e-06
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 7e-06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 1e-05
3nw0_A238 Non-structural maintenance of chromosomes element 2e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-05
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 5e-05
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 9e-05
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 2e-04
2ysj_A63 Tripartite motif-containing protein 31; ring-type 2e-04
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 2e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 2e-04
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 3e-04
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 4e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 4e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 4e-04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 5e-04
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 5e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 5e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 8e-04
>2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
 Score = 68.7 bits (168), Expect = 5e-15
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 467 TSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQ 516
           +S S+  + + + AMA  ++E+ P +P  L+ QDLQ T S  IT +N+L+
Sbjct: 2   SSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILE 51
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>4g3o_A E3 ubiquitin-protein ligase AMFR; all-helical structure, BAG6; 1.60A {Homo sapiens} Length = 58 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
2ejs_A58 Autocrine motility factor receptor, isoform 2; CUE 99.52
2ekf_A61 Ancient ubiquitous protein 1; CUE, ubiquitin ligas 99.51
4g3o_A58 E3 ubiquitin-protein ligase AMFR; all-helical stru 99.41
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.26
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.25
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.24
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.23
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.23
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.23
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.23
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.23
2ect_A78 Ring finger protein 126; metal binding protein, st 99.22
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.22
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.21
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.21
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.2
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.19
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.17
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.17
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.16
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.15
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.14
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.14
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.11
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.05
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.03
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.03
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.01
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.0
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.0
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.98
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.96
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.96
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.95
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.94
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.93
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.93
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.92
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.91
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.91
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.91
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.91
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.9
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.89
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.88
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.84
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.84
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.84
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.83
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.82
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.81
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.74
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.72
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.68
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.66
2ea5_A68 Cell growth regulator with ring finger domain prot 98.63
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.6
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.57
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.47
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.41
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.34
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.34
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.31
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.24
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.16
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.8
3nw0_A238 Non-structural maintenance of chromosomes element 97.5
2dhy_A67 CUE domain-containing protein 1; structural genomi 97.28
2di0_A71 Activating signal cointegrator 1 complex subunit 2 96.26
2qho_B53 E3 ubiquitin-protein ligase EDD1; protein-protein 95.07
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 95.0
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 94.73
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.23
1wil_A89 KIAA1045 protein; ring finger domain, structural g 92.76
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.3
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.87
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 90.77
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.17
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.41
2k16_A75 Transcription initiation factor TFIID subunit 3; p 86.52
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.12
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 84.79
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 84.69
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 82.96
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 82.92
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 81.93
1weu_A91 Inhibitor of growth family, member 4; structural g 81.59
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 80.59
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 80.5
>2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.52  E-value=6.8e-15  Score=109.17  Aligned_cols=48  Identities=38%  Similarity=0.600  Sum_probs=44.2

Q ss_pred             CCcchhhHHHHHHHHHHHhhCCCCChHHHHHHhhccCchhHHHHhhhc
Q 010130          469 RSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQ  516 (517)
Q Consensus       469 ~~~~~~~~~l~~~~~~v~~~~~~~~~~~i~~~~~~~~~~~~t~~~~~~  516 (517)
                      +.++.+.+|+++||++|+++|||+|.++|.+||++||||++|++|||+
T Consensus         4 ~~~~~~~~q~~~mv~~V~~mfP~vp~~~I~~DL~~TgsVe~TienILe   51 (58)
T 2ejs_A            4 GSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILE   51 (58)
T ss_dssp             CCSSCCCCHHHHHHHHHHHHCCSSCHHHHHHHHHHHCSHHHHHHHHHH
T ss_pred             CcCCcchHHHHHHHHHHHHHcCCCCHHHHHHHHHHhCCHHHHHHHHHh
Confidence            345556799999999999999999999999999999999999999996
>2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4g3o_A E3 ubiquitin-protein ligase AMFR; all-helical structure, BAG6; 1.60A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 517
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-12
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-12
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-12
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 8e-10
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-09
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-09
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-09
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 4e-09
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-08
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-08
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 3e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 4e-07
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 3e-06
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 6e-06
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-05
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 4e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 2e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 5e-04
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 61.2 bits (148), Expect = 1e-12
 Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 9/64 (14%)

Query: 256 ATSEELRAY------DDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTC 309
            T E+   Y         C IC E     K   C HL   +CL SW +        CP C
Sbjct: 8   VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQ---GCPFC 64

Query: 310 RKPL 313
           R  +
Sbjct: 65  RCEI 68
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.33
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.32
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.22
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.21
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.2
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.18
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.12
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.12
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.11
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.07
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.04
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.01
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.89
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.88
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.63
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.95
d2di0a163 Activating signal cointegrator 1 complex subunit 2 95.61
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 94.58
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 94.46
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 91.65
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.2
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.22
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 88.22
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 84.77
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 83.41
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

Probab=99.33  E-value=3.9e-13  Score=103.25  Aligned_cols=48  Identities=31%  Similarity=0.776  Sum_probs=41.8

Q ss_pred             CCCCCccccccccccc-cccccCccchhhHHHHHHhCCCCCCCCCccccCCcC
Q 010130          264 YDDECAICREPMAKAK-KLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFV  315 (517)
Q Consensus       264 ~~~~C~IC~~~~~~~~-~l~C~H~Fh~~Cl~~wl~~~~~~~~~CP~CR~~~~~  315 (517)
                      ..+.|+||++.+.++. .+||||.||..|+.+|+++    +.+||+||+++..
T Consensus         4 ~~d~C~IC~~~~~~~~~~~~C~H~Fc~~Ci~~w~~~----~~~CP~CR~~i~~   52 (68)
T d1chca_           4 VAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQ----NPTCPLCKVPVES   52 (68)
T ss_dssp             CCCCCSSCCSCCCSCEEETTTTEEESTTHHHHHHHH----SCSTTTTCCCCCC
T ss_pred             CCCCCccCCcCccCCcEEeCCCCcCcHHHHHHHHHh----CCcCCCCCcchHh
Confidence            3567999999998764 4799999999999999998    6899999998743
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure