Citrus Sinensis ID: 010311

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MHSEENKVSLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVDEAFVGGRQDRSSGVIQDRGSGLRQDSCGSTKQGDYRSIDPREVQSRMLYCHDFPATDLAYDRNQYAAHASERDDTSSESSSFLQDRLYSESDKPYANETSRFVRQNGDVTPVRCNIGRSKEYKPSGYLKVKGESENAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFESPSGDPVNEPFYVGNSRWSNSPEVPEIDKPRALGTRYEVDSSKMDLQDSYIDENLNSKRSDYAGTKSHNQLKQKSPLLHYSNFSPHQNSSLNAYEDSTPVYDGNHCYSLSSKHDAEWMGLNSVMNHHEPHGGKTNSEEAKPLLNDNHVVSSKMVRNSNYFTRPSNFTLGISKSLDAKDKGTSTKMAKVKKLYKEKKAIKGLRDPVSVKTHLNNEMNVVKRLKGELPQRDYIAKASYAEIPRWTNPIKGSAAEMPSSFSEDETAETNSSME
ccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEccccccccccccccccccccccccHHHHHHHccccccccHHHcccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEccccccccccccccccccccccccccccEcccccccccccccccccEcccccccccccccccccccccHcccccccHHHHHHHccccccHcccccccccEEcccccHHHHEEcccccccHHHcccccccccccccccccccccccccccccccccccccccc
MHSEENKVSLEKNIKRRYKTPAQVMALEKFynehkypteeMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVdeafvggrqdrssgviqdrgsglrqdscgstkqgdyrsidprevqsrmlychdfpatdlaydrnqyaahaserddtssessSFLQDRlysesdkpyanetsrfvrqngdvtpvrcnigrskeykpsgylkvkgesENAAISAVKRQLgrhyredgpplgvdfdplppgafespsgdpvnepfyvgnsrwsnspevpeidkpralgtryevdsskmdlqdsyidenlnskrsdyagtkshnqlkqkspllhysnfsphqnsslnayedstpvydgnhcyslsskhdaewmglnsvmnhhephggktnseeakpllndnhvvsskmvrnsnyftrpsnftlgisksldakdkgtstKMAKVKKLYKEKKaikglrdpvsvkTHLNNEMNVVKRLKgelpqrdyiakasyaeiprwtnpikgsaaempssfsedetaetnssme
mhseenkvsleknikrryktpaqVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEkrlsvdeafvggrqdrssgviqdrgsglrqdscgstkqgdyrsiDPREVQSRMLYCHDFPATDLAYDRNQYAAhaserddtssessSFLQDRLysesdkpyanetsrfvrqngdvtpvrcnigrskeykpsgylkvkgesenAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFESPSGDPVNEPFYVgnsrwsnspevpeidkpralGTRYEVDSSKMDLQDSYIDENLNSKRSDYAGTKSHNQLKQKSPLLHYSNFSPHQNSSLNAYEDSTPVYDGNHCYSLSSKHDAEWMGLNSVMNHHEPHGGKTNSEEAKPLLNDNHVVSSKMVrnsnyftrpsnftlgisksldakdkgtstkmakvkklykekkaikglrdpvsvkthlnnemnvvkrlkgelpqrdYIAKasyaeiprwtnPIKGSaaempssfsedetaetnssme
MHSEENKVSLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVDEAFVGGRQDRSSGVIQDRGSGLRQDSCGSTKQGDYRSIDPREVQSRMLYCHDFPATDLAYDRNQYAAHAserddtssesssFLQDRLYSESDKPYANETSRFVRQNGDVTPVRCNIGRSKEYKPSGYLKVKGESENAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFESPSGDPVNEPFYVGNSRWSNSPEVPEIDKPRALGTRYEVDSSKMDLQDSYIDENLNSKRSDYAGTKSHNQLKQKSPLLHYSNFSPHQNSSLNAYEDSTPVYDGNHCYSLSSKHDAEWMGLNSVMNHHEPHGGKTNSEEAKPLLNDNHVVSSKMVRNSNYFTRPSNFTLGISKSLDAKDKGTSTkmakvkklykekkaikGLRDPVSVKTHLNNEMNVVKRLKGELPQRDYIAKASYAEIPRWTNPIKGSAAEMPSSFSEDETAETNSSME
***********************VMALEKFYN**************EQIGLTEKQVSGWFCHRRLKEKRLSVDEAF******************************************RMLYCHDFPATDLAYDR*************************************************VRCNI*********************************************************************************************************************************************************VYDGNHCYSL*******W*****************************************************************************************VKTHLNNEMNVVKRLKGELPQRDYIAKASYAEIPRWT***************************
*********************AQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRR***********************************************************************************************************************************************************************VDFDPLPPGAFE******************************************************************************************************************************************************************************************************************************************************************************
*********LEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVDEAFVGGRQD*************************YRSIDPREVQSRMLYCHDFPATDLAYDRNQY********************RLYSESDKPYANETSRFVRQNGDVTPVRCNIGRSKEYKPSGYLKVKGESENAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFESPSGDPVNEPFYVGNSRWSNSPEVPEIDKPRALGTRYEVDSSKMDLQDSYIDENLNSKRSDYAGTKSHNQLKQKSPLLHYSNFSPHQNSSLNAYEDSTPVYDGNHCYSLSSKHDAEWMGLNSVMNHH********SEEAKPLLNDNHVVSSKMVRNSNYFTRPSNFTLGISKSLDAKDKGTSTKMAKVKKLYKEKKAIKGLRDPVSVKTHLNNEMNVVKRLKGELPQRDYIAKASYAEIPRWTNPIKGS*********************
***************RRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSV***********************************YRSIDPREVQSRMLYCHDFPATDLAYDR****************************SDKPYANETSRFVRQNGDVTPVRCNIGRSKEYKPSGYLKVKGESENAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFESPSGDPVNEPFYVGNSRWSNSP*VP**DKPRALGTRYEVDSSKMDLQ*******************************HYS*F**HQNSSLNAYEDSTPVYDGNHCYSLSSKHDAEWMGLNSVMNHHEPHGGKTNSEEAKPLLNDNHVVSSKMVRNSNYFTRP***********************K****YKE*KAIKGLRDPVSVKTHLNNEMNVVKRLKGELPQRDYIAKASY**********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHSEENKVSLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVDEAFVGGRQDRSSGVIQDRGSGLRQDSCGSTKQGDYRSIDPREVQSRMLYCHDFPATDLAYDRNQYAAHASERDDTSSESSSFLQDRLYSESDKPYANETSRFVRQNGDVTPVRCNIGRSKEYKPSGYLKVKGESENAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFESPSGDPVNEPFYVGNSRWSNSPEVPEIDKPRALGTRYEVDSSKMDLQDSYIDENLNSKRSDYAGTKSHNQLKQKSPLLHYSNFSPHQNSSLNAYEDSTPVYDGNHCYSLSSKHDAEWMGLNSVMNHHEPHGGKTNSEEAKPLLNDNHVVSSKMVRNSNYFTRPSNFTLGISKSLDAKDKGTSTKMAKVKKLYKEKKAIKGLRDPVSVKTHLNNEMNVVKRLKGELPQRDYIAKASYAEIPRWTNPIKGSAAEMPSSFSEDETAETNSSME
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query513 2.2.26 [Sep-21-2011]
P31503632 POU domain, class 2, tran yes no 0.107 0.087 0.375 1e-05
P25425770 POU domain, class 2, tran yes no 0.107 0.071 0.375 1e-05
P14859743 POU domain, class 2, tran yes no 0.107 0.074 0.359 2e-05
Q28BL7757 POU domain, class 2, tran yes no 0.107 0.072 0.359 2e-05
Q29076745 POU domain, class 2, tran yes no 0.107 0.073 0.359 2e-05
P15143739 POU domain, class 2, tran yes no 0.107 0.074 0.359 3e-05
P16143758 POU domain, class 2, tran N/A no 0.107 0.072 0.359 3e-05
Q54PU1638 Homeobox protein 10 OS=Di yes no 0.107 0.086 0.327 3e-05
P34684253 Homeobox protein lin-39 O yes no 0.142 0.288 0.391 5e-05
P31362431 POU domain, class 2, tran no no 0.116 0.139 0.347 0.0001
>sp|P31503|PO2F1_RAT POU domain, class 2, transcription factor 1 (Fragment) OS=Rattus norvegicus GN=Pou2f1 PE=2 SV=2 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 9/64 (14%)

Query: 7   KVSLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLK 66
           + S+E NI+         +ALEK + E++ PT E  + +AEQ+ + ++ +  WFC+RR K
Sbjct: 272 RTSIETNIR---------VALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQK 322

Query: 67  EKRL 70
           EKR+
Sbjct: 323 EKRI 326
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR.
Rattus norvegicus (taxid: 10116)
>sp|P25425|PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus GN=Pou2f1 PE=2 SV=3 Back     alignment and function description
>sp|P14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 OS=Homo sapiens GN=POU2F1 PE=1 SV=2 Back     alignment and function description
>sp|Q28BL7|PO2F1_XENTR POU domain, class 2, transcription factor 1 OS=Xenopus tropicalis GN=pou2f1 PE=2 SV=1 Back     alignment and function description
>sp|Q29076|PO2F1_PIG POU domain, class 2, transcription factor 1 OS=Sus scrofa GN=POU2F1 PE=2 SV=1 Back     alignment and function description
>sp|P15143|PO2F1_CHICK POU domain, class 2, transcription factor 1 OS=Gallus gallus GN=POU2F1 PE=2 SV=1 Back     alignment and function description
>sp|P16143|PO2F1_XENLA POU domain, class 2, transcription factor 1 OS=Xenopus laevis GN=pou2f1 PE=1 SV=3 Back     alignment and function description
>sp|Q54PU1|HBX10_DICDI Homeobox protein 10 OS=Dictyostelium discoideum GN=hbx10 PE=3 SV=1 Back     alignment and function description
>sp|P34684|LIN39_CAEEL Homeobox protein lin-39 OS=Caenorhabditis elegans GN=lin-39 PE=2 SV=1 Back     alignment and function description
>sp|P31362|PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus musculus GN=Pou2f3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
359479221528 PREDICTED: uncharacterized protein LOC10 0.990 0.962 0.543 1e-143
296083843509 unnamed protein product [Vitis vinifera] 0.953 0.960 0.535 1e-137
255572213 643 hypothetical protein RCOM_0834050 [Ricin 0.953 0.760 0.514 1e-126
224105959471 predicted protein [Populus trichocarpa] 0.892 0.972 0.533 1e-121
356554131527 PREDICTED: uncharacterized protein LOC10 0.984 0.958 0.465 1e-115
449444877506 PREDICTED: uncharacterized protein LOC10 0.949 0.962 0.484 1e-115
356501401526 PREDICTED: uncharacterized protein LOC10 0.982 0.958 0.465 1e-114
224055313537 predicted protein [Populus trichocarpa] 0.904 0.864 0.482 1e-103
357493979544 hypothetical protein MTR_5g089870 [Medic 0.964 0.909 0.446 3e-97
356569985381 PREDICTED: uncharacterized protein LOC10 0.664 0.895 0.533 1e-90
>gi|359479221|ref|XP_002279963.2| PREDICTED: uncharacterized protein LOC100265339 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  514 bits (1325), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 281/517 (54%), Positives = 355/517 (68%), Gaps = 9/517 (1%)

Query: 6   NKVSLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRL 65
           NK+  EKN KRR KTP+QV ALEKFYNEHKYPTE MKS++AE+IGLTEKQ+SGWFCHRRL
Sbjct: 12  NKICEEKNKKRRLKTPSQVQALEKFYNEHKYPTESMKSELAEEIGLTEKQISGWFCHRRL 71

Query: 66  KEKRLSVDEAFVGGRQDRSSGVIQDRGSGLRQDSCGSTKQGDYRSIDPREVQSRMLYCHD 125
           K+K+L  DEA   GRQDRSSGVIQDRGSG RQDSCGSTK GDYR IDPREV+SR  Y  +
Sbjct: 72  KDKKLLEDEAGANGRQDRSSGVIQDRGSGYRQDSCGSTKHGDYRHIDPREVESRRFYGQE 131

Query: 126 FPATDLAYD-RNQYAAHASERDDTSSESSSFLQDRLYSESDKPYANETSRFVRQNGDVTP 184
           F A DL Y+ R+ Y  + S R DTSSESSS LQDR + +++ P+  ETS+   ++G V P
Sbjct: 132 FSAGDLNYEHRSHYTGNFSGRGDTSSESSSDLQDRFFPQNEDPFDVETSKLPTRSGIVMP 191

Query: 185 VRCNIGRSKEY-KPSGYLKVKGESENAAISAVKRQLGRHYREDGPPLGVDFDPLPPGAFE 243
           +     +++ + +PSGYLKVKGE EN AI+AVKRQLGRHYREDGPPLGV+F PLPPGAFE
Sbjct: 192 INTKGTQNRGFVRPSGYLKVKGEIENVAITAVKRQLGRHYREDGPPLGVEFQPLPPGAFE 251

Query: 244 SPSGDPVNEPFYVGNSRWSNSPEVPEIDKPRALGTRYEVDSSKMDLQDSYIDE-NLNSKR 302
           S   D  +EP+YVGNS  S SP+ P + KP +L TRYEV SSK+  Q+S ++E N  +  
Sbjct: 252 SSIRDQDDEPYYVGNSIMSQSPDNPGVPKPPSLSTRYEVCSSKLASQNSCMEEANFGTMH 311

Query: 303 S-DYAGTKSHNQLKQKSPLLHYSNFSPHQNSSLNAYEDS---TPVYDGNHCYSLSSKHDA 358
             D     S+ QLKQK    +YSN SP  N S + +ED+   T   + N  Y + S    
Sbjct: 312 GFDSRDNYSNRQLKQKGSFPNYSNLSPGWNFSKDMHEDAAGETSFVNSNKNYEMRSNPGI 371

Query: 359 EWMGLNSVMNHH-EPHGGKTNSEEAKPLLNDNHVVSSKMVRNSNYF-TRPSNFTLGISKS 416
           E M L+SV N    P+GGK  SE+    L++   +  K+V+   Y  ++PSN  L  S S
Sbjct: 372 EGMRLSSVSNRRLHPYGGKVTSEQTDSWLHEYDDIRPKIVQQKEYLKSKPSNLILQQSGS 431

Query: 417 LDAKDKGTSTKMAKVKKLYKEKKAIKGLRDPVSVKTHLNNEMNVVKRLKGELPQRDYIAK 476
            D + +G    MAK++++ +E++A++   DPV  K    NEM V KR++ E P  DY  K
Sbjct: 432 CDDEGRGQLRNMAKMEEVCRERRAMREYSDPVGEKVQPTNEMRVAKRVRDESPPLDYAKK 491

Query: 477 ASYAEIPRWTNPIKGSAAEMPSSFSEDETAETNSSME 513
           +S++E P W N IKGSA EMPSSFSEDETAET+SSM+
Sbjct: 492 SSFSETPTWGNQIKGSAMEMPSSFSEDETAETSSSMD 528

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296083843|emb|CBI24231.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255572213|ref|XP_002527046.1| hypothetical protein RCOM_0834050 [Ricinus communis] gi|223533608|gb|EEF35346.1| hypothetical protein RCOM_0834050 [Ricinus communis] Back     alignment and taxonomy information
>gi|224105959|ref|XP_002313994.1| predicted protein [Populus trichocarpa] gi|222850402|gb|EEE87949.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356554131|ref|XP_003545402.1| PREDICTED: uncharacterized protein LOC100803515 [Glycine max] Back     alignment and taxonomy information
>gi|449444877|ref|XP_004140200.1| PREDICTED: uncharacterized protein LOC101207235 [Cucumis sativus] gi|449480977|ref|XP_004156045.1| PREDICTED: uncharacterized LOC101207235 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356501401|ref|XP_003519513.1| PREDICTED: uncharacterized protein LOC100805913 [Glycine max] Back     alignment and taxonomy information
>gi|224055313|ref|XP_002298475.1| predicted protein [Populus trichocarpa] gi|222845733|gb|EEE83280.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357493979|ref|XP_003617278.1| hypothetical protein MTR_5g089870 [Medicago truncatula] gi|355518613|gb|AET00237.1| hypothetical protein MTR_5g089870 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356569985|ref|XP_003553173.1| PREDICTED: uncharacterized protein LOC100812697 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
TAIR|locus:2032505 1705 HB-1 "homeobox-1" [Arabidopsis 0.107 0.032 0.490 3.8e-16
TAIR|locus:2167628 1694 RLT2 "RINGLET 2" [Arabidopsis 0.115 0.034 0.406 2e-12
UNIPROTKB|F1MZR4151 LOC516179 "Uncharacterized pro 0.226 0.768 0.310 5.1e-07
UNIPROTKB|F1NYF2133 NKX6-2 "Uncharacterized protei 0.216 0.834 0.3 7.8e-06
UNIPROTKB|F1P4U9148 HOXD8 "Homeobox protein Hox-D8 0.155 0.540 0.312 1.6e-05
UNIPROTKB|Q0281460 CHOX-CAD2 "Homeobox protein CH 0.109 0.933 0.389 1.6e-05
UNIPROTKB|F1MCF6118 CDX1 "Uncharacterized protein" 0.111 0.483 0.4 2.1e-05
RGD|621233123 Cdx1 "caudal type homeo box 1" 0.111 0.463 0.4 2.1e-05
UNIPROTKB|Q05095123 Cdx1 "Homeobox protein CDX-1" 0.111 0.463 0.4 2.1e-05
ZFIN|ZDB-GENE-010108-2170 vent "ventral expressed homeob 0.134 0.405 0.357 2.3e-05
TAIR|locus:2032505 HB-1 "homeobox-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 3.8e-16, Sum P(3) = 3.8e-16
 Identities = 27/55 (49%), Positives = 44/55 (80%)

Query:    15 KRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKR 69
             KR+ KTP Q+  LEK Y+E KYP+E  +++++E++ L+++Q+  WFCHRRLK+K+
Sbjct:    42 KRQMKTPFQLETLEKVYSEEKYPSEATRAELSEKLDLSDRQLQMWFCHRRLKDKK 96
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009630 "gravitropism" evidence=RCA
GO:0005515 "protein binding" evidence=IPI
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IGI
TAIR|locus:2167628 RLT2 "RINGLET 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZR4 LOC516179 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYF2 NKX6-2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4U9 HOXD8 "Homeobox protein Hox-D8" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q02814 CHOX-CAD2 "Homeobox protein CHOX-CAD2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCF6 CDX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|621233 Cdx1 "caudal type homeo box 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q05095 Cdx1 "Homeobox protein CDX-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010108-2 vent "ventral expressed homeobox" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00090939
hypothetical protein (471 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-16
pfam0004657 pfam00046, Homeobox, Homeobox domain 9e-16
smart0038957 smart00389, HOX, Homeodomain 2e-14
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 5e-06
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-05
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information 
 Score = 71.9 bits (177), Expect = 5e-16
 Identities = 25/55 (45%), Positives = 38/55 (69%)

Query: 15 KRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKR 69
          KR   TP Q+  LEK + ++ YP+ E + ++A+++GLTE+QV  WF +RR K KR
Sbjct: 3  KRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKR 57

Length = 59
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 513
KOG0489261 consensus Transcription factor zerknullt and relat 99.61
KOG0488309 consensus Transcription factor BarH and related HO 99.61
KOG0843197 consensus Transcription factor EMX1 and related HO 99.53
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.52
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.52
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.51
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.5
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.5
KOG0850245 consensus Transcription factor DLX and related pro 99.46
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.45
KOG0494332 consensus Transcription factor CHX10 and related H 99.43
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.41
KOG0848317 consensus Transcription factor Caudal, contains HO 99.38
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.38
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.37
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.37
KOG0493342 consensus Transcription factor Engrailed, contains 99.32
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.29
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.27
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.25
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.23
COG5576156 Homeodomain-containing transcription factor [Trans 99.22
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.2
KOG0847288 consensus Transcription factor, contains HOX domai 99.13
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.11
KOG0490235 consensus Transcription factor, contains HOX domai 98.98
KOG0849354 consensus Transcription factor PRD and related pro 98.75
KOG0775304 consensus Transcription factor SIX and related HOX 98.73
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.68
KOG0774334 consensus Transcription factor PBX and related HOX 98.12
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.98
KOG0490235 consensus Transcription factor, contains HOX domai 97.78
KOG2252558 consensus CCAAT displacement protein and related h 97.66
KOG11461406 consensus Homeobox protein [General function predi 97.08
KOG0773342 consensus Transcription factor MEIS1 and related H 95.44
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.33
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 90.1
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 86.86
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information 
Probab=99.61  E-value=2.8e-16  Score=156.14  Aligned_cols=66  Identities=30%  Similarity=0.429  Sum_probs=61.8

Q ss_pred             CcCCCCCCccCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCChhhhhhhhhchhhhHhhhhhhh
Q 010311            9 SLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVDE   74 (513)
Q Consensus         9 srkkRRkRT~FT~~QLevLEk~Fekn~YPS~~eReeLA~eLGLSerQVqVWFQNRRaK~KR~kk~e   74 (513)
                      ..+.||.||.||..||.+||+.|..|+|.+...|.|||..|.|+|+||+|||||||+||||..+..
T Consensus       156 ~~~~kR~RtayT~~QllELEkEFhfN~YLtR~RRiEiA~~L~LtErQIKIWFQNRRMK~Kk~~k~~  221 (261)
T KOG0489|consen  156 GGKSKRRRTAFTRYQLLELEKEFHFNKYLTRSRRIEIAHALNLTERQIKIWFQNRRMKWKKENKAK  221 (261)
T ss_pred             cCCCCCCCcccchhhhhhhhhhhccccccchHHHHHHHhhcchhHHHHHHHHHHHHHHHHHhhccc
Confidence            356789999999999999999999999999999999999999999999999999999999987444

>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
1pog_A67 Solution Structure Of The Oct-1 Pou-Homeo Domain De 2e-05
1o4x_A167 Ternary Complex Of The Dna Binding Domains Of The O 2e-05
1oct_C156 Crystal Structure Of The Oct-1 Pou Domain Bound To 3e-05
1cqt_A163 Crystal Structure Of A Ternary Complex Containing A 4e-05
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 1e-04
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 1e-04
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 4e-04
1e3o_C160 Crystal Structure Of Oct-1 Pou Dimer Bound To More 5e-04
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 6e-04
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 7e-04
1hdp_A63 Solution Structure Of A Pou-Specific Homeodomain: 3 8e-04
1hf0_A159 Crystal Structure Of The Dna-Binding Domain Of Oct- 8e-04
>pdb|1POG|A Chain A, Solution Structure Of The Oct-1 Pou-Homeo Domain Determined By Nmr And Restrained Molecular Dynamics Length = 67 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 9/72 (12%)
Query: 1  MHSEENKVSLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWF 60
          M   + + S+E NI+         +ALEK + E++ PT E  + +A+Q+ + ++ +  WF
Sbjct: 5  MRRRKKRTSIETNIR---------VALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWF 55
Query: 61 CHRRLKEKRLSV 72
          C+RR KEKR+ +
Sbjct: 56 CNRRQKEKRIDI 67
>pdb|1O4X|A Chain A, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 167 Back     alignment and structure
>pdb|1OCT|C Chain C, Crystal Structure Of The Oct-1 Pou Domain Bound To An Octamer Site: Dna Recognition With Tethered Dna-Binding Modules Length = 156 Back     alignment and structure
>pdb|1CQT|A Chain A, Crystal Structure Of A Ternary Complex Containing An Oca-B Peptide, The Oct-1 Pou Domain, And An Octamer Element Length = 163 Back     alignment and structure
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|1E3O|C Chain C, Crystal Structure Of Oct-1 Pou Dimer Bound To More Length = 160 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|1HDP|A Chain A, Solution Structure Of A Pou-Specific Homeodomain: 3d-Nmr Studies Of Human B-Cell Transcription Factor Oct-2 Length = 63 Back     alignment and structure
>pdb|1HF0|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Oct-1 Bound To Dna As A Dimer Length = 159 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-15
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 9e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-13
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 5e-13
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 6e-13
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 9e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-12
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-12
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 8e-12
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-10
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-10
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-09
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-09
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-09
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-09
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 4e-09
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 5e-09
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 6e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-08
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-08
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 4e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 5e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 6e-08
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 6e-08
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 7e-08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-07
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-07
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-07
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-07
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 2e-07
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-07
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-07
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-07
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 3e-07
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 4e-07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-07
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 4e-07
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 5e-07
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 6e-07
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 1e-06
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-06
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 1e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-06
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-06
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 2e-06
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 3e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-06
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 4e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 5e-06
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 5e-06
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 7e-06
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-05
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 2e-05
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 4e-05
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-04
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2e19_A64 Transcription factor 8; homeobox domain, structura 7e-04
1lfb_A99 Liver transcription factor (LFB1); transcription r 8e-04
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
 Score = 69.6 bits (170), Expect = 4e-15
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 15 KRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRR----LKEKRL 70
          K + KT  Q+  L+  +      T+E  +++  Q  LT +++  WF  ++    LKE+++
Sbjct: 14 KFKEKTAEQLRVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKM 73

Query: 71 SVDEAFVGGRQDRSSG 86
           +DE+  G     SSG
Sbjct: 74 EIDESNAGSSSGPSSG 89
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.71
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.7
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.7
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.7
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.7
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.7
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.7
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.69
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.69
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.69
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.69
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.69
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.69
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.69
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.68
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.68
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.68
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.68
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.68
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.67
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.67
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.67
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.66
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.66
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.66
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.66
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.66
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.66
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.66
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.65
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.65
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.65
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.65
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.64
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.64
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.64
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.64
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.64
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.63
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.63
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.63
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.63
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.63
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.62
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.62
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.62
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.62
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.61
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.61
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.6
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.6
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.6
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.59
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.59
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.57
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.57
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.57
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.56
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.56
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.56
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.56
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.55
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.55
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.51
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.51
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.51
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.51
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.5
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.49
2e19_A64 Transcription factor 8; homeobox domain, structura 99.49
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.48
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.42
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.26
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.22
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.15
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.15
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.13
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.09
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 91.89
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.71  E-value=2.4e-17  Score=134.85  Aligned_cols=68  Identities=28%  Similarity=0.374  Sum_probs=63.0

Q ss_pred             CcCCCCCCccCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCChhhhhhhhhchhhhHhhhhhhhhh
Q 010311            9 SLEKNIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLSVDEAF   76 (513)
Q Consensus         9 srkkRRkRT~FT~~QLevLEk~Fekn~YPS~~eReeLA~eLGLSerQVqVWFQNRRaK~KR~kk~e~~   76 (513)
                      ....++.|+.||..|+.+||..|..++||+..++.+||..|||+++||++||||||+|+|+..+....
T Consensus         4 ~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~~~~   71 (80)
T 2cue_A            4 GSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQ   71 (80)
T ss_dssp             CCSSCCCCCCSCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCccCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhhhhc
Confidence            46778899999999999999999999999999999999999999999999999999999998755543
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 513
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-14
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-13
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-13
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 5e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-13
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-12
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-12
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 4e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-12
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 5e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-11
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-11
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 4e-11
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 6e-11
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 6e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-10
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-10
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 6e-10
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 8e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 9e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 4e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 9e-07
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: mat alpha2 Homeodomain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 65.2 bits (159), Expect = 3e-14
 Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 15 KRRYKTPAQVMALEKFYNEHK---YPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKRLS 71
            R+ T   V  LE ++ ++    Y   +    + +   L+  Q+  W  +RR KEK ++
Sbjct: 2  GHRF-TKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTIT 60
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.73
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.73
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.72
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.72
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.72
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.72
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.71
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.71
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.69
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.69
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.69
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.68
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.68
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.66
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.66
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.65
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.65
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.64
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.63
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.62
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.61
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.61
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.55
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.55
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.55
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.53
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.47
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.45
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.42
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.41
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.38
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.73  E-value=1.1e-18  Score=135.21  Aligned_cols=57  Identities=32%  Similarity=0.555  Sum_probs=55.2

Q ss_pred             CCCCccCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCChhhhhhhhhchhhhHhh
Q 010311           13 NIKRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKR   69 (513)
Q Consensus        13 RRkRT~FT~~QLevLEk~Fekn~YPS~~eReeLA~eLGLSerQVqVWFQNRRaK~KR   69 (513)
                      |++|+.||..|+.+||..|..++||+..++.+||..|||+++||++||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            577999999999999999999999999999999999999999999999999999986
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure