Citrus Sinensis ID: 010807


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500
MALTNLSPYSLRLSTLSSSSASSSSSSSSSSFNQSSSQNYNFTHRHIPLSLRTRPRTGICCVWTRPRSKRGRKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSSSLAGSQSGSAKTDLTRSLSTAKS
ccccccccHHHHHHHHHcccccccHHHHHHHHHccccccccccHHcccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccc
cccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccc
maltnlspysLRLSTlssssassssssssssfnqsssqnynfthrhiplslrtrprtgiccvwtrprskrgrkseeLESKELVRVLMRsfsdkeplvRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEmrnsgcrpdpsvYNALITAHLHTRDKAKALAKALGYFQkmkgmerckpnIVTYNILLRACAQARNVDQVNALFKELHEsilapdiytyngvmdaygkngmIKEMESVLSRMksnqckpdiiTFNLLIDSYGKRQAFDKMEQVFKSLMhskekptlptfnsMIINYGKARLQGKAEYVFQKMtamkytpsfiTYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLfenshnmgvtpdsstYKLLYKAYTKANMKELVQKLLKRMeqngivpnkRFFLEALETFssslagsqsgsaktdltrslstaks
maltnlspysLRLSTLSSSSASSSSSSSSSSFNQSSSQNYNFTHrhiplslrtrprtgiccvwtrprskrgrkseeleskELVRVLmrsfsdkeplvrTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHEsilapdiytYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMhskekptlptfNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNmgvtpdsstYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSsslagsqsgsaktdltrslstaks
MALTNlspyslrlstlssssassssssssssfnqsssQNYNFTHRHIPLSLRTRPRTGICCVWTRPRSKRGRKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFssslagsqsgsaKTDLTRSLSTAKS
****************************************NFTHRHIPLSLRTRPRTGICCVWT******************VRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLM******TLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALET**************************
*ALTNLSPYSLRLSTLSSSSASSSSSSSSSSFNQSSSQNYNFTHRHIPLSLRTRPRTGICCVWTRPRSKRGRKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSSSLAGSQSGSAKTDLTRSLS****
MALTNLSPYSLRL*************************NYNFTHRHIPLSLRTRPRTGICCVWTRP***********ESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSS***********************
*ALTNLSPYSLRLSTLSSSSASSSSSSSSSSFNQSSSQNYNFTHRHIPLSLRTRPRTGICCVWTRPRSKRGRKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSSSLAGSQSGSAKTDLTRS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALTNLSPYSLRLSTLSSSSASSSSSSSSSSFNQSSSQNYNFTHRHIPLSLRTRPRTGICCVWTRPRSKRGRKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSSSLAGSQSGSAKTDLTRSLSTAKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query500 2.2.26 [Sep-21-2011]
Q9SV96563 Pentatricopeptide repeat- yes no 0.866 0.769 0.735 0.0
Q9SQU6486 Pentatricopeptide repeat- no no 0.696 0.716 0.294 1e-43
Q9SCP4447 Pentatricopeptide repeat- no no 0.716 0.800 0.283 2e-42
Q9S7Q2 862 Pentatricopeptide repeat- no no 0.804 0.466 0.262 1e-41
Q9FKC3508 Pentatricopeptide repeat- no no 0.666 0.655 0.286 2e-40
Q8RWS8 822 Pentatricopeptide repeat- no no 0.942 0.572 0.234 1e-34
Q9LYZ9 819 Pentatricopeptide repeat- no no 0.722 0.440 0.252 4e-34
Q5G1S8 1440 Pentatricopeptide repeat- no no 0.718 0.249 0.237 2e-33
P0C7Q7602 Putative pentatricopeptid no no 0.65 0.539 0.293 5e-33
Q6NQ83619 Pentatricopeptide repeat- no no 0.678 0.547 0.267 1e-32
>sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 Back     alignment and function desciption
 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/434 (73%), Positives = 363/434 (83%), Gaps = 1/434 (0%)

Query: 52  RTRPRTGICCVWTRPRSKRG-RKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSE 110
           R   RT I C     R K   R+S E E++ LVR LM   SD+EPLV+TL+KYVKVVR +
Sbjct: 39  RRSTRTRITCGAISSRRKLAERESAERENRVLVRSLMSRISDREPLVKTLDKYVKVVRCD 98

Query: 111 HCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSE 170
           HCFLLFEELGKSDKWLQCLEVFRWMQKQRWYI D G+YSKLI+VMGKKGQTR+AMWLFSE
Sbjct: 99  HCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIPDNGVYSKLISVMGKKGQTRMAMWLFSE 158

Query: 171 MRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRAC 230
           M+NSGCRPD SVYNALITAHLHTRDKAKAL K  GY  KMKG+ERC+PN+VTYNILLRA 
Sbjct: 159 MKNSGCRPDASVYNALITAHLHTRDKAKALEKVRGYLDKMKGIERCQPNVVTYNILLRAF 218

Query: 231 AQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDI 290
           AQ+  VDQVNALFK+L  S ++PD+YT+NGVMDAYGKNGMIKEME+VL+RM+SN+CKPDI
Sbjct: 219 AQSGKVDQVNALFKDLDMSPVSPDVYTFNGVMDAYGKNGMIKEMEAVLTRMRSNECKPDI 278

Query: 291 ITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQK 350
           ITFN+LIDSYGK+Q F+KMEQ FKSLM SKEKPTLPTFNSMIINYGKAR+  KAE+VF+K
Sbjct: 279 ITFNVLIDSYGKKQEFEKMEQTFKSLMRSKEKPTLPTFNSMIINYGKARMIDKAEWVFKK 338

Query: 351 MTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGL 410
           M  M Y PSFITYEC+I MYGYC +VSRAREIF+E+ +  + +K STLNAMLE YC NGL
Sbjct: 339 MNDMNYIPSFITYECMIMMYGYCGSVSRAREIFEEVGESDRVLKASTLNAMLEVYCRNGL 398

Query: 411 PTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLE 470
             EAD LF N+    V PD+STYK LYKAYTKA+MKE VQ L+K+ME++GIVPNKRFFLE
Sbjct: 399 YIEADKLFHNASAFRVHPDASTYKFLYKAYTKADMKEQVQILMKKMEKDGIVPNKRFFLE 458

Query: 471 ALETFSSSLAGSQS 484
           ALE F S L GS S
Sbjct: 459 ALEVFGSRLPGSGS 472




May play a role in embryogenesis.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SQU6|PP216_ARATH Pentatricopeptide repeat-containing protein At3g06430, chloroplastic OS=Arabidopsis thaliana GN=EMB2750 PE=2 SV=1 Back     alignment and function description
>sp|Q9SCP4|PP279_ARATH Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKC3|PP424_ARATH Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 Back     alignment and function description
>sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 Back     alignment and function description
>sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query500
255582522478 pentatricopeptide repeat-containing prot 0.934 0.976 0.722 0.0
225438599489 PREDICTED: pentatricopeptide repeat-cont 0.946 0.967 0.732 0.0
224081220416 predicted protein [Populus trichocarpa] 0.832 1.0 0.757 0.0
356511125503 PREDICTED: pentatricopeptide repeat-cont 0.866 0.860 0.727 0.0
356528509580 PREDICTED: pentatricopeptide repeat-cont 0.874 0.753 0.726 0.0
15235161563 pentatricopeptide repeat-containing prot 0.866 0.769 0.735 0.0
334187332510 pentatricopeptide repeat-containing prot 0.866 0.849 0.735 0.0
449451631528 PREDICTED: pentatricopeptide repeat-cont 0.888 0.840 0.706 0.0
449525698494 PREDICTED: pentatricopeptide repeat-cont 0.864 0.874 0.724 0.0
357519615 635 Pentatricopeptide repeat-containing prot 0.9 0.708 0.684 0.0
>gi|255582522|ref|XP_002532046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528289|gb|EEF30336.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/493 (72%), Positives = 419/493 (84%), Gaps = 26/493 (5%)

Query: 5   NLSPYSLRLSTLSSSSASSSSSSSSSSFNQSSSQNYNFTHRHIPLSLRTRP-----RTGI 59
           NLSP+SL+LS L SS+ ++                 NF   H P +L   P     +T I
Sbjct: 4   NLSPHSLQLSPLGSSNFTN-----------------NFPQIHNP-TLSWHPCKNLRQTHI 45

Query: 60  CCVWTRPRSKRGRKSEELESKELVRVLMRSFS-DKEPLVRTLNKYVKVVRSEHCFLLFEE 118
            CV TRPR KR   SEE E+++LVR ++RSFS DK PLVRTL+KYV+VVR+EHCFLLFEE
Sbjct: 46  TCVSTRPRKKRFPISEESETEDLVRYVLRSFSSDKVPLVRTLDKYVRVVRTEHCFLLFEE 105

Query: 119 LGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRP 178
           LG+ DKWLQCLEVFRWMQKQRWYIAD+G+YSKLI+VMGKKGQTR+AMWLFSEMRNSGCRP
Sbjct: 106 LGRRDKWLQCLEVFRWMQKQRWYIADSGVYSKLISVMGKKGQTRMAMWLFSEMRNSGCRP 165

Query: 179 DPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQ 238
           D SVYNALITAHLH++DKAKAL KALGYF+KMKGM+RC+PN+VTYNILLRA AQARNV+Q
Sbjct: 166 DSSVYNALITAHLHSKDKAKALIKALGYFEKMKGMQRCQPNVVTYNILLRAFAQARNVNQ 225

Query: 239 VNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLID 298
           VNALFK+L +SI++PDIYTYNGVMDAYGKNGMI+EMESVLSRMKSNQCKPDIITFNLLID
Sbjct: 226 VNALFKDLDQSIVSPDIYTYNGVMDAYGKNGMIREMESVLSRMKSNQCKPDIITFNLLID 285

Query: 299 SYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTP 358
           SYGK+Q FDKMEQVFKSL+HSKE+PTLPTFNSMI NYGKAR +  AE V QKMT MKYTP
Sbjct: 286 SYGKKQDFDKMEQVFKSLLHSKERPTLPTFNSMITNYGKARQKENAESVLQKMTKMKYTP 345

Query: 359 SFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLF 418
           +FITYE +I MYG+CD+VS+AREIFD++ + GK++KVSTLNAML+ YC+NGLP EADLLF
Sbjct: 346 NFITYESLIMMYGFCDSVSKAREIFDDMIESGKEVKVSTLNAMLDVYCLNGLPMEADLLF 405

Query: 419 ENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSS- 477
           +N+ N+G+ PDS+TYKLLYKAYTKANMK+LVQKLLK M+++GI+PNKRFFL+AL  F S 
Sbjct: 406 DNARNVGLLPDSTTYKLLYKAYTKANMKKLVQKLLKHMDRDGIIPNKRFFLDALGAFKSL 465

Query: 478 -SLAGSQSGSAKT 489
            + +G+Q  +AKT
Sbjct: 466 PASSGNQQNNAKT 478




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438599|ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Vitis vinifera] gi|296082481|emb|CBI21486.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224081220|ref|XP_002306340.1| predicted protein [Populus trichocarpa] gi|222855789|gb|EEE93336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511125|ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356528509|ref|XP_003532845.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15235161|ref|NP_195672.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75266408|sp|Q9SV96.1|PP358_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g39620, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2453; Flags: Precursor gi|5042178|emb|CAB44697.1| putative protein [Arabidopsis thaliana] gi|7270946|emb|CAB80625.1| putative protein [Arabidopsis thaliana] gi|58013022|gb|AAW62964.1| chloroplast embryo-defective 2453 [Arabidopsis thaliana] gi|332661694|gb|AEE87094.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334187332|ref|NP_001190970.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332661695|gb|AEE87095.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449451631|ref|XP_004143565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525698|ref|XP_004169853.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357519615|ref|XP_003630096.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524118|gb|AET04572.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query500
TAIR|locus:2122561563 EMB2453 "EMBRYO DEFECTIVE 2453 0.848 0.753 0.738 1.5e-168
TAIR|locus:2081041486 PPR2 "pentatricopeptide repeat 0.696 0.716 0.300 1.3e-43
TAIR|locus:2027166 862 PTAC2 "plastid transcriptional 0.794 0.460 0.275 7.9e-40
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.692 0.422 0.253 2.2e-34
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.684 0.552 0.272 1.6e-31
TAIR|locus:2054331 822 EMB2654 "EMBRYO DEFECTIVE 2654 0.784 0.476 0.262 2.8e-30
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.654 0.532 0.277 3.2e-30
TAIR|locus:2027212 855 AT1G74750 [Arabidopsis thalian 0.64 0.374 0.252 5e-30
TAIR|locus:2116772 1112 PGR3 "AT4G31850" [Arabidopsis 0.686 0.308 0.276 3.6e-29
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.63 0.545 0.256 2.4e-28
TAIR|locus:2122561 EMB2453 "EMBRYO DEFECTIVE 2453" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1639 (582.0 bits), Expect = 1.5e-168, P = 1.5e-168
 Identities = 314/425 (73%), Positives = 358/425 (84%)

Query:    52 RTRPRTGICCVWTRPRSKRG-RKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSE 110
             R   RT I C     R K   R+S E E++ LVR LM   SD+EPLV+TL+KYVKVVR +
Sbjct:    39 RRSTRTRITCGAISSRRKLAERESAERENRVLVRSLMSRISDREPLVKTLDKYVKVVRCD 98

Query:   111 HCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSE 170
             HCFLLFEELGKSDKWLQCLEVFRWMQKQRWYI D G+YSKLI+VMGKKGQTR+AMWLFSE
Sbjct:    99 HCFLLFEELGKSDKWLQCLEVFRWMQKQRWYIPDNGVYSKLISVMGKKGQTRMAMWLFSE 158

Query:   171 MRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRAC 230
             M+NSGCRPD SVYNALITAHLHTRDKAKAL K  GY  KMKG+ERC+PN+VTYNILLRA 
Sbjct:   159 MKNSGCRPDASVYNALITAHLHTRDKAKALEKVRGYLDKMKGIERCQPNVVTYNILLRAF 218

Query:   231 AQARNVDQVNALFKELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDI 290
             AQ+  VDQVNALFK+L  S ++PD+YT+NGVMDAYGKNGMIKEME+VL+RM+SN+CKPDI
Sbjct:   219 AQSGKVDQVNALFKDLDMSPVSPDVYTFNGVMDAYGKNGMIKEMEAVLTRMRSNECKPDI 278

Query:   291 ITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQK 350
             ITFN+LIDSYGK+Q F+KMEQ FKSLM SKEKPTLPTFNSMIINYGKAR+  KAE+VF+K
Sbjct:   279 ITFNVLIDSYGKKQEFEKMEQTFKSLMRSKEKPTLPTFNSMIINYGKARMIDKAEWVFKK 338

Query:   351 MTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGL 410
             M  M Y PSFITYEC+I MYGYC +VSRAREIF+E+ +  + +K STLNAMLE YC NGL
Sbjct:   339 MNDMNYIPSFITYECMIMMYGYCGSVSRAREIFEEVGESDRVLKASTLNAMLEVYCRNGL 398

Query:   411 PTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLE 470
               EAD LF N+    V PD+STYK LYKAYTKA+MKE VQ L+K+ME++GIVPNKRFFLE
Sbjct:   399 YIEADKLFHNASAFRVHPDASTYKFLYKAYTKADMKEQVQILMKKMEKDGIVPNKRFFLE 458

Query:   471 ALETF 475
             ALE F
Sbjct:   459 ALEVF 463




GO:0009507 "chloroplast" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
TAIR|locus:2081041 PPR2 "pentatricopeptide repeat 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054331 EMB2654 "EMBRYO DEFECTIVE 2654" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027212 AT1G74750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SV96PP358_ARATHNo assigned EC number0.73500.8660.7690yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019417001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (489 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query500
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-20
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-13
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-09
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-07
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.001
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 93.0 bits (231), Expect = 6e-20
 Identities = 87/343 (25%), Positives = 155/343 (45%), Gaps = 18/343 (5%)

Query: 129 LEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALIT 188
           L V R +Q +    AD  +Y+ LI+   K G+      +F EM N+G   +   + ALI 
Sbjct: 457 LRVLRLVQ-EAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALID 515

Query: 189 AHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQ---VNALFKE 245
                  +A  +AKA G +  M+  +  KP+ V +N L+ AC Q+  VD+   V A  K 
Sbjct: 516 GC----ARAGQVAKAFGAYGIMRS-KNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKA 570

Query: 246 LHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQA 305
               I  PD  T   +M A    G +   + V   +     K     + + ++S  ++  
Sbjct: 571 ETHPID-PDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGD 629

Query: 306 FDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYEC 365
           +D    ++  +     KP    F++++   G A    KA  + Q           ++Y  
Sbjct: 630 WDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYS- 688

Query: 366 IITMYGYCDNV---SRAREIFDELSKLGKDMKVSTLNAMLEAYC-MNGLPTEADLLFENS 421
             ++ G C N     +A E+++++  +     VST+NA++ A C  N LP   ++L E  
Sbjct: 689 --SLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSE-M 745

Query: 422 HNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPN 464
             +G+ P++ TY +L  A  + +  ++   LL + +++GI PN
Sbjct: 746 KRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPN 788


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 500
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.83
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.83
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.76
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.75
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.74
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.72
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.66
PRK14574 822 hmsH outer membrane protein; Provisional 99.66
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.66
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
KOG1126638 consensus DNA-binding cell division cycle control 99.59
KOG2076 895 consensus RNA polymerase III transcription factor 99.59
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.57
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.56
KOG2076 895 consensus RNA polymerase III transcription factor 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.55
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.55
KOG2003 840 consensus TPR repeat-containing protein [General f 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG2003 840 consensus TPR repeat-containing protein [General f 99.52
PRK12370553 invasion protein regulator; Provisional 99.43
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.41
KOG0547606 consensus Translocase of outer mitochondrial membr 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.38
PRK12370553 invasion protein regulator; Provisional 99.38
KOG1129478 consensus TPR repeat-containing protein [General f 99.36
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.35
PF1304150 PPR_2: PPR repeat family 99.35
KOG1915677 consensus Cell cycle control protein (crooked neck 99.33
KOG1129478 consensus TPR repeat-containing protein [General f 99.31
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.3
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.3
PF1304150 PPR_2: PPR repeat family 99.3
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.3
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.28
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.24
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.22
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.19
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.19
PRK11189296 lipoprotein NlpI; Provisional 99.16
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
PRK11189296 lipoprotein NlpI; Provisional 99.13
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.11
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.1
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.1
KOG0547606 consensus Translocase of outer mitochondrial membr 99.1
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.06
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.02
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.01
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.97
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.97
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.92
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.88
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.87
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.87
PRK04841 903 transcriptional regulator MalT; Provisional 98.84
KOG2376652 consensus Signal recognition particle, subunit Srp 98.83
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.79
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.79
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.78
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.78
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.77
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.76
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.74
KOG1125579 consensus TPR repeat-containing protein [General f 98.73
KOG1125579 consensus TPR repeat-containing protein [General f 98.72
PLN02789320 farnesyltranstransferase 98.72
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.71
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.7
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.69
PF1285434 PPR_1: PPR repeat 98.68
PF1285434 PPR_1: PPR repeat 98.67
PLN02789320 farnesyltranstransferase 98.64
PRK04841 903 transcriptional regulator MalT; Provisional 98.62
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.62
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.6
KOG1128777 consensus Uncharacterized conserved protein, conta 98.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.56
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.56
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.54
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.53
PRK10370198 formate-dependent nitrite reductase complex subuni 98.53
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.5
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.5
PRK10370198 formate-dependent nitrite reductase complex subuni 98.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.45
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.43
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.42
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.42
PRK15359144 type III secretion system chaperone protein SscB; 98.4
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.39
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.38
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.38
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.36
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.34
PRK15359144 type III secretion system chaperone protein SscB; 98.33
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.33
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.33
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.29
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.26
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.21
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.2
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.12
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.11
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.1
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.1
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.1
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.09
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.07
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.05
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.02
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.98
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.95
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.95
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.79
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.79
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.79
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.79
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.77
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.75
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.74
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.71
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.69
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.68
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.66
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.66
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.65
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.56
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.54
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.52
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.5
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.48
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.48
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.48
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.47
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.44
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.43
KOG0553304 consensus TPR repeat-containing protein [General f 97.41
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.4
KOG0553304 consensus TPR repeat-containing protein [General f 97.33
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.3
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.29
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.24
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.22
PF12688120 TPR_5: Tetratrico peptide repeat 97.19
KOG20411189 consensus WD40 repeat protein [General function pr 97.16
PF12688120 TPR_5: Tetratrico peptide repeat 97.14
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.13
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.12
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.07
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.96
KOG20411189 consensus WD40 repeat protein [General function pr 96.96
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.95
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.92
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.89
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.88
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.87
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.85
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.85
COG3898531 Uncharacterized membrane-bound protein [Function u 96.85
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.83
PRK10803263 tol-pal system protein YbgF; Provisional 96.79
COG4700251 Uncharacterized protein conserved in bacteria cont 96.78
COG4700251 Uncharacterized protein conserved in bacteria cont 96.78
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.78
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.78
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.73
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.62
PRK10803263 tol-pal system protein YbgF; Provisional 96.58
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.52
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.46
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.43
PF1337173 TPR_9: Tetratricopeptide repeat 96.41
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.34
PRK15331165 chaperone protein SicA; Provisional 96.31
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.31
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.28
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.24
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.23
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.22
PRK15331165 chaperone protein SicA; Provisional 96.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.2
COG3898531 Uncharacterized membrane-bound protein [Function u 96.16
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.13
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.09
PF1337173 TPR_9: Tetratricopeptide repeat 96.05
KOG3941406 consensus Intermediate in Toll signal transduction 96.03
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.99
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.97
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.91
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.89
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.79
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.78
smart00299140 CLH Clathrin heavy chain repeat homology. 95.72
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.63
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.61
KOG3941406 consensus Intermediate in Toll signal transduction 95.6
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.55
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.53
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.42
KOG1585308 consensus Protein required for fusion of vesicles 95.39
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.39
smart00299140 CLH Clathrin heavy chain repeat homology. 95.38
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.76
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.75
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 94.72
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.71
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.6
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.6
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.58
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.31
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.3
PF13929292 mRNA_stabil: mRNA stabilisation 94.26
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.22
KOG4555175 consensus TPR repeat-containing protein [Function 94.21
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.21
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.17
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.16
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.14
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.97
PF13512142 TPR_18: Tetratricopeptide repeat 93.96
COG3629280 DnrI DNA-binding transcriptional activator of the 93.9
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.8
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.21
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.21
KOG4555175 consensus TPR repeat-containing protein [Function 93.2
COG3629280 DnrI DNA-binding transcriptional activator of the 93.04
KOG2610491 consensus Uncharacterized conserved protein [Funct 93.01
PF13512142 TPR_18: Tetratricopeptide repeat 92.94
PRK11906458 transcriptional regulator; Provisional 92.67
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.63
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.62
KOG4570 418 consensus Uncharacterized conserved protein [Funct 92.47
PF1342844 TPR_14: Tetratricopeptide repeat 92.42
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.38
KOG1258577 consensus mRNA processing protein [RNA processing 92.37
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.31
KOG1585308 consensus Protein required for fusion of vesicles 92.17
PF1342844 TPR_14: Tetratricopeptide repeat 92.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.12
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.91
KOG1550552 consensus Extracellular protein SEL-1 and related 91.82
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 91.74
KOG1550552 consensus Extracellular protein SEL-1 and related 91.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.4
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.2
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.77
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.71
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.63
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.59
KOG4570 418 consensus Uncharacterized conserved protein [Funct 90.55
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 90.53
PRK11906458 transcriptional regulator; Provisional 90.45
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.96
COG3947361 Response regulator containing CheY-like receiver a 88.92
PF13929292 mRNA_stabil: mRNA stabilisation 88.64
PF1343134 TPR_17: Tetratricopeptide repeat 88.43
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.26
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.76
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.73
PF1343134 TPR_17: Tetratricopeptide repeat 86.61
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.55
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 86.21
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 86.2
COG4455 273 ImpE Protein of avirulence locus involved in tempe 86.1
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.7
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 85.63
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.57
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 85.29
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.26
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.98
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.94
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.9
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.47
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 84.22
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 83.98
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.58
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 83.45
COG1747 711 Uncharacterized N-terminal domain of the transcrip 82.67
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 82.5
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 81.88
KOG1586288 consensus Protein required for fusion of vesicles 81.56
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 81.53
KOG0687393 consensus 26S proteasome regulatory complex, subun 80.38
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.36
KOG4648 536 consensus Uncharacterized conserved protein, conta 80.21
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.1e-58  Score=476.51  Aligned_cols=398  Identities=21%  Similarity=0.331  Sum_probs=366.1

Q ss_pred             CCccchhHHHHHHHHHHhcC-CCchH--HHHHHHhhhccCcch---------------HHHHHHHHcccCCHHHHHHHHH
Q 010807           72 RKSEELESKELVRVLMRSFS-DKEPL--VRTLNKYVKVVRSEH---------------CFLLFEELGKSDKWLQCLEVFR  133 (500)
Q Consensus        72 ~~~~~~~a~~l~~~l~~~~~-~~~~~--~~~l~~~~~~~~~~~---------------~~~l~~~l~~~~~~~~A~~~~~  133 (500)
                      +.|...+|..+++.|.+... .....  ..++..+.+.+..++               +..++..+.+.|+++.|+++|+
T Consensus       382 r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a~~k~g~~e~A~~lf~  461 (1060)
T PLN03218        382 RDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSVCASSQDIDGALRVLR  461 (1060)
T ss_pred             HCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHHHHhCcCHHHHHHHHH
Confidence            45677888999998876531 11111  223344444433333               3456777888999999999999


Q ss_pred             HHHHccCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHcCcchHHHHHHHHHHHHHhhcC
Q 010807          134 WMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGM  213 (500)
Q Consensus       134 ~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~~~~~~~~~~a~~~~~~~~~~  213 (500)
                      .|.+.+ +.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|+    +.|++++|+++|++|.. 
T Consensus       462 ~M~~~G-l~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~----k~G~~eeAl~lf~~M~~-  535 (1060)
T PLN03218        462 LVQEAG-LKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCA----RAGQVAKAFGAYGIMRS-  535 (1060)
T ss_pred             HHHHcC-CCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHH----HCcCHHHHHHHHHHHHH-
Confidence            999987 899999999999999999999999999999999999999999999999999    77889999999999987 


Q ss_pred             CCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHh--CCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHHHHhCCCCCCHH
Q 010807          214 ERCKPNIVTYNILLRACAQARNVDQVNALFKELHE--SILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDII  291 (500)
Q Consensus       214 ~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~--~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~~~~~  291 (500)
                      .++.||..+|+.||.+|++.|++++|.++|++|..  .|+.||..+|+++|.+|++.|++++|.++|++|.+.|+.|+..
T Consensus       536 ~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~  615 (1060)
T PLN03218        536 KNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPE  615 (1060)
T ss_pred             cCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChH
Confidence            78999999999999999999999999999999976  6799999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHhHHHHHHHHHHhCCCCCCHHHHHHHHHHHh
Q 010807          292 TFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYG  371 (500)
Q Consensus       292 ~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~  371 (500)
                      +|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|+.++|.++++.|.+.|+.||..+|+.+|.+|+
T Consensus       616 tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~  695 (1060)
T PLN03218        616 VYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACS  695 (1060)
T ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChhhHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHH
Q 010807          372 YCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAYCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQK  451 (500)
Q Consensus       372 ~~~~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~~  451 (500)
                      +.|++++|.++|++|.+.|+.||..+||.||.+|++.|++++|.++|++|...|+.||..||+.++.+|.+.|++++|.+
T Consensus       696 k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~G~le~A~~  775 (1060)
T PLN03218        696 NAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLD  775 (1060)
T ss_pred             hCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHH
Q 010807          452 LLKRMEQNGIVPNKRFFLEALETF  475 (500)
Q Consensus       452 ~~~~m~~~g~~p~~~~~~~ll~~~  475 (500)
                      ++++|.+.|+.||..+|..++..|
T Consensus       776 l~~~M~k~Gi~pd~~tynsLIglc  799 (1060)
T PLN03218        776 LLSQAKEDGIKPNLVMCRCITGLC  799 (1060)
T ss_pred             HHHHHHHcCCCCCHHHHHHHHHHH
Confidence            999999999999999999998654



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query500
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 78.3 bits (191), Expect = 2e-15
 Identities = 34/262 (12%), Positives = 76/262 (29%), Gaps = 20/262 (7%)

Query: 122 SDKWLQCLEVFRWMQKQR-----------WYIADTGIYSKLIAVMGKKGQTRLAMWLFSE 170
             +W + LE  +  Q+ R           +   +    ++ + V  +    ++A  L   
Sbjct: 23  CGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDC 82

Query: 171 MRNSGCRPDPSVYNALITAHLHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRAC 230
            R +   P       L+             A             +            + C
Sbjct: 83  TRQAPESPWEEQLARLLQEAPGKLSLDVEQA-----PSGQHSQAQLSGQQQRLLAFFKCC 137

Query: 231 AQARNVDQVNALFKELHESI---LAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCK 287
                +   + L    H          +  YN VM  + + G  KE+  VL  +K     
Sbjct: 138 LLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLT 197

Query: 288 PDIITFNLLIDSYGKR-QAFDKMEQVFKSLMHSKEKPTLPTFNSMIINYGKARLQGKAEY 346
           PD++++   +   G++ Q    +E+  + +     K        ++    +A +      
Sbjct: 198 PDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHK 257

Query: 347 VFQKMTAMKYTPSFITYECIIT 368
           V    +     P  +    ++ 
Sbjct: 258 VKPTFSLPPQLPPPVNTSKLLR 279


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query500
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.76
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.63
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.61
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.59
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.59
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
3u4t_A272 TPR repeat-containing protein; structural genomics 99.56
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.56
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.56
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.51
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.49
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.47
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.46
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.45
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.37
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.29
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.28
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.0
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.0
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.98
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.97
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.94
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.94
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.93
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.89
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.85
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.85
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.73
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.7
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.66
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.65
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.6
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.57
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.57
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.56
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.55
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.55
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.52
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.49
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.49
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.49
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.47
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.46
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.45
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.45
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.43
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.39
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.39
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.37
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.34
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.33
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.32
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.3
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.28
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.27
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.27
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.2
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.2
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.16
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.04
3k9i_A117 BH0479 protein; putative protein binding protein, 98.01
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.01
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.0
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.96
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.95
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.94
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.9
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.85
3k9i_A117 BH0479 protein; putative protein binding protein, 97.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.84
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.83
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.83
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.79
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.78
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.77
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.75
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.54
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.5
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.39
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.31
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.31
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.31
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.87
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.87
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.81
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.72
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.7
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.65
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.58
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.38
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.24
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.16
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.13
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.76
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.64
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.62
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.51
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.39
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.34
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.32
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.14
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.0
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.04
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.0
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.25
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.02
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.86
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 92.75
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.62
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.59
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.11
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.74
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.32
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.25
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.46
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 86.4
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.35
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 84.98
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 84.77
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.57
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.51
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 81.97
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.54
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.98
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.65
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2e-33  Score=286.76  Aligned_cols=404  Identities=11%  Similarity=0.035  Sum_probs=336.8

Q ss_pred             CCccchhHHHHHHHHHHhcCCCchHHHHHHHhhhccCcchHHHHHHH-----------------HcccCCHHHHHHHHHH
Q 010807           72 RKSEELESKELVRVLMRSFSDKEPLVRTLNKYVKVVRSEHCFLLFEE-----------------LGKSDKWLQCLEVFRW  134 (500)
Q Consensus        72 ~~~~~~~a~~l~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~-----------------l~~~~~~~~A~~~~~~  134 (500)
                      +.+...+|..+++.++...++...+..+...+...++.+.+..+++.                 +.+.|++++|+++|+.
T Consensus        96 ~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  175 (597)
T 2xpi_A           96 MQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGE  175 (597)
T ss_dssp             HTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHHTTCHHHHHHHHCS
T ss_pred             HccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHHHHhhHHHHHHHHhc
Confidence            35667889999998887777766666666777777766666555444                 4567999999999985


Q ss_pred             HHHcc--------------CCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCC-HHHHHHHHHHH---------
Q 010807          135 MQKQR--------------WYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPD-PSVYNALITAH---------  190 (500)
Q Consensus       135 ~~~~~--------------~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~~~~~li~~~---------  190 (500)
                      +....              +.+.+..+|+.++.+|.+.|++++|+++|++|.+.+  |+ ...+..+...+         
T Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~  253 (597)
T 2xpi_A          176 TNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWD  253 (597)
T ss_dssp             SCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHH
T ss_pred             cCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHH
Confidence            32221              123458899999999999999999999999998864  33 33333332111         


Q ss_pred             -------------------------HcCcchHHHHHHHHHHHHHhhcCCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 010807          191 -------------------------LHTRDKAKALAKALGYFQKMKGMERCKPNIVTYNILLRACAQARNVDQVNALFKE  245 (500)
Q Consensus       191 -------------------------~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~  245 (500)
                                               +....+.|++++|+++|+++...   +++..+|+.++.+|.+.|++++|.++|++
T Consensus       254 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~---~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  330 (597)
T 2xpi_A          254 LVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL---EKSSDLLLCKADTLFVRSRFIDVLAITTK  330 (597)
T ss_dssp             HHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG---GGCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC---CchHHHHHHHHHHHHHhcCHHHHHHHHHH
Confidence                                     11112789999999999999863   68999999999999999999999999999


Q ss_pred             HHhCCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCCH
Q 010807          246 LHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPTL  325 (500)
Q Consensus       246 m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~  325 (500)
                      +.+.+.. +..++..++.+|.+.|++++|.++++++.+.. +.+..+++.++.+|.+.|++++|.++|+++.+.. +.+.
T Consensus       331 ~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~  407 (597)
T 2xpi_A          331 ILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFG  407 (597)
T ss_dssp             HHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCH
T ss_pred             HHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCH
Confidence            9987654 77889999999999999999999999998654 3478899999999999999999999999998753 3378


Q ss_pred             HHHHHHHHHHHhcCCHhHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q 010807          326 PTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEAY  405 (500)
Q Consensus       326 ~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~  405 (500)
                      .+|+.++.+|.+.|++++|..+|+++.+.+ +.+..+|..++.+|.+.|++++|.++|+++.+... .+..+|+.++.+|
T Consensus       408 ~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~  485 (597)
T 2xpi_A          408 PAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQ-YDPLLLNELGVVA  485 (597)
T ss_dssp             HHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCC-CCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CChHHHHHHHHHH
Confidence            899999999999999999999999999875 45788999999999999999999999999998753 4789999999999


Q ss_pred             HhcCChhhHHHHHHHHHhC----CCCCC--HHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcCC
Q 010807          406 CMNGLPTEADLLFENSHNM----GVTPD--SSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPNKRFFLEALETFSSSL  479 (500)
Q Consensus       406 ~~~g~~~~A~~~~~~m~~~----~~~p~--~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g  479 (500)
                      .+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.++++++.+.+ +.+..+|..+...|...|
T Consensus       486 ~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g  564 (597)
T 2xpi_A          486 FNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKK  564 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTT
T ss_pred             HHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhC
Confidence            9999999999999999876    66787  7899999999999999999999999999875 447889999999999998


Q ss_pred             CCCCCcc
Q 010807          480 AGSQSGS  486 (500)
Q Consensus       480 ~~~~~~~  486 (500)
                      +++....
T Consensus       565 ~~~~A~~  571 (597)
T 2xpi_A          565 IPGLAIT  571 (597)
T ss_dssp             CHHHHHH
T ss_pred             CHHHHHH
Confidence            8765443



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query500
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.58
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.22
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.14
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.13
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.11
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.09
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.06
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.01
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.91
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.73
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.54
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.51
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.38
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.37
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.37
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.29
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.21
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.15
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.15
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.1
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.96
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.94
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.91
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.87
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.82
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.81
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.8
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.76
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.68
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.6
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.46
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.38
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.37
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.31
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.16
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.95
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.61
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.45
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.37
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.32
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.1
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.52
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.27
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.61
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.77
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.56
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=7.1e-19  Score=166.06  Aligned_cols=344  Identities=10%  Similarity=0.033  Sum_probs=267.3

Q ss_pred             HcccCCHHHHHHHHHHHHHccCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHcCcchHH
Q 010807          119 LGKSDKWLQCLEVFRWMQKQRWYIADTGIYSKLIAVMGKKGQTRLAMWLFSEMRNSGCRPDPSVYNALITAHLHTRDKAK  198 (500)
Q Consensus       119 l~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~~~~~~  198 (500)
                      ..+.|++++|++.|+.+.+..  +.+...+..+..++.+.|++++|+..|++..+.. +-+...|..+...+.    ..|
T Consensus         9 ~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~----~~g   81 (388)
T d1w3ba_           9 EYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYK----ERG   81 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHH----HHT
T ss_pred             HHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhh----hhc
Confidence            345588888888888887763  4567778888888888888888888888887753 234567777777777    677


Q ss_pred             HHHHHHHHHHHhhcCCCCCCCHHHHHH----------------------------------HHHHHHHcCCHHHHHHHHH
Q 010807          199 ALAKALGYFQKMKGMERCKPNIVTYNI----------------------------------LLRACAQARNVDQVNALFK  244 (500)
Q Consensus       199 ~~~~a~~~~~~~~~~~~~~~~~~~~~~----------------------------------ll~~~~~~g~~~~a~~~~~  244 (500)
                      ++++|+..+.......  +.+...+..                                  ........+....+...+.
T Consensus        82 ~~~~A~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLK--PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL  159 (388)
T ss_dssp             CHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHH
T ss_pred             cccccccccccccccc--cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHH
Confidence            7888888887776532  222222222                                  2233333444455555555


Q ss_pred             HHHhCCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCC
Q 010807          245 ELHESILAPDIYTYNGVMDAYGKNGMIKEMESVLSRMKSNQCKPDIITFNLLIDSYGKRQAFDKMEQVFKSLMHSKEKPT  324 (500)
Q Consensus       245 ~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~  324 (500)
                      ........ +...+..+...+...|++++|...+++..+.... +...+..+...+...|++++|+..++....... .+
T Consensus       160 ~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~-~~  236 (388)
T d1w3ba_         160 KAIETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLSP-NH  236 (388)
T ss_dssp             HHHHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT-TC
T ss_pred             HhhccCcc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhh-hH
Confidence            55444322 5677788888999999999999999998876433 677889999999999999999999999887643 47


Q ss_pred             HHHHHHHHHHHHhcCCHhHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q 010807          325 LPTFNSMIINYGKARLQGKAEYVFQKMTAMKYTPSFITYECIITMYGYCDNVSRAREIFDELSKLGKDMKVSTLNAMLEA  404 (500)
Q Consensus       325 ~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~li~~  404 (500)
                      ...+..+...+...|++++|...|++..+.. +-+..++..+...+...|++++|.+.++...... +.+...+..+..+
T Consensus       237 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~  314 (388)
T d1w3ba_         237 AVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANI  314 (388)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHH
Confidence            7888889999999999999999999998864 4457889999999999999999999999988864 4578899999999


Q ss_pred             HHhcCChhhHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHhcCC
Q 010807          405 YCMNGLPTEADLLFENSHNMGVTPDSSTYKLLYKAYTKANMKELVQKLLKRMEQNGIVPN-KRFFLEALETFSSSL  479 (500)
Q Consensus       405 ~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~-~~~~~~ll~~~~~~g  479 (500)
                      +...|++++|+..|++.++.. +-+..++..+..+|.+.|++++|...|++..+.  .|+ ...|..+-..+.+.|
T Consensus       315 ~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         315 KREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--SPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             HHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--CTTCHHHHHHHHHHHHHTC
T ss_pred             HHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcC
Confidence            999999999999999998763 335778999999999999999999999998854  565 566777777766555



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure