Citrus Sinensis ID: 010598

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MALAAINALNGIYTMRGCDQPLTVRFADPKRPRPGDSRSGPTFGGPGFGPRFQPPSPRPPPNFGDPITDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGPADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQSPQHMPPLQLHPQVPSSYSHTQNSHLRQLQIPGQTSFSQALPSQHLLGMSGNLPASQPQGQQIASSSTALPTPLNIKPQSSSLPGGTNQQQLPAPVQQQLHQPYQQSPSQLAQMLSQQTQTLQATFQSSQQAFSQLQQQLQLMQPSNQNLPLQQGSQGTKQQSQWAGIAPQTVASAPASAPAADLPVSTSIGPAAPVSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFEQQQQQQKPPVQQPPSQLHSQVLPAQHIPQTQQVQLQTQLRQQQQQQLQHPFSSSYQAPVVRGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSGT
cHHHHHHHHcccEEccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccc
cHHHHHHHHcccEEEccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccHHccHHHHHHHHHHcccccc
MALAAINALNGiytmrgcdqpltvrfadpkrprpgdsrsgptfggpgfgprfqppsprpppnfgdpitdqipqnawhpmsprnmgplsnpgirgfgnqlpprsgdlgmplnpggpadvplpglavsstssalqqnfcqpesqapslgqqisplqkplqspqhmpplqlhpqvpssyshtqnshlrqlqipgqtsfsqalpsqhllgmsgnlpasqpqgqqiassstalptplnikpqssslpggtnqqqlpapvqqqlhqpyqqspSQLAQMLSQQTQTLQATFQSSQQAFSQLQQQLQLmqpsnqnlplqqgsqgtkqqsqwagiapqtvasapasapaadlpvstsigpaapvssqtvapaksswtehtspdgykyYYNCVtgvskwekpeeltLFEQQqqqqkppvqqppsqlhsqvlpaqhipqtQQVQLQTQLRQQQQQqlqhpfsssyqapvvrgqhnaqelgytqlppvaagsvnnptrFQQGLQAAQDWmwknkpsgt
MALAAINALNGIYTMRGCDQPLTVRfadpkrprpgdsrsgpTFGGPGFGPRFQPPSPRPPPNFGDPITDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGPADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQSPQHMPPLQLHPQVPSSYSHTQNSHLRQLQIPGQTSFSQALPSQHLLGMSGNLPASQPQGQQIASSSTALPTPLNIKPQSSSLPGGTNQQQLPAPVQQQLHQPYQQSPSQLAQMLSQQTQTLQATFQSSQQAFSQLQQQLQLMQPSNQNLPLQQGSQGTKQQSQWAGIAPQTVASAPASAPAADLPVSTSIGPAAPvssqtvapaksswtehtspdgyKYYYNCVTGVSKWEKPEELTLFEQQQQQQKPPVQQPPSQLHSQVLPAQHIPQTQQVQLQTQLRQQQQQQLQHPFSSSYQAPVVRGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSGT
MALAAINALNGIYTMRGCDQPLTVRFADPKRPRPGDsrsgptfggpgfgprfqppsprpppnfgdpITDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGPADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKplqspqhmpplqlhpqvpSSYSHTQNSHLRQLQIPGQTSFSQALPSQHLLGMSGNLPASQPQGQQIASSSTALPTPLNIKPQSSSLPGGTNqqqlpapvqqqlhqpyqqspsqlaqmlsqqtqtlqatfqssqqafsqlqqqlqlmqpsnqnlplqqgsqgtkqqsqWAGIAPQTVasapasapaaDLPVSTSIGPAAPVSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFEqqqqqqkppvqqppsqLHSQVLPAQHIPqtqqvqlqtqlrqqqqqqlqHPFSSSYQAPVVRGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSGT
***AAINALNGIYTMRGCDQPLTVR************************************************************************************************************************************************************************************************************************************************************************************************************************************************************DGYKYYYNCVTGVSKWEK*******************************************************************************************************************
***AA*NALNGIYTMRGCDQPLT***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MALAAINALNGIYTMRGCDQPLTVRFADPK*********GPTFGGPGFGPRFQPPSPRPPPNFGDPITDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGPADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQSPQHMPPLQLHPQ************LRQLQIPGQTSFSQALPSQHLLGMSGNLP*************TALPTPLNIKPQ**********************************************************QQLQLMQPSNQNL************************************VSTSIGPAA****************HTSPDGYKYYYNCVTGVSKWEKPEELTL*********************QVLPAQHIPQ************************SYQAPVVRGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSGT
MALAAINALNGIYTMRGCDQPLTVRFADPKRPR***********************PRP*******ITDQIPQNAWHPMSPRNMGPLSN*******N*****************************************************************************************************************************************************************************************************************************************************************************WTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFEQQQQQ*******************************************************************QLPPVA*G***NP*R**Q******D**WKN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALAAINALNGIYTMRGCDQPLTVRFADPKRPRPGDSRSGPTFGGPGFGPRFQPPSPRPPPNFGDPITDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGPADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQSPQHMPPLQLHPQVPSSYSHTQNSHLRQLQIPGQTSFSQALPSQHLLGMSGNLPASQPQGQQIASSSTALPTPLNIKPQSSSLPGGTNQQQLPAPVQQQLHQPYQQSPSQLAQMLSQQTQTLQATFQSSQQAFSQLQQQLQLMQPSNQNLPLQQGSQGTKQQSQWAGIAPQTVASAPASAPAADLPVSTSIGPAAPVSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFEQQQQQQKPPVQQPPSQLHSQVLPAQHIPQTQQVQLQTQLRQQQQQQLQHPFSSSYQAPVVRGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query506 2.2.26 [Sep-21-2011]
O04425747 Flowering time control pr yes no 0.911 0.617 0.451 2e-73
Q924H7 646 WW domain-containing adap yes no 0.075 0.058 0.578 4e-07
Q9BTA9 647 WW domain-containing adap yes no 0.075 0.058 0.578 5e-07
Q5U4Q0 628 WW domain-containing adap yes no 0.075 0.060 0.578 5e-07
Q7ZUK7 558 WW domain-containing adap yes no 0.075 0.068 0.578 6e-07
F4JCC1 992 Pre-mRNA-processing prote no no 0.083 0.042 0.488 1e-06
O75400 957 Pre-mRNA-processing facto no no 0.081 0.042 0.585 1e-06
Q8CGF7 1100 Transcription elongation no no 0.100 0.046 0.450 2e-05
B6EUA9 958 Pre-mRNA-processing prote no no 0.084 0.044 0.534 2e-05
Q9R1C7 953 Pre-mRNA-processing facto no no 0.057 0.030 0.655 0.0001
>sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 Back     alignment and function desciption
 Score =  276 bits (707), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 236/523 (45%), Positives = 292/523 (55%), Gaps = 62/523 (11%)

Query: 2   ALAAINALNGIYTMRGCDQPLTVRFADPKRPRPGDSRSGPTFGGPGFGPRFQPPSPRPPP 61
           A+AAI+ LNG YTMRGC+QPL VRFA+PKRP+PG+SR      G G GPRFQ   PRP  
Sbjct: 264 AMAAIDGLNGTYTMRGCNQPLIVRFAEPKRPKPGESREMAPPVGLGSGPRFQASGPRPTS 323

Query: 62  NFGDPITDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGP------ 115
           NFGD   D    N W P + RN+GP SN GIRG G+  PP+ G   +P N GGP      
Sbjct: 324 NFGDSSGDVSHTNPWRPATSRNVGPPSNTGIRGAGSDFPPKPGQATLPSNQGGPLGGYGV 383

Query: 116 -ADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQSPQHMPPLQLHPQVPS 174
               PLP   VSS+++  QQN         + GQ I+PL+KPL SPQ + PL L PQ   
Sbjct: 384 PPLNPLPVPGVSSSATLQQQN--------RAAGQHITPLKKPLHSPQGL-PLPLRPQT-- 432

Query: 175 SYSHTQNSHLRQLQIPGQTSFSQALPSQHLLGMSGNLPASQPQGQQIASSSTALPTPLNI 234
                          PG    +QA P Q+    S  LP SQ   QQ  S +TA  TPLNI
Sbjct: 433 -------------NFPG----AQA-PLQNPYAYSSQLPTSQLPPQQNISRATAPQTPLNI 474

Query: 235 KPQSSSLPGGTNQQQLPAPVQQQLHQPYQQSPSQLAQMLSQQTQTLQATFQSSQQAFSQL 294
             + +++   T   Q P   QQQ  Q  Q  PS+LAQ+LSQQTQ+LQATFQSSQQA SQL
Sbjct: 475 NLRPTTVSSAT--VQFPPRSQQQPLQKMQHPPSELAQLLSQQTQSLQATFQSSQQAISQL 532

Query: 295 QQQLQLMQPSNQNLPLQQGSQGTKQQSQWAGIAPQTVASAPASAPAADLPVSTSIGPAAP 354
           QQQ+Q MQ  NQNLPL Q  +  KQ  QWAG A   VAS   S P       + +  AAP
Sbjct: 533 QQQVQSMQQPNQNLPLSQNGRAGKQ--QWAGSAIPRVASTTGSTPV------SYVQTAAP 584

Query: 355 VSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFEQQQQQQKPPVQQP-- 412
             SQ+V   K +WTEHTSPDG+KYYYN +TG SKWEKPEE+ +FE++QQ+Q+   ++P  
Sbjct: 585 AVSQSVGSVKCTWTEHTSPDGFKYYYNGLTGESKWEKPEEMIVFEREQQKQQQHQEKPTI 644

Query: 413 --------PSQLHSQVLPAQHIPQTQQVQLQTQLR-----QQQQQQLQHPFSSSYQAPVV 459
                   P Q   Q +  Q+  Q  Q    + L          Q    P   + Q P+ 
Sbjct: 645 QQSQTQLQPLQQQPQQVQQQYQGQQLQQPFYSSLYPTPGASHNTQYPSLPVGQNSQFPMS 704

Query: 460 RGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNK 502
               NAQ+   T + PV A S+N+ +R QQ  Q+ Q+ MWKNK
Sbjct: 705 GIGQNAQDYARTHI-PVGAASMNDISRTQQSRQSPQELMWKNK 746
Plays a major role in the promotion of the transition of the vegetative meristem to reproductive development. Plays a role in the regulation of flowering time in the autonomous flowering pathway by decreasing FLOWERING LOCUS C mRNA levels. Required for RNA-mediated chromatin silencing of a range of loci in the genome. Cotranscriptionally recognizes aberrant RNA and marks it for silencing. Controls alternative cleavage and polyadenylation on pre-mRNAs and antisense RNAs. Acts redundantly with FPA to prevent the expression of distally polyadenylated antisense RNAs at the FLC locus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q924H7|WAC_MOUSE WW domain-containing adapter protein with coiled-coil OS=Mus musculus GN=Wac PE=1 SV=2 Back     alignment and function description
>sp|Q9BTA9|WAC_HUMAN WW domain-containing adapter protein with coiled-coil OS=Homo sapiens GN=WAC PE=1 SV=3 Back     alignment and function description
>sp|Q5U4Q0|WAC_XENTR WW domain-containing adapter protein with coiled-coil OS=Xenopus tropicalis GN=wac PE=2 SV=1 Back     alignment and function description
>sp|Q7ZUK7|WAC_DANRE WW domain-containing adapter protein with coiled-coil OS=Danio rerio GN=waca PE=2 SV=1 Back     alignment and function description
>sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 Back     alignment and function description
>sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 Back     alignment and function description
>sp|Q8CGF7|TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus GN=Tcerg1 PE=1 SV=2 Back     alignment and function description
>sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 Back     alignment and function description
>sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
296083224 708 unnamed protein product [Vitis vinifera] 0.982 0.701 0.644 1e-135
359477208 785 PREDICTED: flowering time control protei 0.982 0.633 0.644 1e-134
255556436 811 Flowering time control protein FCA, puta 0.905 0.564 0.627 1e-105
449462184 675 PREDICTED: flowering time control protei 0.926 0.694 0.542 1e-105
356565014 733 PREDICTED: flowering time control protei 0.974 0.672 0.555 1e-104
356521753 737 PREDICTED: flowering time control protei 0.976 0.670 0.554 2e-98
60459259 743 FCA gamma [Pisum sativum] 0.976 0.664 0.484 4e-88
357479035 862 FCA [Medicago truncatula] gi|355510858|g 0.960 0.563 0.504 3e-83
18150431 715 FCA gamma [Brassica napus] 0.843 0.597 0.441 3e-79
334302803 747 RecName: Full=Flowering time control pro 0.911 0.617 0.451 1e-71
>gi|296083224|emb|CBI22860.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 344/534 (64%), Positives = 386/534 (72%), Gaps = 37/534 (6%)

Query: 1   MALAAINALNGIYTMRGCDQPLTVRFADPKRPRPGDSRSGPTFGGPGFGPRFQPPSPRPP 60
           MA+AAINALNGIYTMRGCDQPLTVRFADPKRPRPG+SR  P FGGPGFGPRFQ P  RP 
Sbjct: 184 MAMAAINALNGIYTMRGCDQPLTVRFADPKRPRPGESRGAPAFGGPGFGPRFQAPGVRPT 243

Query: 61  PNFGDPI-TDQIPQNAWHPMSPRNMGPLSNPGIRGFGNQLPPRSGDLGMP-------LNP 112
            N GDPI + +IP NAW PMSP+N+GP SN GI GFGNQ  PRSGD  +           
Sbjct: 244 MNQGDPIGSGRIPPNAWRPMSPQNLGPSSNAGIHGFGNQSLPRSGDGSISSTPGVPLGGL 303

Query: 113 GGPADVPLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQSPQHMPP-LQLHPQ 171
           GG AD  L G+AVSS++++ QQ+F QP  Q PS+G+QISPLQK LQSPQH+PP LQL  Q
Sbjct: 304 GGSADGSLSGIAVSSSATS-QQSFNQPMLQVPSIGEQISPLQKSLQSPQHLPPSLQLQSQ 362

Query: 172 VPSSYSHTQNSH--LRQ---LQI---PGQTSFSQALPSQHLLGMSGNLPASQPQGQQIAS 223
            P+SY+  Q  H  LRQ   LQI    GQT F+Q LPSQ LLG+SG L  SQPQ QQ AS
Sbjct: 363 TPASYTQPQTPHSSLRQFGQLQISHSAGQTPFNQTLPSQQLLGLSGQLSGSQPQVQQSAS 422

Query: 224 SSTALPTPLNIKPQSSSLPGGTNQQQLPAPVQQQLHQPYQQSPSQLAQMLSQQTQTLQAT 283
           S+TA  TP+N+  Q  ++    NQ Q+PAP QQQL QP  QSPSQLAQ+LSQQTQ LQA+
Sbjct: 423 SATAQQTPVNLNLQQHAVSVMANQHQVPAPSQQQLVQPLHQSPSQLAQLLSQQTQALQAS 482

Query: 284 FQSSQQAFSQLQQQLQLMQPSNQNLPLQQGSQGTKQQSQWAGIAPQTVASAPASAPAADL 343
           FQSSQQAFSQLQQQLQLMQPSNQ L  QQGSQ TKQ  QW G  PQTVAS     PA D+
Sbjct: 483 FQSSQQAFSQLQQQLQLMQPSNQTLTSQQGSQTTKQ--QWPGTVPQTVASTATITPATDV 540

Query: 344 PVSTSIGPAAPVSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFEQQQQ 403
           P +TS   A PV++Q VAP K +WTEHTSPDGYKYY+N VTG S+WEKPEELTL EQQQQ
Sbjct: 541 PSTTS---AVPVTTQAVAPVKCNWTEHTSPDGYKYYHNSVTGESRWEKPEELTLLEQQQQ 597

Query: 404 QQKPPVQQPPSQLHSQVLPAQHIPQTQQVQLQTQLRQQQQQQLQH-----------PFSS 452
           QQK  VQQ  +Q H+QVL  Q IPQ QQVQLQTQL+   Q QLQ            P SS
Sbjct: 598 QQKSSVQQSQAQSHTQVLSTQQIPQAQQVQLQTQLQAHLQAQLQSQLRQHQQMQQPPVSS 657

Query: 453 SYQAPVVRGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSGT 506
           S  A  V GQ N QELGY Q   V A SVN+P RFQQGLQAAQ+WMWKNKP+G+
Sbjct: 658 S--ASGVMGQQNVQELGYAQ-AQVGASSVNDPARFQQGLQAAQEWMWKNKPAGS 708

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359477208|ref|XP_002279515.2| PREDICTED: flowering time control protein FCA [Vitis vinifera] Back     alignment and taxonomy information
>gi|255556436|ref|XP_002519252.1| Flowering time control protein FCA, putative [Ricinus communis] gi|223541567|gb|EEF43116.1| Flowering time control protein FCA, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449462184|ref|XP_004148821.1| PREDICTED: flowering time control protein FCA-like [Cucumis sativus] gi|449511891|ref|XP_004164081.1| PREDICTED: flowering time control protein FCA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356565014|ref|XP_003550740.1| PREDICTED: flowering time control protein FCA-like [Glycine max] Back     alignment and taxonomy information
>gi|356521753|ref|XP_003529516.1| PREDICTED: flowering time control protein FCA-like [Glycine max] Back     alignment and taxonomy information
>gi|60459259|gb|AAX20016.1| FCA gamma [Pisum sativum] Back     alignment and taxonomy information
>gi|357479035|ref|XP_003609803.1| FCA [Medicago truncatula] gi|355510858|gb|AES92000.1| FCA [Medicago truncatula] Back     alignment and taxonomy information
>gi|18150431|gb|AAL61622.1|AF414188_1 FCA gamma [Brassica napus] Back     alignment and taxonomy information
>gi|334302803|sp|O04425.2|FCA_ARATH RecName: Full=Flowering time control protein FCA gi|2244986|emb|CAB10407.1| FCA gamma protein [Arabidopsis thaliana] gi|7268377|emb|CAB78670.1| FCA gamma protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
UNIPROTKB|Q6K271738 P0415D04.46-1 "FCA" [Oryza sat 0.108 0.074 0.454 8.6e-30
UNIPROTKB|Q6WQT6738 Q6WQT6 "Flowering time control 0.108 0.074 0.454 8.6e-30
TAIR|locus:2065190512 AT2G47310 [Arabidopsis thalian 0.071 0.070 0.75 5.4e-16
UNIPROTKB|H0YG38346 PRPF40A "Pre-mRNA-processing f 0.081 0.118 0.585 6e-07
UNIPROTKB|C9JVK6173 WAC "WW domain-containing adap 0.096 0.283 0.509 1.1e-06
UNIPROTKB|F5H578 448 PRPF40A "Pre-mRNA-processing f 0.081 0.091 0.585 1.5e-06
MGI|MGI:1860512 953 Prpf40a "PRP40 pre-mRNA proces 0.094 0.050 0.545 4.6e-06
RGD|1311401 953 Prpf40a "PRP40 pre-mRNA proces 0.094 0.050 0.545 4.6e-06
UNIPROTKB|C9JD58204 WAC "WW domain-containing adap 0.096 0.240 0.509 9.4e-06
UNIPROTKB|O75400 957 PRPF40A "Pre-mRNA-processing f 0.081 0.042 0.585 1.2e-05
UNIPROTKB|Q6K271 P0415D04.46-1 "FCA" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 154 (59.3 bits), Expect = 8.6e-30, Sum P(4) = 8.6e-30
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query:   345 VSTSIGPAAPVSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTLFE 399
             + ++I      ++    P   +WTEHTSP+G+KYYYN +T  SKW+KPEE  L+E
Sbjct:   593 IPSNINTIPQQATSPAVPLTCNWTEHTSPEGFKYYYNSITRESKWDKPEEYVLYE 647
GO:0003723 "RNA binding" evidence=ISS
GO:0009909 "regulation of flower development" evidence=ISS
GO:0044428 "nuclear part" evidence=ISS
UNIPROTKB|Q6WQT6 Q6WQT6 "Flowering time control protein isoform OsFCA-1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2065190 AT2G47310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H0YG38 PRPF40A "Pre-mRNA-processing factor 40 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JVK6 WAC "WW domain-containing adapter protein with coiled-coil" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H578 PRPF40A "Pre-mRNA-processing factor 40 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1860512 Prpf40a "PRP40 pre-mRNA processing factor 40 homolog A (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311401 Prpf40a "PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|C9JD58 WAC "WW domain-containing adapter protein with coiled-coil" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75400 PRPF40A "Pre-mRNA-processing factor 40 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033168001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (676 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-13
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 5e-09
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 8e-08
pfam0039730 pfam00397, WW, WW domain 1e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-06
COG5104 590 COG5104, PRP40, Splicing factor [RNA processing an 9e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-04
COG5104 590 COG5104, PRP40, Splicing factor [RNA processing an 7e-04
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 7e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 9e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.001
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information 
 Score = 66.0 bits (161), Expect = 1e-13
 Identities = 25/29 (86%), Positives = 26/29 (89%)

Query: 1  MALAAINALNGIYTMRGCDQPLTVRFADP 29
          MA AAI ALNG+YTMRGCDQPL VRFADP
Sbjct: 52 MAQAAIKALNGVYTMRGCDQPLIVRFADP 80

This subgroup corresponds to the RRM2 of FCA, a gene controlling flowering time in Arabidopsis, which encodes a flowering time control protein that functions in the posttranscriptional regulation of transcripts involved in the flowering process. The flowering time control protein FCA contains two RNA recognition motifs (RRMs), also known as RBDs (RNA binding domains) or RNP (ribonucleoprotein domains), and a WW protein interaction domain. . Length = 80
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|227435 COG5104, PRP40, Splicing factor [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|227435 COG5104, PRP40, Splicing factor [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 506
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 100.0
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 98.54
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 98.52
cd0020131 WW Two conserved tryptophans domain; also known as 98.5
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 98.18
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 97.78
KOG3259163 consensus Peptidyl-prolyl cis-trans isomerase [Pos 97.71
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 96.88
KOG0155 617 consensus Transcription factor CA150 [Transcriptio 96.67
KOG0155 617 consensus Transcription factor CA150 [Transcriptio 96.47
KOG0150336 consensus Spliceosomal protein FBP21 [RNA processi 95.7
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 95.07
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 93.44
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 85.98
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 81.95
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 80.77
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-35  Score=300.74  Aligned_cols=315  Identities=23%  Similarity=0.151  Sum_probs=262.4

Q ss_pred             ChHHHHHhhcCceeecCCCCCeEEEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 010598            1 MALAAINALNGIYTMRGCDQPLTVRFADPKRPRPGDSRSGPTFGGPGFGPRFQPPSPRPPPNFGDPITDQIPQNAWHPMS   80 (506)
Q Consensus         1 ~AlaAI~~Lng~~tm~Gc~~PL~VrfAd~k~pr~gesrg~~~~~g~g~gp~~~ap~~rp~~n~~d~~g~~~~pnawrP~~   80 (506)
                      ||++||++|||+||||||++||||||||+||+|.|+.                                .-.-|+|+...
T Consensus       177 ~A~~Aika~ng~~tmeGcs~PLVVkFADtqkdk~~~~--------------------------------lqq~~~~~~qq  224 (510)
T KOG0144|consen  177 MAVAAIKALNGTQTMEGCSQPLVVKFADTQKDKDGKR--------------------------------LQQLNPALLQQ  224 (510)
T ss_pred             HHHHHHHhhccceeeccCCCceEEEecccCCCchHHH--------------------------------HHhhhHHHHHH
Confidence            7999999999999999999999999999999999998                                22478999999


Q ss_pred             CCCCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCccccccchhhhcccCCCCCCCCCCCCcCCCCCCCCC
Q 010598           81 PRNMGPLSNPGIRGFGNQLPPRSGDLGMPLNPGGPADV--PLPGLAVSSTSSALQQNFCQPESQAPSLGQQISPLQKPLQ  158 (506)
Q Consensus        81 p~~~~p~~n~g~~g~Gs~~~~~~G~~~~~~~~~gp~~g--~~~~~~~~~~s~~sqq~~n~~~~q~~~~gqqi~plqKp~~  158 (506)
                      -.+.++..|.++.|++++-....+.-.++++.+|+..|  .|.++    . ++..+       |...++.+|.|+||+..
T Consensus       225 l~~~~~~~n~~~~~~l~~~~~~~~Qq~~~sqn~g~l~g~~~L~~l----~-a~~~q-------q~~~~~~~~ta~q~~~~  292 (510)
T KOG0144|consen  225 LGNGQNPQNLASLGALSNGYQGPQQQTQQSQNVGTLGGLPPLGPL----N-ATQLQ-------QAAALAAAATAAQKTAS  292 (510)
T ss_pred             hcCCCCccchhhhhccCcccCchhhhccccCCCcccccccCCCCc----c-hhHHH-------HHHHhhhhcccccCCCC
Confidence            99999999999999999888889999999999988774  55554    2 34433       78889999999999999


Q ss_pred             CCCCCCCCcCCCCCCCCcccccccccccccCCCCCcc-cCCCccccccCCCCCCCCCCcchhhcccccccCCCCCCCCCC
Q 010598          159 SPQHMPPLQLHPQVPSSYSHTQNSHLRQLQIPGQTSF-SQALPSQHLLGMSGNLPASQPQGQQIASSSTALPTPLNIKPQ  237 (506)
Q Consensus       159 spQ~~p~lq~~pq~~~~~~~~~~l~~~~~~~~~~~~f-~~~~p~q~~~~~sgql~~sQp~~qq~a~~~~~~q~~l~~~~q  237 (506)
                      |++.+|. +  ++                     +|| |..-|.++.++++.++++|+-..+++.+..+++.+++|+| .
T Consensus       293 s~q~~pl-~--~q---------------------ts~~~~~~~~~~~~~~ss~~~~s~~~~aq~~~~q~~p~t~~~~n-~  347 (510)
T KOG0144|consen  293 STQGLPL-R--TQ---------------------TSFPGSQTSPQSASAPSSSLSTSQNPLAQLGARQTFPGTPANYN-L  347 (510)
T ss_pred             CcccCcc-c--cc---------------------cCCccccCCCccccCccccCcccccchhhhhHhhcCCCCchhcc-c
Confidence            9999844 2  22                     666 6677788899999999999999999999999999999999 6


Q ss_pred             CCCCCCCCCCccCCcccccccCCCccCCchHHHHHHHHHHHHHHHhhhchHHHHHHHHHHHHHcCCCccCCCCccCCCCc
Q 010598          238 SSSLPGGTNQQQLPAPVQQQLHQPYQQSPSQLAQMLSQQTQTLQATFQSSQQAFSQLQQQLQLMQPSNQNLPLQQGSQGT  317 (506)
Q Consensus       238 s~~~~~~~~qqq~p~~vqqq~~qp~qq~Psql~Qll~QQtqtlQasfqSsQQa~sqlqqQlq~mq~~~Q~l~~q~~~~~~  317 (506)
                      .+.|  ....-..|.....+.++++...|+. ++++++++|++|..|+|++.|+..|..|.+.|++.+.+...+.....+
T Consensus       348 ~~~~--a~a~~~sp~aa~~~~lq~~~ltp~~-~~~~~~~tQa~q~~~q~a~~a~~~l~~q~~~~qq~~~~~~~q~eGpeG  424 (510)
T KOG0144|consen  348 AGGM--AGAGTTSPVAASLANLQQIGLTPFA-GAAALDHTQAMQQYAQSANLAAPGLVGQQATTQQAQMVGNGQVEGPEG  424 (510)
T ss_pred             cccc--ccccccCcccccccccccccCCChh-hhhhHhHHHhhhHhhhhhhhcccchhhhhHhhhhhhcccCccccCCCc
Confidence            7777  3456677888888899999999999 999999999999999999999999999999999999998888776655


Q ss_pred             ccccccCCCCCcccccCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCCCceEEeCCCCCcccccCCCCceeccCCccCCH
Q 010598          318 KQQSQWAGIAPQTVASAPASAPAADLPVSTSIGPAAPVSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELTL  397 (506)
Q Consensus       318 k~Q~qw~G~~~q~v~s~~~~APaA~v~Ss~s~~savP~~~q~~~~~~s~WtEh~SpDGr~YYYNt~TkEStWEKPeElk~  397 (506)
                      +.=  .-++.           |--...      ..++..-+..-...+.|+++...+|-.|||+-+|.|+.|++++++..
T Consensus       425 anl--fiyhl-----------Pqefgd------q~l~~~f~pfG~Vlsakvfidk~tnlskcfgfvSyen~~sa~~aI~a  485 (510)
T KOG0144|consen  425 ANL--FIYHL-----------PQEFGD------QDLIATFQPFGGVLSAKVFIDKVTNLSKCFGFVSYENAQSAQNAISA  485 (510)
T ss_pred             cce--eeeeC-----------chhhhh------HHHHHHhccccceeEEEEEEecccCHhhhcCcccccchhhhHHHHHH
Confidence            431  22222           322222      23444444445567789999999999999999999999999999988


Q ss_pred             HHHHHHhcC
Q 010598          398 FEQQQQQQK  406 (506)
Q Consensus       398 ~Erq~qqq~  406 (506)
                      ++..+...|
T Consensus       486 mngfQig~K  494 (510)
T KOG0144|consen  486 MNGFQIGSK  494 (510)
T ss_pred             hcchhhccc
Confidence            876554333

>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0155 consensus Transcription factor CA150 [Transcription] Back     alignment and domain information
>KOG0155 consensus Transcription factor CA150 [Transcription] Back     alignment and domain information
>KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
2l5f_A92 Solution Structure Of The Tandem Ww Domains From Hy 2e-06
1ywi_A41 Structure Of The Fbp11ww1 Domain Complexed To The P 2e-05
2jxw_A75 Solution Structure Of The Tandem Ww Domains Of Fbp2 4e-05
1e0l_A37 Fbp28ww Domain From Mus Musculus Length = 37 4e-04
1zr7_A30 Solution Structure Of The First Ww Domain Of Fbp11 5e-04
>pdb|2L5F|A Chain A, Solution Structure Of The Tandem Ww Domains From HypaFBP11 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/41 (58%), Positives = 29/41 (70%)
Query: 355 VSSQTVAPAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEEL 395
           V++ T + AKS WTEH SPDG  YYYN  T  S WEKP++L
Sbjct: 4   VAAGTASGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDL 44
>pdb|1YWI|A Chain A, Structure Of The Fbp11ww1 Domain Complexed To The Peptide Apptppplpp Length = 41 Back     alignment and structure
>pdb|2JXW|A Chain A, Solution Structure Of The Tandem Ww Domains Of Fbp21 Length = 75 Back     alignment and structure
>pdb|1E0L|A Chain A, Fbp28ww Domain From Mus Musculus Length = 37 Back     alignment and structure
>pdb|1ZR7|A Chain A, Solution Structure Of The First Ww Domain Of Fbp11 Length = 30 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 99.31
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 99.23
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 99.16
2dk7_A73 Transcription elongation regulator 1; structural g 99.07
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 99.06
2jxw_A75 WW domain-binding protein 4; WW domain containing 98.78
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 98.68
2jxw_A75 WW domain-binding protein 4; WW domain containing 98.61
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 98.6
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 98.59
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 98.58
1ymz_A43 CC45; artificial protein, computational design, un 98.54
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.46
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 98.46
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.46
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.44
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 98.41
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 98.41
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.38
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 98.37
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 98.32
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 98.27
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 98.22
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 98.22
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 98.21
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 98.17
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.1
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 98.1
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.1
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 98.09
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 98.08
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 98.07
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 98.07
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 97.96
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 97.92
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 97.82
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 97.82
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 97.78
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 97.75
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 97.75
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 97.74
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 97.73
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 97.53
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 97.51
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 97.42
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 97.17
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 96.67
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 96.55
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 96.28
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 96.02
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 95.61
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 94.94
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 94.34
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 94.15
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 94.13
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 93.76
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 93.75
2cqd_A116 RNA-binding region containing protein 1; RNA recog 93.67
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 93.56
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 93.55
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 93.45
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 93.24
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 93.14
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 93.04
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 92.72
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 92.46
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 92.42
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 92.37
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 92.23
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 91.94
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 91.89
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 91.84
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 91.56
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 91.28
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 91.26
1x5p_A97 Negative elongation factor E; structure genomics, 91.24
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 91.15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 91.12
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 91.09
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 90.98
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 90.81
2dis_A109 Unnamed protein product; structural genomics, RRM 90.6
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 90.39
2cpj_A99 Non-POU domain-containing octamer-binding protein; 90.36
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 90.21
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 90.14
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 90.13
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 90.01
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 89.8
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 89.73
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 89.08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 88.93
2cph_A107 RNA binding motif protein 19; RNA recognition moti 88.85
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 88.59
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 88.2
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 87.81
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 87.06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 86.82
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 85.96
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 85.95
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 85.3
2div_A99 TRNA selenocysteine associated protein; structural 85.29
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 85.27
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 85.08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 84.64
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 84.56
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 84.21
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 83.39
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 83.36
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 83.14
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 82.78
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 82.71
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 82.43
3p5t_L90 Cleavage and polyadenylation specificity factor S; 82.12
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 82.12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 81.48
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 80.37
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 80.2
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
Probab=99.31  E-value=1e-12  Score=93.53  Aligned_cols=34  Identities=56%  Similarity=0.904  Sum_probs=31.6

Q ss_pred             CCCCceEEeCCCCCcccccCCCCceeccCCccCC
Q 010598          363 AKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELT  396 (506)
Q Consensus       363 ~~s~WtEh~SpDGr~YYYNt~TkEStWEKPeElk  396 (506)
                      ..+.|+|++++||++||||.+|+||+||||++|+
T Consensus         4 ~~~~W~e~~~~~G~~YYyN~~T~es~We~P~~~k   37 (37)
T 1e0l_A            4 AVSEWTEYKTADGKTYYYNNRTLESTWEKPQELK   37 (37)
T ss_dssp             SSCSCEEEECTTSCEEEEETTTTEEESSCCSSCC
T ss_pred             CCCCeEEEECCCCCEEEEECCCCCEEecCCCccC
Confidence            4567999999999999999999999999999985
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 506
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 1e-14
d2dk1a138 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP 2e-14
d1o6wa129 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's y 4e-13
d1ywia128 b.72.1.1 (A:15-42) Huntingtin-interacting protein 4e-13
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 6e-13
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 2e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.002
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 0.003
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 0.003
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure

class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Formin binding protein FBP28 domain
species: Domestic mouse (Mus musculus) [TaxId: 10090]

 Score = 65.6 bits (160), Expect = 1e-14
 Identities = 20/35 (57%), Positives = 23/35 (65%)

Query: 361 APAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEEL 395
           A A S WTE+ + DG  YYYN  T  S WEKP+EL
Sbjct: 2   ATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQEL 36
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 29 Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 99.33
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 99.29
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 99.25
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 99.25
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 99.04
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 98.36
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 98.09
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 98.04
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 98.04
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 97.88
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 96.61
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 95.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 93.39
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 92.53
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 92.38
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 91.62
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 91.5
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 91.22
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 91.0
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 89.39
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 88.85
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 87.98
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 86.97
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 86.86
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 84.93
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 84.59
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 83.87
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 83.52
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 83.5
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 82.03
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 81.92
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 81.92
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 80.43
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 80.3
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 80.17
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 80.16
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Formin binding protein FBP28 domain
species: Domestic mouse (Mus musculus) [TaxId: 10090]

Probab=99.33  E-value=2.9e-13  Score=96.19  Aligned_cols=35  Identities=54%  Similarity=0.880  Sum_probs=32.4

Q ss_pred             CCCCCceEEeCCCCCcccccCCCCceeccCCccCC
Q 010598          362 PAKSSWTEHTSPDGYKYYYNCVTGVSKWEKPEELT  396 (506)
Q Consensus       362 ~~~s~WtEh~SpDGr~YYYNt~TkEStWEKPeElk  396 (506)
                      ...+.|+|++++|||+||||.+|+||+||+|+||+
T Consensus         3 ~~~s~W~e~~~~~Gr~YY~N~~T~~s~We~P~elk   37 (37)
T d2rm0w1           3 TAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELK   37 (37)
T ss_dssp             CCSCCEEEEECTTCCEEEEETTTTEEESSCCSSCC
T ss_pred             CCccCCEEEECCCCCEEEEECCCCCEeCCCccccC
Confidence            35678999999999999999999999999999985
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure