Citrus Sinensis ID: 011171
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 492 | 2.2.26 [Sep-21-2011] | |||||||
| O04251 | 1329 | BRCT domain-containing pr | no | no | 0.178 | 0.066 | 0.384 | 1e-13 | |
| Q9NS56 | 1045 | E3 ubiquitin-protein liga | yes | no | 0.128 | 0.060 | 0.318 | 0.0001 | |
| Q80Z37 | 1033 | E3 ubiquitin-protein liga | yes | no | 0.128 | 0.060 | 0.318 | 0.0001 | |
| Q60596 | 631 | DNA repair protein XRCC1 | no | no | 0.170 | 0.133 | 0.321 | 0.0001 | |
| Q5F3B2 | 244 | RING finger protein 166 O | no | no | 0.156 | 0.315 | 0.313 | 0.0002 | |
| A0JNA8 | 984 | PAX-interacting protein 1 | no | no | 0.134 | 0.067 | 0.367 | 0.0003 | |
| Q6ZW49 | 1069 | PAX-interacting protein 1 | no | no | 0.134 | 0.061 | 0.367 | 0.0003 | |
| Q6NZQ4 | 1056 | PAX-interacting protein 1 | no | no | 0.134 | 0.062 | 0.367 | 0.0003 | |
| P84445 | 532 | E3 ubiquitin-protein liga | no | no | 0.095 | 0.088 | 0.396 | 0.0004 | |
| P28990 | 532 | E3 ubiquitin-protein liga | no | no | 0.095 | 0.088 | 0.396 | 0.0004 |
| >sp|O04251|Y4211_ARATH BRCT domain-containing protein At4g02110 OS=Arabidopsis thaliana GN=At4g02110 PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 78.6 bits (192), Expect = 1e-13, Method: Compositional matrix adjust.
Identities = 35/91 (38%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
Query: 2 ESVVATVSGYHGTERFNLIKLISYSGASYVGTM-SKSTTHLVCWKFEGEKHSLAKKFRTI 60
+++V ++GY G +R ++++++ G + + + THL+C+KFEGEK+ LAK+ + I
Sbjct: 110 KALVVCLTGYQGHDREDIMRMVELMGGQFSKPLVANRVTHLICYKFEGEKYELAKRIKRI 169
Query: 61 -IVNHQWVEDCIKQHRRLPERPYMLQSGQEI 90
+VNH+W+EDC+K + LPE Y + SG E+
Sbjct: 170 KLVNHRWLEDCLKNWKLLPEVDYEI-SGYEL 199
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9NS56|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens GN=TOPORS PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q80Z37|TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus GN=Topors PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q60596|XRCC1_MOUSE DNA repair protein XRCC1 OS=Mus musculus GN=Xrcc1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5F3B2|RN166_CHICK RING finger protein 166 OS=Gallus gallus GN=RNF166 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P84445|ICP0_EHV1V E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain V592) GN=ICP0 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P28990|ICP0_EHV1B E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain Ab4p) GN=63 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 492 | ||||||
| 118485165 | 482 | unknown [Populus trichocarpa] | 0.871 | 0.890 | 0.503 | 1e-125 | |
| 359488305 | 503 | PREDICTED: uncharacterized protein LOC10 | 0.845 | 0.827 | 0.476 | 1e-117 | |
| 298204398 | 475 | unnamed protein product [Vitis vinifera] | 0.845 | 0.875 | 0.476 | 1e-117 | |
| 224079912 | 422 | predicted protein [Populus trichocarpa] | 0.827 | 0.964 | 0.472 | 1e-109 | |
| 449455840 | 490 | PREDICTED: uncharacterized protein LOC10 | 0.912 | 0.916 | 0.464 | 1e-107 | |
| 356573651 | 491 | PREDICTED: uncharacterized protein LOC10 | 0.853 | 0.855 | 0.430 | 6e-95 | |
| 255581342 | 460 | ubiquitin-protein ligase, putative [Rici | 0.831 | 0.889 | 0.428 | 1e-94 | |
| 297838453 | 464 | zinc finger family protein [Arabidopsis | 0.900 | 0.954 | 0.415 | 2e-94 | |
| 357147768 | 546 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.875 | 0.390 | 2e-88 | |
| 357147770 | 501 | PREDICTED: uncharacterized protein LOC10 | 0.941 | 0.924 | 0.405 | 1e-87 |
| >gi|118485165|gb|ABK94444.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 455 bits (1171), Expect = e-125, Method: Compositional matrix adjust.
Identities = 271/538 (50%), Positives = 316/538 (58%), Gaps = 109/538 (20%)
Query: 1 MESVVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFRTI 60
MESVVATVSGYHG+ERFNLIKLIS SGASYVG MS STTHLVCWKFEG K+ LA KF T+
Sbjct: 1 MESVVATVSGYHGSERFNLIKLISQSGASYVGAMSNSTTHLVCWKFEGRKYELASKFDTL 60
Query: 61 IVNHQWVEDCIKQHRRLPERPYMLQSGQEIGPLLLEVP----LFNMNSDRSNLDDNSKNE 116
+VNH+WVE+C+KQ +R+PE PYML+SGQE+GPL+L+VP L ++N R L D S N
Sbjct: 61 VVNHRWVEECVKQGKRVPEYPYMLESGQEVGPLVLDVPNVDKLGSLNKKRKPLSDKSNNC 120
Query: 117 E------TDMRFEVSELAGWKGSFLLNENLLPKFGKSENTSHKCKSKSFKRASKQEQRSS 170
E D+ E S LA W SFLLN+ + G S N+S
Sbjct: 121 EDSERRIVDVDCEDSGLAAWSDSFLLND--VKHGGSSYNSS------------------- 159
Query: 171 ARNCFQDPPLSGLIRMEYEESSSDSSIHSVRGKRKISKHEESSTHSSLRSLREKTKISKG 230
+EES ++H VRG+R S+T S+L
Sbjct: 160 ----------------RHEESDIVPNMHFVRGRRNTF----SNTGSTL------------ 187
Query: 231 IGSSSSAKPSTKGRRLA-KCIGRNGLESMLLDSDQDRAPVIRIAETSDDGFHKDGGI--- 286
A+PS KGRRL K I R+ LE++L DSDQ+ PV + K G
Sbjct: 188 ------AEPSRKGRRLMKKNIARDNLETLLSDSDQEWHPVRLNKNNNSKSTAKRTGCKRK 241
Query: 287 ----------------NEGSEV--IKEIEE-------------RDFP--ALLQRESQDGC 313
N GS V + EIEE FP AL E D
Sbjct: 242 LDIFEAEVTSDVAVINNRGSAVESLDEIEEGTHWNHLPVSEYSNSFPEGALTASEIADSS 301
Query: 314 -SGIENSNGMVKNTDRIEHVNRSSTSGELSCVICWTEFSSTRGVLACGHRFCYSCIQNWA 372
S EN N VK+ D+ E V R ELSCVICWTEFSSTRGVL CGHRFCYSCIQ WA
Sbjct: 302 GSAAENLNAKVKDMDQFESVARLPAPAELSCVICWTEFSSTRGVLPCGHRFCYSCIQEWA 361
Query: 373 DHMASVRKISTCPLCKASFMSITKVEDAATSDQKIYSQTIPCAWSTRDVF--ILPDGDSA 430
DHMAS R+ISTCPLCKA F ITKVEDAATSDQKIYSQTIP A ST DVF +L + +
Sbjct: 362 DHMASRRRISTCPLCKAGFSIITKVEDAATSDQKIYSQTIPHASSTVDVFFSMLQEQNKF 421
Query: 431 SVQPSLLEACIECRSQEPQDLLIRCHLCQSRCIHCYCMDPPLDPWTCIHCKDLQMLYN 488
+PS C ECRS+EP+DLLIRCHLC++RCIH YC+DPPL PW C HCKDLQMLY+
Sbjct: 422 GAEPSFGSVCCECRSREPEDLLIRCHLCETRCIHSYCLDPPLSPWICTHCKDLQMLYH 479
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359488305|ref|XP_002279145.2| PREDICTED: uncharacterized protein LOC100256612 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|298204398|emb|CBI16878.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224079912|ref|XP_002305970.1| predicted protein [Populus trichocarpa] gi|222848934|gb|EEE86481.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449455840|ref|XP_004145658.1| PREDICTED: uncharacterized protein LOC101213123 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356573651|ref|XP_003554971.1| PREDICTED: uncharacterized protein LOC100815034 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255581342|ref|XP_002531481.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223528908|gb|EEF30905.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297838453|ref|XP_002887108.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297332949|gb|EFH63367.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357147768|ref|XP_003574477.1| PREDICTED: uncharacterized protein LOC100840339 isoform 1 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|357147770|ref|XP_003574478.1| PREDICTED: uncharacterized protein LOC100840339 isoform 2 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 492 | ||||||
| TAIR|locus:2033691 | 453 | AT1G67180 [Arabidopsis thalian | 0.310 | 0.337 | 0.579 | 1.5e-91 | |
| TAIR|locus:2132198 | 1329 | AT4G02110 "AT4G02110" [Arabido | 0.178 | 0.066 | 0.384 | 1e-11 | |
| TAIR|locus:2078092 | 883 | AT3G05670 "AT3G05670" [Arabido | 0.355 | 0.198 | 0.272 | 5.2e-08 | |
| FB|FBgn0037344 | 2296 | CG2926 [Drosophila melanogaste | 0.268 | 0.057 | 0.278 | 1.3e-07 | |
| RGD|708360 | 1685 | Phrf1 "PHD and ring finger dom | 0.386 | 0.112 | 0.291 | 2.4e-07 | |
| UNIPROTKB|Q63625 | 1685 | Phrf1 "PHD and RING finger dom | 0.386 | 0.112 | 0.291 | 2.4e-07 | |
| UNIPROTKB|I3LUY7 | 135 | I3LUY7 "Uncharacterized protei | 0.180 | 0.659 | 0.285 | 5.7e-06 | |
| TAIR|locus:2034934 | 106 | AT1G18770 [Arabidopsis thalian | 0.144 | 0.669 | 0.362 | 4.1e-05 | |
| ASPGD|ASPL0000016982 | 841 | AN10434 [Emericella nidulans ( | 0.158 | 0.092 | 0.384 | 5.5e-05 | |
| UNIPROTKB|C9IZE0 | 114 | TRIM59 "Tripartite motif-conta | 0.060 | 0.263 | 0.483 | 5.9e-05 |
| TAIR|locus:2033691 AT1G67180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 526 (190.2 bits), Expect = 1.5e-91, Sum P(2) = 1.5e-91
Identities = 91/157 (57%), Positives = 119/157 (75%)
Query: 340 ELSCVICWTEFSSTRGVLACGHRFCYSCIQNWADHMASVRKISTCPLCKASFMSITKVED 399
++SC+ICWTEFSS+RG+L CGHRFCYSCIQ WAD + S RK +TCPLCK++F++ITK+ED
Sbjct: 297 QVSCIICWTEFSSSRGILPCGHRFCYSCIQKWADRLVSERKKTTCPLCKSNFITITKIED 356
Query: 400 AATSDQKIYSQTIPCAWSTRDVFI-LPDGDSA--SVQP-SLLEACIECRSQEPQDLLIRC 455
A +SDQKIYSQT+P ST ++ + LP+ + ++ P + C C EP++LLIRC
Sbjct: 357 ADSSDQKIYSQTVPDLSSTNNILVVLPEEEEQRQTLNPLTRASGCSRCYLTEPEELLIRC 416
Query: 456 HLCQSRCIHCYCMDPPLDPWTCIHCKDLQMLYNRSNF 492
HLC R IH YC+DP L PWTC HC DLQM+Y+R N+
Sbjct: 417 HLCNFRRIHSYCLDPYLLPWTCNHCNDLQMMYHRRNY 453
|
|
| TAIR|locus:2132198 AT4G02110 "AT4G02110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078092 AT3G05670 "AT3G05670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037344 CG2926 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|708360 Phrf1 "PHD and ring finger domains 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q63625 Phrf1 "PHD and RING finger domain-containing protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LUY7 I3LUY7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034934 AT1G18770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000016982 AN10434 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9IZE0 TRIM59 "Tripartite motif-containing protein 59" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 492 | |||
| pfam12738 | 63 | pfam12738, PTCB-BRCT, twin BRCT domain | 2e-21 | |
| cd00027 | 72 | cd00027, BRCT, Breast Cancer Suppressor Protein (B | 6e-11 | |
| pfam00533 | 77 | pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | 1e-10 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-09 | |
| smart00292 | 78 | smart00292, BRCT, breast cancer carboxy-terminal d | 5e-09 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 3e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-07 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 7e-07 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-05 | |
| PHA02926 | 242 | PHA02926, PHA02926, zinc finger-like protein; Prov | 3e-04 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.001 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 0.001 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 0.002 |
| >gnl|CDD|193214 pfam12738, PTCB-BRCT, twin BRCT domain | Back alignment and domain information |
|---|
Score = 87.3 bits (217), Expect = 2e-21
Identities = 29/63 (46%), Positives = 39/63 (61%)
Query: 4 VVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFRTIIVN 63
+V VSGY G +R L KLI GA Y ++K THL+C + EGEK+ AKK+ +V+
Sbjct: 1 LVICVSGYSGDDRKYLQKLIEALGAEYSKDLTKKVTHLICKRGEGEKYEKAKKWGIPVVS 60
Query: 64 HQW 66
H W
Sbjct: 61 HLW 63
|
This is a BRCT domain that appears in duplicate in most member sequences. BRCT domains are peptide- and phosphopeptide-binding modules. BRCT domains are present in a number of proteins involved in DNA checkpoint controls and DNA repair. Length = 63 |
| >gnl|CDD|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 492 | |||
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 99.69 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 99.56 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.52 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 99.46 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 99.38 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 99.33 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.02 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.85 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 98.82 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.8 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.77 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 98.76 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.72 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 98.69 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.64 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.64 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.64 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.57 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.57 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.57 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.53 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.51 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.44 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 98.42 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.41 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.41 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.32 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.3 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.27 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.26 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.21 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.17 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 98.14 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.1 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.05 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.03 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.03 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.02 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 98.02 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.01 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 98.0 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 97.96 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 97.96 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 97.93 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 97.92 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.9 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 97.9 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.83 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.77 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.74 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 97.73 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.73 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.73 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 97.71 | |
| KOG3548 | 1176 | consensus DNA damage checkpoint protein RHP9/CRB2/ | 97.6 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.54 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.45 | |
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 97.37 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.37 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 97.3 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.29 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.18 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.17 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.14 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.0 | |
| COG5275 | 276 | BRCT domain type II [General function prediction o | 96.95 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.92 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 96.86 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 96.85 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 96.74 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.73 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.73 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 96.72 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.68 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 96.67 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 96.55 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 96.45 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 96.43 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.36 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.35 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.12 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.09 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 95.86 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 95.81 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.73 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.68 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 95.67 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.62 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.34 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.28 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.25 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 95.24 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 95.03 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.96 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.9 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 94.78 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 94.18 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.17 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 94.02 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.37 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 93.35 | |
| KOG2093 | 1016 | consensus Translesion DNA polymerase - REV1 deoxyc | 92.94 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.68 | |
| PRK05601 | 377 | DNA polymerase III subunit epsilon; Validated | 92.66 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 92.58 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.23 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 92.0 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 91.93 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.84 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 91.83 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 91.55 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 91.32 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 90.8 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 90.6 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 90.51 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 90.49 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 90.22 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 90.17 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 90.07 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 90.04 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 89.69 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 89.02 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.82 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 88.52 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.13 | |
| PHA03096 | 284 | p28-like protein; Provisional | 87.95 | |
| PHA02862 | 156 | 5L protein; Provisional | 87.68 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 87.24 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 87.09 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 86.93 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 86.81 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 86.53 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 86.09 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 85.84 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 85.6 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.07 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 83.97 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.55 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.31 | |
| KOG2093 | 1016 | consensus Translesion DNA polymerase - REV1 deoxyc | 83.11 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 82.92 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 82.67 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 82.52 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 82.22 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 81.73 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 80.65 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 80.45 |
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
Probab=99.69 E-value=1.4e-17 Score=130.50 Aligned_cols=63 Identities=41% Similarity=0.644 Sum_probs=56.4
Q ss_pred cEEEecCCCcchHHHHHHHHHhcCCEEecccCCCCcEEEecCCCChhHHHHHhcCCeEecccc
Q 011171 4 VVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFRTIIVNHQW 66 (492)
Q Consensus 4 ~~I~vSG~~~~er~~i~~li~~~Gg~~~~~lt~~vTHLV~~~~~~~K~~~A~~~~i~IVs~~W 66 (492)
|+||+|||.+.++..|.++|++|||+|+++|++++|||||..+.+.||++|.+|||+||+++|
T Consensus 1 ~~i~~sg~~~~~~~~l~~~i~~~Gg~~~~~lt~~~THLI~~~~~~~K~~~A~~~gi~vV~~~W 63 (63)
T PF12738_consen 1 VVICFSGFSGKERSQLRKLIEALGGKYSKDLTKKTTHLICSSPEGKKYRKAKEWGIPVVSPDW 63 (63)
T ss_dssp -EEEEEEB-TTTCCHHHHHHHCTT-EEESSSSTT-SEEEEES--HHHHHHHHHCTSEEEEHHH
T ss_pred CEEEECCCCHHHHHHHHHHHHHCCCEEeccccCCceEEEEeCCCcHHHHHHHHCCCcEECCCC
Confidence 689999999999999999999999999999999999999999999999999999999999999
|
|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >COG5275 BRCT domain type II [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG2093 consensus Translesion DNA polymerase - REV1 deoxycytidyl transferase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PRK05601 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2093 consensus Translesion DNA polymerase - REV1 deoxycytidyl transferase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 492 | ||||
| 2d8m_A | 129 | Solution Structure Of The First Brct Domain Of Dna- | 9e-06 | ||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 6e-05 | ||
| 4ayc_A | 138 | Rnf8 Ring Domain Structure Length = 138 | 7e-05 | ||
| 4epo_C | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 7e-05 | ||
| 1chc_A | 68 | Structure Of The C3hc4 Domain By 1h-Nuclear Magneti | 5e-04 |
| >pdb|2D8M|A Chain A, Solution Structure Of The First Brct Domain Of Dna-Repair Protein Xrcc1 Length = 129 | Back alignment and structure |
|
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
| >pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
Score = 106 bits (267), Expect = 8e-28
Identities = 26/86 (30%), Positives = 40/86 (46%)
Query: 1 MESVVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFRTI 60
++ VV +SG+ R L GA Y ++ +THL+C K+S
Sbjct: 23 LQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHLICAFANTPKYSQVLGLGGR 82
Query: 61 IVNHQWVEDCIKQHRRLPERPYMLQS 86
IV +WV DC + RRLP + Y++
Sbjct: 83 IVRKEWVLDCHRMRRRLPSQRYLMAG 108
|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Length = 209 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Length = 241 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Length = 259 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Length = 264 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 492 | |||
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.84 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.83 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.81 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.81 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.76 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.75 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.74 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.7 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 99.64 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 99.63 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 99.59 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.59 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.58 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.56 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.56 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 99.51 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.49 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.46 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 99.44 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 99.44 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 99.36 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 99.35 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.32 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 99.29 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 99.28 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 99.18 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.16 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 99.15 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.15 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 99.15 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.13 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.12 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.11 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.09 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.09 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.08 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.08 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 99.07 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.06 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.06 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.06 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 99.06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.04 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.03 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.03 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.02 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.01 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.01 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.01 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.0 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.97 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.97 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.97 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.97 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.97 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.97 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.97 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.96 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.96 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.96 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.95 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.94 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.94 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.93 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.92 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.92 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.9 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.9 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.9 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.89 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.88 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.88 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.86 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.86 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.85 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.85 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 98.85 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.84 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.82 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 98.82 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.81 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.79 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.78 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.76 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.74 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 98.72 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.71 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.71 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.7 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.63 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 98.59 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.58 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 98.56 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.54 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.54 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.53 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.52 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 98.52 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.5 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.48 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.47 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 98.36 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.31 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.27 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.23 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.22 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.1 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.08 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 98.07 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 98.05 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 97.98 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 97.9 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.88 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 97.87 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.75 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 97.71 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.7 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 97.51 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 97.46 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 97.45 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 97.44 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 97.4 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.39 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 97.39 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 97.37 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 97.35 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 97.3 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 97.24 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 97.22 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 97.17 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 97.14 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.12 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 97.09 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 97.04 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 96.96 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 96.93 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 96.93 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 96.91 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 96.87 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 96.83 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 96.76 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 96.49 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 96.44 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 96.33 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 96.33 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 96.29 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 96.07 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 96.0 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 95.71 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 95.31 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 95.19 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 94.97 | |
| 3qbz_A | 160 | DDK kinase regulatory subunit DBF4; FHA domain,RAD | 94.83 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 94.75 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 94.47 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 94.41 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 94.4 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 94.06 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 94.01 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 93.75 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 93.28 | |
| 3oq0_A | 151 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 93.21 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 93.14 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 92.21 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 91.71 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 91.69 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 91.57 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 91.21 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 91.04 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 90.67 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 90.56 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 90.45 | |
| 2aq4_A | 434 | DNA repair protein REV1; polymerase, PAD, N-digit, | 90.2 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 89.91 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 88.86 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 88.8 | |
| 2ffw_A | 78 | Midline-1; B-BOX, ring finger, zinc-finger, ligase | 87.44 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 87.19 | |
| 3gqc_A | 504 | DNA repair protein REV1; protein-DNA complex, DNA | 85.96 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 84.78 |
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.84 E-value=4.6e-22 Score=172.55 Aligned_cols=85 Identities=18% Similarity=0.325 Sum_probs=83.1
Q ss_pred CCCcEEEecCCCcchHHHHHHHHHhcCCEEecccCCCCcEEEecCCCChhHHHHHhcCCeEeccccHHHHHhhcCCCCCC
Q 011171 1 MESVVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFRTIIVNHQWVEDCIKQHRRLPER 80 (492)
Q Consensus 1 ~~g~~I~vSG~~~~er~~i~~li~~~Gg~~~~~lt~~vTHLV~~~~~~~K~~~A~~~~i~IVs~~WL~dc~~~~~~l~e~ 80 (492)
|.||+||+|||++.+|.+|+++|+.+||+|+..+++++||||+..+.+.||..|.+|+|+||+++||+||++.|.++||.
T Consensus 22 F~g~~Ic~sGf~~~er~~l~~~i~~~GG~~~~~l~~~cTHLV~~~~~~~K~~~A~~~~i~IVs~eWl~dsi~~g~~ldE~ 101 (112)
T 3l46_A 22 FQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGET 101 (112)
T ss_dssp TTTCEECEESCCHHHHHHHHHHHHHTTCEECCTTCTTCSEEEECTTTBSSCSSCCCSSCEEEEHHHHHHHHHHTSCCCGG
T ss_pred cCCeEEEEeCCCHHHHHHHHHHHHHcCCEECcccCCCceEEEecCCchhhHHHHHHCCeeEecHHHHHHHHHcCCccChh
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcccC
Q 011171 81 PYMLQ 85 (492)
Q Consensus 81 ~Y~l~ 85 (492)
.|.+.
T Consensus 102 ~Y~~~ 106 (112)
T 3l46_A 102 MYLYE 106 (112)
T ss_dssp GSBCC
T ss_pred hceec
Confidence 99983
|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2aq4_A DNA repair protein REV1; polymerase, PAD, N-digit, G-loop, transferase; HET: DNA DOC DCP; 2.32A {Saccharomyces cerevisiae} PDB: 3bjy_A* 3osp_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ffw_A Midline-1; B-BOX, ring finger, zinc-finger, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3gqc_A DNA repair protein REV1; protein-DNA complex, DNA damage, DNA repair, DNA synthesis, binding, magnesium, metal-binding; HET: DNA DOC DCP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 492 | ||||
| d1wf6a_ | 132 | c.15.1.5 (A:) DNA topoisomerase II binding protein | 2e-14 | |
| d1t15a1 | 109 | c.15.1.3 (A:1649-1757) Breast cancer associated pr | 2e-12 | |
| d1cdza_ | 96 | c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom | 2e-11 | |
| d1t15a2 | 102 | c.15.1.3 (A:1758-1859) Breast cancer associated pr | 5e-10 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-09 | |
| d1kzyc1 | 153 | c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) | 2e-08 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 9e-08 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-07 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 5e-07 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 9e-07 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-06 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 1e-05 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 1e-04 | |
| d1in1a_ | 88 | c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sa | 1e-04 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 2e-04 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 3e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 3e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 4e-04 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 4e-04 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 0.002 |
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: BRCT domain superfamily: BRCT domain family: DNA topoisomerase II binding protein 1, TopBP1 domain: DNA topoisomerase II binding protein 1, TopBP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.9 bits (165), Expect = 2e-14
Identities = 17/86 (19%), Positives = 36/86 (41%), Gaps = 2/86 (2%)
Query: 1 MESVVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFRTI 60
++ + G+ G + L +LI+ G +++ TH++ ++ E K
Sbjct: 41 LDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHR 100
Query: 61 I--VNHQWVEDCIKQHRRLPERPYML 84
V +W+ +C + L E PY+
Sbjct: 101 PHVVGAKWLLECFSKGYMLSEEPYIH 126
|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 492 | |||
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.74 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.71 | |
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.7 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.63 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 99.34 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 99.26 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.12 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.1 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.09 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.05 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.05 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.03 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.01 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.01 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.96 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.96 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.86 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.85 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.73 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.69 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.65 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.58 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 98.17 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.85 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 97.33 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 96.97 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 96.71 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 96.69 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 96.6 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 96.33 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 96.13 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.04 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 95.17 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 93.94 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 93.14 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 92.13 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 87.07 |
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: BRCT domain superfamily: BRCT domain family: DNA-repair protein XRCC1 domain: DNA-repair protein XRCC1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74 E-value=1.9e-18 Score=142.60 Aligned_cols=84 Identities=18% Similarity=0.266 Sum_probs=80.8
Q ss_pred CCCcEEEecC-CCcchHHHHHHHHHhcCCEEecccCCCCcEEEecCCCChhHHHHHhc--CCeEeccccHHHHHhhcCCC
Q 011171 1 MESVVATVSG-YHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKF--RTIIVNHQWVEDCIKQHRRL 77 (492)
Q Consensus 1 ~~g~~I~vSG-~~~~er~~i~~li~~~Gg~~~~~lt~~vTHLV~~~~~~~K~~~A~~~--~i~IVs~~WL~dc~~~~~~l 77 (492)
|+|++|+++| |+..++..|.++|.++||++...++.++||||+....+.+++.+.++ +++||+++||+||+++++++
T Consensus 6 F~g~~f~v~g~~~~~~~~~l~~~i~~~GG~v~~~~~~~~THvI~~~~~~~~~~~~~~~~~~i~iV~~~Wl~dc~~~~~~l 85 (96)
T d1cdza_ 6 FQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLL 85 (96)
T ss_dssp TTTCEEEECSCCCTHHHHHHHHHHHHTTCEECSSCSTTCSEEECSSCCCHHHHHHHTTCTTCEEECTHHHHHHHTTTSCC
T ss_pred cCCcEEEEeCCCCHHHHHHHHHHHHHhCCEEeccCCCCceEEEEccCCcceeeehhhhCCCCeEEEEhHHHHHHHcCCcC
Confidence 7999999998 88999999999999999999999999999999999999999999876 79999999999999999999
Q ss_pred CCCCccc
Q 011171 78 PERPYML 84 (492)
Q Consensus 78 ~e~~Y~l 84 (492)
|+++|.+
T Consensus 86 p~~~Y~i 92 (96)
T d1cdza_ 86 PHQLYGV 92 (96)
T ss_dssp CGGGGBC
T ss_pred CchhcEe
Confidence 9999987
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|