Citrus Sinensis ID: 010739


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MASVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIREFRFLKSVELDQFVTSDDEDEMSEEFFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLYIKKYKLWIIKML
ccccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHccccccHHHccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHccc
cccHHHHccEEccccccccccccccHHccccccccccEEEEEEccccccEEEEEccccEEEEEEEEEEEEccEEccccHHHHcccHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHEEEEEEcc
masvpelgfalspnfLLQRHkllvpqlhgscltrpppristriknyqnpsfiaTKVSKIREFRFLKSVeldqfvtsddedEMSEEFFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDmdcvglkpgfSMIEKVISLYWEMEKKERAVLFVKAVLSRGIayaegdgegqqggptgYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVragsiaeldgknLGLIEKYQSDLladgsrlsswaiqeggsslyGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLdlglypeyMDRVAVLQGLRKRIQQSGNVEAYLNLCKRlsdtsligpcLVYLYIKKYKLWIIKML
MASVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPristriknyqnpsfIATKVSKIREFRFLKSVELDqfvtsddedemSEEFFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKkenrvdneTMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAyaegdgegqqggPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRagsiaeldgknlgLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRlsdtsligpcLVYLYIKKYKLWIIKML
MASVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIREFRFLKSVELDQFVTSddedemseeffeaieeleRMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERgvgdvvdllvdmdcvglKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAegdgegqqggPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVylyikkyklwiikml
******LGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIREFRFLKSVELDQFV**************************************ARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLYIKKYKLWIIK**
****************LQRHKLLVPQLHGSCLTRPP***********************************************EEFFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLYIKKYKLWIIKML
MASVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIREFRFLKSVELDQFVTSDDEDEMSEEFFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLYIKKYKLWIIKML
**SVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIREFRFLKSVELDQFVTSDDEDEMSEEFFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLYIKKYKLWIIKML
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIREFRFLKSVELDQFVTSDDxxxxxxxxxxxxxxxxxxxxxPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLYIKKYKLWIIKML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query502 2.2.26 [Sep-21-2011]
Q0WNN7503 Pentatricopeptide repeat- yes no 0.940 0.938 0.636 1e-170
Q0WVV0 664 Pentatricopeptide repeat- no no 0.350 0.265 0.25 4e-05
Q9LW84642 Pentatricopeptide repeat- no no 0.262 0.205 0.275 0.0007
>sp|Q0WNN7|PP176_ARATH Pentatricopeptide repeat-containing protein At2g30100, chloroplastic OS=Arabidopsis thaliana GN=At2g30100 PE=2 SV=2 Back     alignment and function desciption
 Score =  598 bits (1543), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 313/492 (63%), Positives = 380/492 (77%), Gaps = 20/492 (4%)

Query: 23  LVPQLHGSCLTRPPPRISTRIK-NYQNPSFIATKVSKIREFRFLKSVELDQFVTSDDEDE 81
            +P+LH +   +P  RI   +K NY           K RE    +SVELDQF+TS++E+ 
Sbjct: 20  FLPRLHRNHSVKPNSRIICNLKLNYS--------AGKFREMGLSRSVELDQFITSEEEEG 71

Query: 82  MSEE----FFEAIEELERMTREPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVF 137
            +EE    FFEAIEELERMTREPSDILEEMN RLS+RELQL+LVYF+QEGRDSWC LEVF
Sbjct: 72  EAEEIGEGFFEAIEELERMTREPSDILEEMNHRLSSRELQLMLVYFAQEGRDSWCTLEVF 131

Query: 138 EWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKV 197
           EWLKKENRVD E MELMVSIMC WVKK IE+E     V DLL++MDCVGLKPGFSM++KV
Sbjct: 132 EWLKKENRVDEEIMELMVSIMCGWVKKLIEDECNAHQVFDLLIEMDCVGLKPGFSMMDKV 191

Query: 198 ISLYWEMEKKERAVLFVKAVLSR-----GIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVD 252
           I+LY EM KKE AVLFVK VL R           G  EG++GGP GYLAWK MV+G Y  
Sbjct: 192 IALYCEMGKKESAVLFVKEVLRRRDGFGYSVVGGGGSEGRKGGPVGYLAWKFMVDGDYRK 251

Query: 253 AIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGL 312
           A+ +V+ LR SGLKPE YSYLIA+TA+VKELN  GK LR+LK + RAG +AE+D  +  L
Sbjct: 252 AVDMVMELRLSGLKPEAYSYLIAMTAIVKELNSLGKTLRELKRFARAGFVAEIDDHDRVL 311

Query: 313 IEKYQSDLLADGSRLSSWAIQEG--GSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLV 370
           IEKYQS+ L+ G +L++WA++EG    S+ GVVHERLLAMYICAGRG EAE+QLW+MKL 
Sbjct: 312 IEKYQSETLSRGLQLATWAVEEGQENDSIIGVVHERLLAMYICAGRGPEAEKQLWKMKLA 371

Query: 371 GKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDA 430
           G+E + DL+DIV+AICASQ E +AVSRLL+R+E M S  KKKTLSWLLRGY+KGGH  +A
Sbjct: 372 GREPEADLHDIVMAICASQKEVNAVSRLLTRVEFMGSQRKKKTLSWLLRGYVKGGHFEEA 431

Query: 431 AETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTSLIGPCLVYLY 490
           AETL  M+D GL+PEY+DRVAV+QG+ ++IQ+  +VEAY++LCKRL D  L+GPCLVY+Y
Sbjct: 432 AETLVSMIDSGLHPEYIDRVAVMQGMTRKIQRPRDVEAYMSLCKRLFDAGLVGPCLVYMY 491

Query: 491 IKKYKLWIIKML 502
           I KYKLWI+KM+
Sbjct: 492 IDKYKLWIVKMM 503





Arabidopsis thaliana (taxid: 3702)
>sp|Q0WVV0|PPR31_ARATH Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
225434512511 PREDICTED: pentatricopeptide repeat-cont 0.998 0.980 0.782 0.0
255560355499 conserved hypothetical protein [Ricinus 0.976 0.981 0.763 0.0
224105911500 predicted protein [Populus trichocarpa] 0.966 0.97 0.777 0.0
356566020508 PREDICTED: pentatricopeptide repeat-cont 0.996 0.984 0.716 0.0
356539658510 PREDICTED: pentatricopeptide repeat-cont 0.992 0.976 0.708 0.0
449523569501 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.970 0.972 0.695 0.0
449450940 1290 PREDICTED: uncharacterized protein LOC10 0.948 0.368 0.688 0.0
334184571503 pentatricopeptide repeat-containing prot 0.940 0.938 0.636 1e-168
297745858411 unnamed protein product [Vitis vinifera] 0.703 0.858 0.750 1e-158
3150410 902 putative unknown protein, leucine-rich r 0.898 0.5 0.630 1e-157
>gi|225434512|ref|XP_002278434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/502 (78%), Positives = 435/502 (86%), Gaps = 1/502 (0%)

Query: 1   MASVPELGFALSPNFLLQRHKLLVPQLHGSCLTRPPPRISTRIKNYQNPSFIATKVSKIR 60
           + S  ELGF LS +F +QR +L+VP+   S L     R +T I N+QNP F+  K  KIR
Sbjct: 11  LMSPTELGFTLSSSFSIQRPRLIVPKFSRSFLGEYCSRATT-ICNHQNPRFVVPKRDKIR 69

Query: 61  EFRFLKSVELDQFVTSDDEDEMSEEFFEAIEELERMTREPSDILEEMNDRLSARELQLVL 120
           EFR  KSVELDQF+TSDDEDEMSE FFEAIEELERMTREPSD+LEEMNDRLSARELQLVL
Sbjct: 70  EFRLFKSVELDQFLTSDDEDEMSEGFFEAIEELERMTREPSDVLEEMNDRLSARELQLVL 129

Query: 121 VYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLV 180
           VYFSQEGRDSWCALEVFEWL+KENRVD ETMELMVSIMCSWVKK IE E  VGDVVDLLV
Sbjct: 130 VYFSQEGRDSWCALEVFEWLRKENRVDKETMELMVSIMCSWVKKLIEGEHDVGDVVDLLV 189

Query: 181 DMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYL 240
           DMDCVGLKPGFSMIEKVISLYWEME+KE+AVLFVK VL R IAY+E DG+G +GGPTGYL
Sbjct: 190 DMDCVGLKPGFSMIEKVISLYWEMEEKEKAVLFVKEVLRREIAYSEDDGDGHKGGPTGYL 249

Query: 241 AWKMMVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAG 300
           AWKMM EG Y  A+KLVIHLRESGLKPEVYSYLIA+TAVVKELNEF KALRKLKG+ ++G
Sbjct: 250 AWKMMAEGNYRGAVKLVIHLRESGLKPEVYSYLIAMTAVVKELNEFAKALRKLKGFTKSG 309

Query: 301 SIAELDGKNLGLIEKYQSDLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEA 360
            IAELD +N+ LIEKYQSDLLADG RLSSW IQEG S L+GVV+ERLLAMYICAGRGLEA
Sbjct: 310 LIAELDAENVELIEKYQSDLLADGVRLSSWVIQEGRSPLHGVVYERLLAMYICAGRGLEA 369

Query: 361 ERQLWEMKLVGKEADGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRG 420
           ERQLWEMKLVGKEAD +LYDIVLAICAS+ E SA+SRLL+ +EV +S+ +KKTLSWLLRG
Sbjct: 370 ERQLWEMKLVGKEADRELYDIVLAICASKKEASAISRLLTGMEVTSSIRRKKTLSWLLRG 429

Query: 421 YIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTS 480
           YIKG H +DA+ET+ KMLDLGL PEY+DR AVLQGLR RIQQ+GNVE YL LCK LSD +
Sbjct: 430 YIKGSHFDDASETIIKMLDLGLCPEYLDRAAVLQGLRNRIQQTGNVETYLKLCKHLSDAN 489

Query: 481 LIGPCLVYLYIKKYKLWIIKML 502
           LIGPCLVYLYIKKYKLWI+K +
Sbjct: 490 LIGPCLVYLYIKKYKLWILKTI 511




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255560355|ref|XP_002521193.1| conserved hypothetical protein [Ricinus communis] gi|223539607|gb|EEF41193.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224105911|ref|XP_002313976.1| predicted protein [Populus trichocarpa] gi|222850384|gb|EEE87931.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356566020|ref|XP_003551233.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356539658|ref|XP_003538312.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449523569|ref|XP_004168796.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449450940|ref|XP_004143220.1| PREDICTED: uncharacterized protein LOC101207176 [Cucumis sativus] Back     alignment and taxonomy information
>gi|334184571|ref|NP_180571.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546771|sp|Q0WNN7.2|PP176_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g30100, chloroplastic; Flags: Precursor gi|330253250|gb|AEC08344.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297745858|emb|CBI15914.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|3150410|gb|AAC16962.1| putative unknown protein, leucine-rich repeat [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WNN7PP176_ARATHNo assigned EC number0.63610.94020.9383yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024051001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (511 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 502
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.65
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.63
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.58
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.56
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.53
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.51
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.5
PF1304150 PPR_2: PPR repeat family 99.47
PF1304150 PPR_2: PPR repeat family 99.45
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.45
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.41
PRK14574 822 hmsH outer membrane protein; Provisional 99.39
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.34
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.29
PRK14574 822 hmsH outer membrane protein; Provisional 99.27
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.27
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.27
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.27
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.2
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.19
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.19
KOG2076 895 consensus RNA polymerase III transcription factor 99.15
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.13
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.07
KOG2003 840 consensus TPR repeat-containing protein [General f 99.06
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.05
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.02
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.01
PF1285434 PPR_1: PPR repeat 99.0
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.97
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.95
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.94
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.88
PF1285434 PPR_1: PPR repeat 98.86
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.85
KOG1126638 consensus DNA-binding cell division cycle control 98.8
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.78
PRK12370553 invasion protein regulator; Provisional 98.76
KOG1126638 consensus DNA-binding cell division cycle control 98.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.75
PRK12370553 invasion protein regulator; Provisional 98.75
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.73
KOG2076 895 consensus RNA polymerase III transcription factor 98.66
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.64
KOG2003840 consensus TPR repeat-containing protein [General f 98.61
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.55
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.5
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.47
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.44
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.43
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.41
KOG1129478 consensus TPR repeat-containing protein [General f 98.39
KOG1129478 consensus TPR repeat-containing protein [General f 98.36
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.32
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.27
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.25
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.25
PRK11189296 lipoprotein NlpI; Provisional 98.2
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.16
KOG0547606 consensus Translocase of outer mitochondrial membr 98.16
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.14
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.14
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.13
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.12
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.11
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.1
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.09
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.08
PRK11189296 lipoprotein NlpI; Provisional 98.08
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.05
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.04
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.99
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.98
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.95
KOG0547606 consensus Translocase of outer mitochondrial membr 97.94
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.91
KOG1128777 consensus Uncharacterized conserved protein, conta 97.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.88
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.86
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.84
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.82
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.8
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.78
PRK04841 903 transcriptional regulator MalT; Provisional 97.77
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.74
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.71
PRK04841 903 transcriptional regulator MalT; Provisional 97.7
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.68
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.66
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.65
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.57
KOG1128777 consensus Uncharacterized conserved protein, conta 97.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.49
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.49
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.38
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.37
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.32
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.28
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.26
PRK10370198 formate-dependent nitrite reductase complex subuni 97.26
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.25
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.22
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.22
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.18
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.17
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.12
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.1
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.08
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.06
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.05
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.04
PRK15359144 type III secretion system chaperone protein SscB; 97.01
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.0
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.97
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.96
PRK10370198 formate-dependent nitrite reductase complex subuni 96.94
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.93
PRK15359144 type III secretion system chaperone protein SscB; 96.91
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.77
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.76
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.74
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.72
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 96.7
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.62
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.59
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.56
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.54
KOG1125579 consensus TPR repeat-containing protein [General f 96.49
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.49
PLN02789320 farnesyltranstransferase 96.48
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.42
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 96.41
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.36
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.34
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.33
KOG1125579 consensus TPR repeat-containing protein [General f 96.24
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.1
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.02
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.01
KOG3941 406 consensus Intermediate in Toll signal transduction 95.96
PLN02789320 farnesyltranstransferase 95.95
KOG3941 406 consensus Intermediate in Toll signal transduction 95.94
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 95.94
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.81
KOG0553304 consensus TPR repeat-containing protein [General f 95.77
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.74
KOG3060289 consensus Uncharacterized conserved protein [Funct 95.71
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.63
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.51
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 95.48
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.46
PF12688120 TPR_5: Tetratrico peptide repeat 95.36
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.32
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 95.27
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.99
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.98
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.94
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.88
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.79
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.75
KOG20411189 consensus WD40 repeat protein [General function pr 94.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.42
smart00299140 CLH Clathrin heavy chain repeat homology. 94.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.28
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.26
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.08
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 93.88
smart00299140 CLH Clathrin heavy chain repeat homology. 93.83
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.74
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 93.69
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.64
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.15
PF12688120 TPR_5: Tetratrico peptide repeat 93.08
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.04
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 93.01
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.82
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.8
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 92.76
KOG2796366 consensus Uncharacterized conserved protein [Funct 92.69
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 92.34
PRK10803263 tol-pal system protein YbgF; Provisional 92.34
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.27
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.27
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.23
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.22
KOG0553304 consensus TPR repeat-containing protein [General f 92.0
PF1337173 TPR_9: Tetratricopeptide repeat 91.95
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.93
PRK10803263 tol-pal system protein YbgF; Provisional 91.8
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 91.68
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.66
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.63
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.59
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 90.97
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 90.86
PF1337173 TPR_9: Tetratricopeptide repeat 90.73
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 90.58
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.35
PF13762145 MNE1: Mitochondrial splicing apparatus component 90.23
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.0
KOG4570 418 consensus Uncharacterized conserved protein [Funct 89.79
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.52
KOG4570 418 consensus Uncharacterized conserved protein [Funct 89.34
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.8
KOG1585308 consensus Protein required for fusion of vesicles 88.79
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 88.61
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.58
PRK15331165 chaperone protein SicA; Provisional 88.18
COG3629280 DnrI DNA-binding transcriptional activator of the 87.81
COG3898531 Uncharacterized membrane-bound protein [Function u 87.47
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.18
PRK11906458 transcriptional regulator; Provisional 87.05
PF13512142 TPR_18: Tetratricopeptide repeat 87.03
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.53
COG1729262 Uncharacterized protein conserved in bacteria [Fun 86.35
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.26
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 86.23
PRK15331165 chaperone protein SicA; Provisional 85.89
PF13929292 mRNA_stabil: mRNA stabilisation 85.07
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 85.0
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 84.8
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 84.6
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 84.35
KOG4555175 consensus TPR repeat-containing protein [Function 84.04
COG4700251 Uncharacterized protein conserved in bacteria cont 83.85
COG3629280 DnrI DNA-binding transcriptional activator of the 83.28
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.22
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 83.1
COG4235287 Cytochrome c biogenesis factor [Posttranslational 83.07
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 82.92
KOG4555175 consensus TPR repeat-containing protein [Function 82.89
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 81.87
COG4649221 Uncharacterized protein conserved in bacteria [Fun 81.68
PHA02875413 ankyrin repeat protein; Provisional 81.49
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 81.22
PF13762145 MNE1: Mitochondrial splicing apparatus component 81.18
PF11838324 ERAP1_C: ERAP1-like C-terminal domain; InterPro: I 80.89
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.58
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 80.54
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 80.13
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-58  Score=492.36  Aligned_cols=388  Identities=13%  Similarity=0.149  Sum_probs=360.0

Q ss_pred             HHHHHHHHHHHhhcC----ChHHHHHH---------------------HhcccChhhHHHHHHHHHHcCCChHHHHHHHH
Q 010739           84 EEFFEAIEELERMTR----EPSDILEE---------------------MNDRLSARELQLVLVYFSQEGRDSWCALEVFE  138 (502)
Q Consensus        84 ~~~~~a~~~~~~~~~----~~~~~~~~---------------------~~~~~~~~~~~~ll~~~~~~~~~~~~a~~~~~  138 (502)
                      +.+.+|+++|+.|..    .++.+...                     |.. +....|+.+|.+|++.|+. +.|.++|+
T Consensus       384 G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~-pd~~Tyn~LL~a~~k~g~~-e~A~~lf~  461 (1060)
T PLN03218        384 GRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRN-PTLSTFNMLMSVCASSQDI-DGALRVLR  461 (1060)
T ss_pred             cCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCC-CCHHHHHHHHHHHHhCcCH-HHHHHHHH
Confidence            349999999999982    23322221                     111 3344599999999999999 89999999


Q ss_pred             HHHHcC-CCChHHHHHHHHHHhhhhhhhhhhhccHhhHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHH
Q 010739          139 WLKKEN-RVDNETMELMVSIMCSWVKKYIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAV  217 (502)
Q Consensus       139 ~m~~~~-~~~~~~~~~li~~~~~~~~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~y~~li~~~~~~g~~~~A~~l~~~m  217 (502)
                      .|.+.| .||..+||++|.++|        +.|++++|.++|++|.+.|+.||..+||+||++|++.|++++|.++|++|
T Consensus       462 ~M~~~Gl~pD~~tynsLI~~y~--------k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M  533 (1060)
T PLN03218        462 LVQEAGLKADCKLYTTLISTCA--------KSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIM  533 (1060)
T ss_pred             HHHHcCCCCCHHHHHHHHHHHH--------hCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHH
Confidence            999999 999999999999999        99999999999999999999999999999999999999999999999999


Q ss_pred             HHcCCCCCCccccccCCCCchHHHHHHHHhCcHHHHHHHHHHHHH--cCCCCCHhHHHHHHHHHHhccccHHHHHHHHHH
Q 010739          218 LSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHLRE--SGLKPEVYSYLIALTAVVKELNEFGKALRKLKG  295 (502)
Q Consensus       218 ~~~~~~p~~~ty~~~~~~~~~~~~~~~~~~g~~~~a~~~~~~m~~--~g~~p~~~ty~~li~~~~~~~~~~~~a~~~~~~  295 (502)
                      .+.|+.||..||+.        ++.++++.|++++|.++|++|..  .|+.||.+||+++|.+|++. |++++|.++|++
T Consensus       534 ~~~Gv~PD~vTYns--------LI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~-G~ldeA~elf~~  604 (1060)
T PLN03218        534 RSKNVKPDRVVFNA--------LISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANA-GQVDRAKEVYQM  604 (1060)
T ss_pred             HHcCCCCCHHHHHH--------HHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHC-CCHHHHHHHHHH
Confidence            99999999999999        99999999999999999999986  58999999999999999999 899999999999


Q ss_pred             HHHcCCCCchhchHHHHHHHHhc-CcHHhHHHHHHHHHHcCCCCchHhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCC
Q 010739          296 YVRAGSIAELDGKNLGLIEKYQS-DLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEA  374 (502)
Q Consensus       296 m~~~g~~p~~~~~~~~li~~~~~-g~~~~a~~~~~~m~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p  374 (502)
                      |.+.|+.|+..+|+ .+|.+|++ |++++|.++|++|...|..+ |.++|+++|.+|++.|++++|.++|++|.+.|+.|
T Consensus       605 M~e~gi~p~~~tyn-sLI~ay~k~G~~deAl~lf~eM~~~Gv~P-D~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~p  682 (1060)
T PLN03218        605 IHEYNIKGTPEVYT-IAVNSCSQKGDWDFALSIYDDMKKKGVKP-DEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKL  682 (1060)
T ss_pred             HHHcCCCCChHHHH-HHHHHHHhcCCHHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCC
Confidence            99999999999999 79999999 99999999999999999776 56899999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q 010739          375 DGDLYDIVLAICASQNEGSAVSRLLSRIEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPEYMDRVAVLQ  454 (502)
Q Consensus       375 ~~~t~~~li~~~~~~~~~~~a~~l~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~  454 (502)
                      |..+|+++|.+|++.|++++|.++|++|...|+.||..+||.||.+|++.|++++|.++|++|.+.|+.||..||++++.
T Consensus       683 d~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~  762 (1060)
T PLN03218        683 GTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLV  762 (1060)
T ss_pred             CHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHccccccccHHHHHHHHhhhhhcCC-----chhHHHHH----HHhhcch
Q 010739          455 GLRKRIQQSGNVEAYLNLCKRLSDTSL-----IGPCLVYL----YIKKYKL  496 (502)
Q Consensus       455 ~~~~~~~~~~~~~~a~~~~~~m~~~~~-----~~~~li~~----y~~~g~~  496 (502)
                      +|++    .|++++|.+++.+|.+.|+     ++++|+.+    |.+++++
T Consensus       763 a~~k----~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l  809 (1060)
T PLN03218        763 ASER----KDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACAL  809 (1060)
T ss_pred             HHHH----CCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhh
Confidence            9998    8999999999999988875     56678766    4555544



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF11838 ERAP1_C: ERAP1-like C-terminal domain; InterPro: IPR024571 This entry represents the uncharacterised C-terminal domain of zinc metallopeptidases belonging to MEROPS peptidase family M1 (aminopeptidase N, clan MA), with a single member characterised in Streptomyces lividans: aminopeptidase G [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 54.1 bits (129), Expect = 8e-08
 Identities = 64/561 (11%), Positives = 151/561 (26%), Gaps = 160/561 (28%)

Query: 49  PSFIAT-KVSKIREF--RFLKSVELDQFVTSDDEDEMS---------------EEFFEAI 90
            +F+       +++     L   E+D  + S D    +               ++F E +
Sbjct: 27  DAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEV 86

Query: 91  ---------EELERMTREPSDILEE--------MND------------------RLSARE 115
                      ++   R+PS +            ND                  R +  E
Sbjct: 87  LRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLE 146

Query: 116 LQ---LVLVY----FSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVK--KYI 166
           L+    VL+         G+ +W AL+V    K + ++D +           W+      
Sbjct: 147 LRPAKNVLIDGVLGS---GK-TWVALDVCLSYKVQCKMDFKIF---------WLNLKNCN 193

Query: 167 EEERGVGDVVDLLVDMDCVGLKPGFSM---------IEKVISLYWEMEKKERAVL----- 212
             E  +  +  LL  +D                   I+  +    + +  E  +L     
Sbjct: 194 SPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNV 253

Query: 213 ----FVKA--------VLSRGIAYAEGDGEGQQGGPTGYLAWKMMVEGKYVDAIKLVIHL 260
                  A        + +R     +          +       +   +    +   +  
Sbjct: 254 QNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDC 313

Query: 261 RESGLKPEVYS---YLIAL-TAVVKE----LNEFGKALRKLKGYVRAGSIAELDGKNLGL 312
           R   L  EV +     +++    +++     + +          +   S+  L+      
Sbjct: 314 RPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEY-- 371

Query: 313 IEKYQSDL--LADGSRLSS------WAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQL 364
             K    L      + + +      W           +  + ++ +       L  E+Q 
Sbjct: 372 -RKMFDRLSVFPPSAHIPTILLSLIWF--------DVIKSDVMVVVNKLHKYSL-VEKQP 421

Query: 365 WEMKLVGKEADGDLYDIVLAICASQNEGSAV-SRLLSRIEVMNSLCKKKTLSWLLRGYIK 423
            E  +        +  I L +        A+   ++    +  +      +   L  Y  
Sbjct: 422 KESTIS-------IPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFY 474

Query: 424 ---GGHINDAAETLTKMLDLGLYPE-YMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDT 479
              G H+ +      + +   L+   ++D     + L ++I+               S  
Sbjct: 475 SHIGHHLKNI--EHPERMT--LFRMVFLD----FRFLEQKIRHDS-----TAWNASGSIL 521

Query: 480 SLIGPCLVYLYIKKYKLWIIK 500
           + +        +K YK +I  
Sbjct: 522 NTLQQ------LKFYKPYICD 536


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.9
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.86
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.82
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.8
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.78
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.77
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.74
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.68
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.67
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.65
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.65
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.62
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.61
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.6
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.59
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.58
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.55
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.54
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.54
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.54
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.54
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.53
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.39
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.39
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.39
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.32
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.3
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.26
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.24
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.24
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.24
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.22
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.21
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.2
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.15
3u4t_A272 TPR repeat-containing protein; structural genomics 99.13
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.13
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.12
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.12
3u4t_A272 TPR repeat-containing protein; structural genomics 99.12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.11
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.1
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.09
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.07
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.03
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.98
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.92
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.91
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.9
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.84
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.82
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.8
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.79
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.79
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.78
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.76
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.73
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.71
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.66
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.66
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.64
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.62
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.57
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.54
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.52
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.51
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.45
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.43
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.43
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.38
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.37
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.36
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.29
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.28
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.17
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.13
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.12
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.11
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.08
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.06
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.02
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.98
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.98
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.97
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.96
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.92
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.92
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.91
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.88
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.84
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.84
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.84
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.81
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.8
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.79
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.76
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.73
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.72
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.7
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.7
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.69
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.63
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.55
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.53
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.53
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.5
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.49
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.47
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.46
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.44
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.4
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.4
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.39
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.36
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.36
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.36
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.36
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.32
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.31
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.27
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.23
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.2
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.14
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.13
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.1
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.04
3k9i_A117 BH0479 protein; putative protein binding protein, 97.01
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.0
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.9
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.84
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.83
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.72
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.62
3k9i_A117 BH0479 protein; putative protein binding protein, 96.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.58
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.49
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.47
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.38
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.36
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.29
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.26
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.24
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.1
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.01
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.78
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.72
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.59
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.48
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.35
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.33
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.25
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.22
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.15
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.93
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.78
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.72
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.54
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 94.47
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.47
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.43
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.39
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.36
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 93.84
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.45
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.37
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 93.28
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.16
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.78
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 92.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.38
1pc2_A152 Mitochondria fission protein; unknown function; NM 91.25
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 90.81
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 90.6
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 90.22
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 90.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.13
1pc2_A152 Mitochondria fission protein; unknown function; NM 88.91
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.63
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 88.02
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 87.72
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 87.52
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 86.65
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.18
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.74
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.56
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 83.44
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 83.03
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 82.94
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 82.76
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 82.0
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.58
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=6.9e-33  Score=279.99  Aligned_cols=207  Identities=7%  Similarity=0.040  Sum_probs=135.7

Q ss_pred             ccHhhHHHHHHHHhhCCCCCCH-HHHHHHHHHHHhcCcHHHHHHHHHHHHHcCCCCCCccccccCCCCchHHHHHHHHh-
Q 010739          170 RGVGDVVDLLVDMDCVGLKPGF-SMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKMMVE-  247 (502)
Q Consensus       170 ~~~~~a~~~~~~m~~~g~~p~~-~~y~~li~~~~~~g~~~~A~~l~~~m~~~~~~p~~~ty~~~~~~~~~~~~~~~~~~-  247 (502)
                      +....+..+.+++.+.+..+.. ..++.+|++|+|.|++++|.++|++|.+.|+.||..|||+        ++..+... 
T Consensus         4 ~~~s~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~--------Li~~c~~~~   75 (501)
T 4g26_A            4 HMASPSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNV--------LLYVCSLAE   75 (501)
T ss_dssp             --------------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHH--------HHHHHTTCC
T ss_pred             cccchHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHH--------HHHHHHhCC
Confidence            3345566777788888875544 4689999999999999999999999999999999999999        88877764 


Q ss_pred             --------CcHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhccccHHHHHHHHHHHHHcCCCCchhchHHHHHHHHhc-
Q 010739          248 --------GKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELDGKNLGLIEKYQS-  318 (502)
Q Consensus       248 --------g~~~~a~~~~~~m~~~g~~p~~~ty~~li~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~~li~~~~~-  318 (502)
                              +.+++|.++|++|...|+.||..|||++|++|++. |++++|.++|++|.+.|+.||..||| .||.+|++ 
T Consensus        76 ~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~-g~~~~A~~l~~~M~~~g~~Pd~~tyn-~lI~~~~~~  153 (501)
T 4g26_A           76 AATESSPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARLAVAK-DDPEMAFDMVKQMKAFGIQPRLRSYG-PALFGFCRK  153 (501)
T ss_dssp             CCSSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHH-TCHHHHHHHHHHHHHTTCCCCHHHHH-HHHHHHHHT
T ss_pred             chhhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhc-CCHHHHHHHHHHHHHcCCCCccceeh-HHHHHHHHC
Confidence                    45899999999999999999999999999999999 89999999999999999988777554 34444444 


Q ss_pred             CcHHhHHHHHHHHHHcCCCCchHhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q 010739          319 DLLADGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEADGDLYDIVLAICA  387 (502)
Q Consensus       319 g~~~~a~~~~~~m~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~li~~~~  387 (502)
                      |++++|.++|++|...|..+ |..||++||.+|++.|++++|+++|++|++.|+.|+..||++++..|+
T Consensus       154 g~~~~A~~l~~~M~~~G~~P-d~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~  221 (501)
T 4g26_A          154 GDADKAYEVDAHMVESEVVP-EEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFK  221 (501)
T ss_dssp             TCHHHHHHHHHHHHHTTCCC-CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHhcCCCC-CHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHh
Confidence            44444444444444444333 234444444444444444444444444444444444444444444444



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.68
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.62
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.2
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.68
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.63
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.52
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.36
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.16
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.04
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.92
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.88
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.81
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.75
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.5
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.47
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.22
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.21
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.13
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.06
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.04
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.96
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.95
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.93
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.76
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.74
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.44
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.36
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.2
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.94
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.89
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 95.75
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.22
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.16
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 94.96
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 94.77
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.66
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.66
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 94.41
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.8
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.75
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.05
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.01
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.03
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 89.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 88.17
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 85.95
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 83.26
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 83.18
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 81.23
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=7.6e-13  Score=126.35  Aligned_cols=365  Identities=13%  Similarity=0.013  Sum_probs=241.4

Q ss_pred             HHHHHHHHHhhc-CChHHHHHHHhcccChhhHHHHHHHHHHcCCChHHHHHHHHHHHHcCCCChHHHHHHHHHHhhhhhh
Q 010739           86 FFEAIEELERMT-REPSDILEEMNDRLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENRVDNETMELMVSIMCSWVKK  164 (502)
Q Consensus        86 ~~~a~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~li~~~~~~~~~  164 (502)
                      +++|++.++++. ..|.          .+..+..+-..+.+.|++ ++|.+.|+...+..+-+..+|..+...+.     
T Consensus        15 ~~~A~~~~~~~l~~~p~----------~~~~~~~la~~~~~~~~~-~~A~~~~~~al~~~p~~~~a~~~l~~~~~-----   78 (388)
T d1w3ba_          15 FEAAERHCMQLWRQEPD----------NTGVLLLLSSIHFQCRRL-DRSAHFSTLAIKQNPLLAEAYSNLGNVYK-----   78 (388)
T ss_dssp             HHHHHHHHHHHHHHCTT----------CHHHHHHHHHHHHHTTCH-HHHHHHHHHHHHHCTTCHHHHHHHHHHHH-----
T ss_pred             HHHHHHHHHHHHHhCCC----------CHHHHHHHHHHHHHcCCH-HHHHHHHHHHHHhCCCCHHHHHHHHHHhh-----
Confidence            666666666654 2332          123355556666666777 67777777766655335556666666555     


Q ss_pred             hhhhhccHhhHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHcCCCCCCccccccCCCCchHHHHHH
Q 010739          165 YIEEERGVGDVVDLLVDMDCVGLKPGFSMIEKVISLYWEMEKKERAVLFVKAVLSRGIAYAEGDGEGQQGGPTGYLAWKM  244 (502)
Q Consensus       165 ~~~~~~~~~~a~~~~~~m~~~g~~p~~~~y~~li~~~~~~g~~~~A~~l~~~m~~~~~~p~~~ty~~~~~~~~~~~~~~~  244 (502)
                         ..|++++|...+....+... .+...+..........+....+..................+         ......
T Consensus        79 ---~~g~~~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~  145 (388)
T d1w3ba_          79 ---ERGQLQEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRS---------DLGNLL  145 (388)
T ss_dssp             ---HHTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHH---------HHHHHH
T ss_pred             ---hhcccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccc---------cccccc
Confidence               66777777777766665433 23334444444444444444444444444333322111000         022223


Q ss_pred             HHhCcHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhccccHHHHHHHHHHHHHcCCCCchh-chHHHHHHHHhc-CcHH
Q 010739          245 MVEGKYVDAIKLVIHLRESGLKPEVYSYLIALTAVVKELNEFGKALRKLKGYVRAGSIAELD-GKNLGLIEKYQS-DLLA  322 (502)
Q Consensus       245 ~~~g~~~~a~~~~~~m~~~g~~p~~~ty~~li~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~-~~~~~li~~~~~-g~~~  322 (502)
                      ...+....+...+....... +-+...+..+...+... ++.++|...+.+..+.  .|+.. .+. .+...+.. |+++
T Consensus       146 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~-~~~~~A~~~~~~al~~--~p~~~~~~~-~l~~~~~~~~~~~  220 (388)
T d1w3ba_         146 KALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQ-GEIWLAIHHFEKAVTL--DPNFLDAYI-NLGNVLKEARIFD  220 (388)
T ss_dssp             HTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTT-TCHHHHHHHHHHHHHH--CTTCHHHHH-HHHHHHHTTTCTT
T ss_pred             cccchhhhhHHHHHHhhccC-cchhHHHHhhccccccc-CcHHHHHHHHHHHHHh--CcccHHHHH-HHhhhhhccccHH
Confidence            33577777777777766542 22345666677777777 7899999999887553  34433 333 56677888 9999


Q ss_pred             hHHHHHHHHHHcCCCCchHhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCC-CHHHHHHHHHHHHhcCChhHHHHHHHH
Q 010739          323 DGSRLSSWAIQEGGSSLYGVVHERLLAMYICAGRGLEAERQLWEMKLVGKEA-DGDLYDIVLAICASQNEGSAVSRLLSR  401 (502)
Q Consensus       323 ~a~~~~~~m~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p-~~~t~~~li~~~~~~~~~~~a~~l~~~  401 (502)
                      +|...+++.........  ..+..+...+.+.|++++|...|++..+.  .| +...+..+...+...|+.++|.+.++.
T Consensus       221 ~A~~~~~~~~~~~~~~~--~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~  296 (388)
T d1w3ba_         221 RAVAAYLRALSLSPNHA--VVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEAEDCYNT  296 (388)
T ss_dssp             HHHHHHHHHHHHCTTCH--HHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHH
T ss_pred             HHHHHHHHhHHHhhhHH--HHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHh
Confidence            99999998887665543  48888889999999999999999998764  34 456788888999999999999999988


Q ss_pred             HHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHccccccccHHHHHHHHhhhhhcC
Q 010739          402 IEVMNSLCKKKTLSWLLRGYIKGGHINDAAETLTKMLDLGLYPE-YMDRVAVLQGLRKRIQQSGNVEAYLNLCKRLSDTS  480 (502)
Q Consensus       402 m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~-~~t~~~ll~~~~~~~~~~~~~~~a~~~~~~m~~~~  480 (502)
                      ..... ..+...+..+...|.+.|++++|.+.|++.++.  .|+ ..++..+-..+..    .|+.++|...+++..+..
T Consensus       297 ~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~----~g~~~~A~~~~~~al~l~  369 (388)
T d1w3ba_         297 ALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQ----QGKLQEALMHYKEAIRIS  369 (388)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHT----TTCCHHHHHHHHHHHTTC
T ss_pred             hhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHH----cCCHHHHHHHHHHHHHhC
Confidence            76654 456778888999999999999999999998764  454 4556666667766    799999999998875422


Q ss_pred             C----chhHHHHHHHhhcc
Q 010739          481 L----IGPCLVYLYIKKYK  495 (502)
Q Consensus       481 ~----~~~~li~~y~~~g~  495 (502)
                      .    ....+-.+|.+.||
T Consensus       370 P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         370 PTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TTCHHHHHHHHHHHHHTCC
T ss_pred             CCCHHHHHHHHHHHHHcCC
Confidence            1    22334455555543



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure