Citrus Sinensis ID: 011245

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MATGFNRAEAERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDLQLSQLGERPRQTQMPPPPQPPQPIQSQPVRRSPPPPARRSPPPQAKISPLNKDKGVSNRTVEEERSSSNNVTESTREARTSRTESNRPSEAAYEGPRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSGNAKDTGGNFSKWTPVSPMFACPKPGQNNKKTNKRVQVLYDEVLISDSESDPEESDDEWGSNKKKKKAKNVKGKGNEVRKNVKRTPVERGKRGSQNQKENQNAGGNVDGMVGTSSGGGGARVLRSSGKKQMGNGLDLNVEFSNELEEPMAAVPPRMNPENGMEDNIDGVFFEGLDEFLSSLPILNVVKDDKVKPT
ccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEcccccccccc
ccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHEEEccEEEcccccccEEEEEcccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEcccccccccEEcccccccccccccEEcccccccccccccccccccccccccccccccccccHcccccccEEEEEccccccccccccccccccccccccccEEEEccHHHHHHccccEEEccccccccc
MATGFNRAEAERWLSVAEKVLSSHDFQGARSFAIRareydpsfeapnqVLAVADTIIAGESiiitsngnqyHDWYAILQLARFTHSIELIATQYRKLALLlspernrfpfadrsfKLVYDAWSIlsnparkimydtdlqlsqlgerprqtqmppppqppqpiqsqpvrrspppparrspppqakisplnkdkgvsnrtveeersssnnvtestreartsrtesnrpseaayegprfwtacpycyilyeypkayedctlkcqnckrafhgvmiasppvtekdtyfccwgffpvgysgnakdtggnfskwtpvspmfacpkpgqnnkktnkrVQVLYDEVLisdsesdpeesddewgsnkkkkkaknvkgkgnevrknvkrtpvergkrgsqnqkenqnaggnvdgmvgtssggggarvlrssgkkqmgngldlnvefsneleepmaavpprmnpengmednidgVFFEGLDEflsslpilnvvkddkvkpt
matgfnraeaeRWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDLQLSQLGERPRQTQMPPPPQPPQPIQSQPVRRSPPPPARrspppqakisplnkdkgvsnrtveeersssnnvtestreartsrtesnrpseaayegprfwtACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSGNAKDTGGNFSKWTPVSPMFACPkpgqnnkktnkrvQVLYDEVlisdsesdpeesddewgsnkkkkkaknvkgkgnevrknvkrtpvergkrgsqnqkenqnaggnvdgmvGTSSGGGGARVLRssgkkqmgngLDLNVEFSNELEEPMAAVPPRMNPENGMEDNIDGVFFEGLDEFlsslpilnvvkddkvkpt
MATGFNRAEAERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDLQLSQLGErprqtqmppppqppqpiqsqpvrrspppparrspppqAKISPLNKDKGVSNRTVEEERSSSNNVtestreartsrtesNRPSEAAYEGPRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSGNAKDTGGNFSKWTPVSPMFACPKPGQNNKKTNKRVQVLYDEVLIsdsesdpeesddeWgsnkkkkkaknvkgkgnEVRKNVKRTPVERGKRGSQNQKENQNAGGNVDgmvgtssggggARVLRSSGKKQMGNGLDLNVEFSNELEEPMAAVPPRMNPENGMEDNIDGVFFEGLDEFLSSLPILNVVKDDKVKPT
***********RWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDL*********************************************************************************************EGPRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSGNAKDTGGNFSKWTPVSPMFAC*************VQVLYDEVL*************************************************************************************************************************IDGVFFEGLDEFLSSLPILNVV********
*****NR*EAERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESII****GNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMY**********************************************************************************************AAYEGPRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFH*************************************************************************************************************************************************************************************************DGVFFEGLDEFLSSLPILNVVKDD*****
*********AERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDLQLSQLG**************************************AKISPL******************************************YEGPRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSGNAKDTGGNFSKWTPVSPMFACPKPGQNNKKTNKRVQVLYDEVLIS******************************EVRKNVKRTP***************NAGGNVDGMVGTSSGGGGARVLRSSGKKQMGNGLDLNVEFSNELEEPMAAVPPRMNPENGMEDNIDGVFFEGLDEFLSSLPILNVVKDDKVKPT
*******AEAERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDLQL*********************************************************************************************PRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSG****************P****************RVQVLYDEVLISDSES************KK*********************************************************************GLDLNVEFSNELEEPMAAV**********EDNIDGVFFEGLDEFLSSLPILNVVKDDK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGFNRAEAERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESIIITSNGNQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKIMYDTDLQLSQLGERPRQTQMPPPPQPPQPIQSQPVRRSPPPPARRSPPPQAKISPLNKDKGVSNRTVEEERSSSNNVTESTREARTSRTESNRPSEAAYEGPRFWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKDTYFCCWGFFPVGYSGNAKDTGGNFSKWTPVSPMFACPKPGQNNKKTNKRVQVLYDEVLISDSESDPEESDDEWGSNKKKKKAKNVKGKGNEVRKNVKRTPVERGKRGSQNQKENQNAGGNVDGMVGTSSGGGGARVLRSSGKKQMGNGLDLNVEFSNELEEPMAAVPPRMNPENGMEDNIDGVFFEGLDEFLSSLPILNVVKDDKVKPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query490 2.2.26 [Sep-21-2011]
P0CW06389 Chaperone protein DnaJ OS yes no 0.126 0.159 0.412 2e-06
P0CW07389 Chaperone protein DnaJ OS yes no 0.126 0.159 0.412 2e-06
Q9UXR9387 Chaperone protein DnaJ OS N/A no 0.126 0.160 0.428 2e-06
P48353224 Protein HLJ1 OS=Saccharom yes no 0.153 0.334 0.365 2e-06
Q9QYI4376 DnaJ homolog subfamily B yes no 0.153 0.199 0.368 4e-06
O13633403 Uncharacterized J domain- yes no 0.128 0.156 0.421 4e-06
Q58DR2370 DnaJ homolog subfamily B yes no 0.153 0.202 0.368 8e-06
Q8TQR1382 Chaperone protein DnaJ OS yes no 0.126 0.162 0.412 8e-06
Q9NXW2375 DnaJ homolog subfamily B yes no 0.153 0.2 0.355 1e-05
Q9RUG2376 Chaperone protein DnaJ OS yes no 0.126 0.164 0.412 2e-05
>sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 1/63 (1%)

Query: 73  DWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKI 132
           D+Y IL L++ + S+E I   YRKLAL   P+RN+ P A+  FK + +A+++LS+  ++ 
Sbjct: 6   DYYEILGLSKDS-SVEDIKKTYRKLALQYHPDRNKEPGAEEKFKEISEAYAVLSDAEKRA 64

Query: 133 MYD 135
            YD
Sbjct: 65  QYD 67
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Methanosarcina mazei (taxid: 2209)
>sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P48353|HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HLJ1 PE=1 SV=1 Back     alignment and function description
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description
>sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 Back     alignment and function description
>sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 Back     alignment and function description
>sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 Back     alignment and function description
>sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
356528019458 PREDICTED: uncharacterized protein LOC10 0.883 0.945 0.444 1e-100
357476275489 hypothetical protein MTR_4g093930 [Medic 0.936 0.938 0.450 2e-98
356519465463 PREDICTED: uncharacterized protein LOC10 0.902 0.954 0.438 3e-98
356546751499 PREDICTED: uncharacterized protein LOC10 0.926 0.909 0.458 3e-97
225462428486 PREDICTED: uncharacterized protein LOC10 0.861 0.868 0.457 8e-96
356557579497 PREDICTED: uncharacterized protein LOC10 0.930 0.917 0.430 5e-89
15237681464 chaperone DnaJ-domain containing protein 0.861 0.909 0.395 4e-85
147772368451 hypothetical protein VITISV_031217 [Viti 0.836 0.909 0.437 2e-81
42570619422 chaperone DnaJ-domain containing protein 0.789 0.917 0.391 1e-80
224141167414 predicted protein [Populus trichocarpa] 0.810 0.958 0.421 3e-80
>gi|356528019|ref|XP_003532603.1| PREDICTED: uncharacterized protein LOC100788733 [Glycine max] Back     alignment and taxonomy information
 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 225/506 (44%), Positives = 290/506 (57%), Gaps = 73/506 (14%)

Query: 4   GFNRAEAERWLSVAEKVLSSHDFQGARSFAIRAREYDPSFEAPNQVLAVADTIIAGESII 63
           G NR EAERWL  A K+LS+ D  GARSFAIRARE DP+++A   +L V DT++AGES I
Sbjct: 3   GGNRPEAERWLYTANKLLSARDLHGARSFAIRARESDPTYDASEHLLTVIDTLLAGESRI 62

Query: 64  ITSNGNQYH-DWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAW 122
                N +H DWY ILQ+ R+  +++ IA QYR+LALLL P RN F FA  +F LV DAW
Sbjct: 63  -----NDHHRDWYGILQILRYATNMDHIAAQYRRLALLLDPHRNMFAFASHAFSLVNDAW 117

Query: 123 SILSNPARKIMYDTDLQLSQLGERPRQTQMPPPPQPPQPIQSQPVRRSPPPPARRSPPPQ 182
           S+LSN A+K MYD++L+L  L         P PPQP    +  P  R  P P R    P+
Sbjct: 118 SVLSNSAKKAMYDSELRL--LTAPAPPQHHPLPPQPQPTPRRNPRSRDEPNPNR----PE 171

Query: 183 AKISPLNKDKGVSNRTVEEERSSSNNVTESTREARTSRTESNRPSEAAYEGPRFWTACPY 242
           +                           ES+R+ RT  T++         G  FWT+CPY
Sbjct: 172 S--------------------------AESSRQTRTVETDT---------GTSFWTSCPY 196

Query: 243 CYILYEYPKAYEDCTLKCQNCKRAFHGVMIAS-PPVTEKDTYFCCWGFFPVGYSGNAKDT 301
           CY+LYEYPK YE+CTL+CQ+C+R FH V+I S PP++ KD  +C WGFFP+G+SGN+KD 
Sbjct: 197 CYVLYEYPKVYEECTLRCQSCRRGFHAVVIRSPPPLSGKDGSYCSWGFFPLGFSGNSKDV 256

Query: 302 GGNFSKWTPVSPMFACPKPGQNNKKTNK----RVQVLYDEVLISDSESDPEESDDEW--G 355
            G+ S W P SP+F CP  G + ++  +             +     SD +  D +W  G
Sbjct: 257 NGHASNWNPFSPLFPCPLKGSSKRRPQRNWAYYDDDAAAAFIELSDPSDDDSGDGDWRVG 316

Query: 356 SNKKKKKAKNVKGKGNEVRKNVKRTPVERGKRGSQNQKENQNAG--GNVD---------G 404
            N+ +K+ +  K  G+      +R PVER +RG+    +N  +G  GNV+         G
Sbjct: 317 KNRGRKRTRGKKNSGDG-----RREPVERTRRGAHVGNDNVGSGASGNVNANAASAVLAG 371

Query: 405 MVGTSSGGGGARVLRSSGKKQMGNGLDLNVEFSNELEEPMAAVPPRM-NPENGMEDNIDG 463
             G SS       LR  G   +G  LDLNVEFSNE+EEP   V  R  N     EDNI+G
Sbjct: 372 ARGESSKKAALGGLRRRGAGNLGK-LDLNVEFSNEVEEPSRGVHNREGNAAGHAEDNIEG 430

Query: 464 V-FFEGLDEFLSSLPILNVVKDDKVK 488
           + FFEGLDEFLSSLPILNVV DDKVK
Sbjct: 431 IGFFEGLDEFLSSLPILNVVADDKVK 456

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357476275|ref|XP_003608423.1| hypothetical protein MTR_4g093930 [Medicago truncatula] gi|355509478|gb|AES90620.1| hypothetical protein MTR_4g093930 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356519465|ref|XP_003528393.1| PREDICTED: uncharacterized protein LOC100812412 [Glycine max] Back     alignment and taxonomy information
>gi|356546751|ref|XP_003541786.1| PREDICTED: uncharacterized protein LOC100818960 [Glycine max] Back     alignment and taxonomy information
>gi|225462428|ref|XP_002263945.1| PREDICTED: uncharacterized protein LOC100253681 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356557579|ref|XP_003547093.1| PREDICTED: uncharacterized protein LOC100778926 [Glycine max] Back     alignment and taxonomy information
>gi|15237681|ref|NP_201241.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|30698003|ref|NP_851265.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|79332130|ref|NP_001032136.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|9759412|dbj|BAB09867.1| unnamed protein product [Arabidopsis thaliana] gi|110740701|dbj|BAE98452.1| hypothetical protein [Arabidopsis thaliana] gi|134031896|gb|ABO45685.1| At5g64360 [Arabidopsis thaliana] gi|222423220|dbj|BAH19587.1| AT5G64360 [Arabidopsis thaliana] gi|332010495|gb|AED97878.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332010496|gb|AED97879.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332010497|gb|AED97880.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147772368|emb|CAN73431.1| hypothetical protein VITISV_031217 [Vitis vinifera] Back     alignment and taxonomy information
>gi|42570619|ref|NP_851264.2| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332010494|gb|AED97877.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224141167|ref|XP_002323946.1| predicted protein [Populus trichocarpa] gi|222866948|gb|EEF04079.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
TAIR|locus:2173443464 EIP9 "EMF1-Interacting Protein 0.495 0.523 0.393 3.2e-81
TAIR|locus:2144726280 AT5G09540 [Arabidopsis thalian 0.279 0.489 0.539 5.4e-59
TAIR|locus:2015529 797 AT1G62970 [Arabidopsis thalian 0.277 0.170 0.507 1.7e-55
TAIR|locus:2065393311 AT2G01710 "AT2G01710" [Arabido 0.269 0.424 0.485 1.8e-52
TAIR|locus:2169170431 AT5G37380 [Arabidopsis thalian 0.253 0.287 0.369 4.7e-22
TAIR|locus:2163786 726 AT5G53150 [Arabidopsis thalian 0.253 0.170 0.346 3.5e-19
TAIR|locus:2122950558 AT4G19570 [Arabidopsis thalian 0.269 0.236 0.369 3.3e-18
TAIR|locus:2051244 706 AT2G05230 [Arabidopsis thalian 0.242 0.168 0.368 5e-18
TAIR|locus:2051274 706 AT2G05250 [Arabidopsis thalian 0.242 0.168 0.368 5e-18
TAIR|locus:2040110 656 AT2G25560 [Arabidopsis thalian 0.255 0.190 0.335 7e-17
TAIR|locus:2173443 EIP9 "EMF1-Interacting Protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 451 (163.8 bits), Expect = 3.2e-81, Sum P(2) = 3.2e-81
 Identities = 111/282 (39%), Positives = 143/282 (50%)

Query:   236 FWTACPYCYILYEYPKAYEDCTLKCQNCKRAFHGVMIASPPVTEKD---TYFCCWGFFPV 292
             FWTACPYC++L+EYPKAYE+CTLKCQ C+RAF  V I  PPV +KD    YFC W  FP+
Sbjct:   195 FWTACPYCFVLFEYPKAYEECTLKCQECRRAFQAVTIPKPPVDKKDDEDVYFCSWALFPL 254

Query:   293 GYSGNAKDTGGNFSKWTPVSPMFACPKP---GQNNKKTNKRVQVLY---DEVLIXXXXXX 346
             G+SG  +        W+P+SP+FACP     G+  K+       +Y   D++ +      
Sbjct:   255 GFSGEFQAPS-----WSPISPLFACPLQKLDGEPKKRKEPGPPRIYYDDDDIYVAISDGD 309

Query:   347 XXXXXXXWXXXXXXXXXXXXXXXXXE-VRKNVKRTPVERGKRGSQNQKENQNAGGN-VDX 404
                    W                   VR N K      G    QN +   +A  + V  
Sbjct:   310 DAGDDGDWQDVVQVNKKTNVGKGKETYVRSNKKH-----GVEEVQNVESISSASNHAVSI 364

Query:   405 XXXXXXXXXXARVLRSSG----KKQMGNG------LDLNVEFSNELEEPMAAVPPRMNPE 454
                         V+   G    +K+MG G      LDLNVEFSNE+EEP   V    N  
Sbjct:   365 ASNAAAVGSSTGVMSKPGSYITRKRMGTGAKNLGRLDLNVEFSNEVEEP--GVAGGGNAG 422

Query:   455 NGME-----DNIDGV-FFEGLDEFLSSLPILNVVKDDKVKPT 490
             NG+      DN++G+ FFEGLDEFL+SLPIL+VV DDK+K T
Sbjct:   423 NGIGSNREVDNMEGIGFFEGLDEFLNSLPILSVVGDDKIKAT 464
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0009909 "regulation of flower development" evidence=IMP
TAIR|locus:2144726 AT5G09540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015529 AT1G62970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065393 AT2G01710 "AT2G01710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169170 AT5G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163786 AT5G53150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122950 AT4G19570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051244 AT2G05230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051274 AT2G05250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040110 AT2G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00007544001
SubName- Full=Chromosome undetermined scaffold_193, whole genome shotgun sequence; (486 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-11
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 5e-09
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-08
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-07
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-06
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 3e-05
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-05
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-04
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-04
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-04
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-04
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 6e-04
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 8e-04
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 0.001
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 0.001
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 0.001
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 0.001
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 0.003
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 0.003
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 0.003
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 58.7 bits (143), Expect = 2e-11
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 73  DWYAILQLARFTHSIELIATQYRKLALLLSPERNRF-PFADRSFKLVYDAWSILSNPARK 131
           D+Y IL + R   S E I   YRKLAL   P++N   P A+  FK + +A+ +LS+P ++
Sbjct: 1   DYYEILGVPR-DASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKR 59

Query: 132 IMYD 135
            +YD
Sbjct: 60  AIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 490
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.84
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14288369 chaperone protein DnaJ; Provisional 99.73
PRK14296372 chaperone protein DnaJ; Provisional 99.73
PRK14279392 chaperone protein DnaJ; Provisional 99.69
PRK14287371 chaperone protein DnaJ; Provisional 99.67
PRK14286372 chaperone protein DnaJ; Provisional 99.67
PRK14276380 chaperone protein DnaJ; Provisional 99.67
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.67
PRK14299291 chaperone protein DnaJ; Provisional 99.67
PRK14298377 chaperone protein DnaJ; Provisional 99.67
PRK14283378 chaperone protein DnaJ; Provisional 99.66
PRK14291382 chaperone protein DnaJ; Provisional 99.66
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PRK14278378 chaperone protein DnaJ; Provisional 99.66
PRK14280376 chaperone protein DnaJ; Provisional 99.66
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.65
PRK14282369 chaperone protein DnaJ; Provisional 99.65
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.65
PRK14277386 chaperone protein DnaJ; Provisional 99.64
PRK14285365 chaperone protein DnaJ; Provisional 99.64
PRK14294366 chaperone protein DnaJ; Provisional 99.63
PRK14284391 chaperone protein DnaJ; Provisional 99.63
PRK14295389 chaperone protein DnaJ; Provisional 99.63
PRK14301373 chaperone protein DnaJ; Provisional 99.62
PRK14297380 chaperone protein DnaJ; Provisional 99.62
PRK10767371 chaperone protein DnaJ; Provisional 99.61
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.61
PRK14281397 chaperone protein DnaJ; Provisional 99.6
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.6
PRK14300372 chaperone protein DnaJ; Provisional 99.6
PRK14292371 chaperone protein DnaJ; Provisional 99.59
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
PRK14293374 chaperone protein DnaJ; Provisional 99.59
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
PRK14290365 chaperone protein DnaJ; Provisional 99.58
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
PRK14289386 chaperone protein DnaJ; Provisional 99.57
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.54
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.52
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.51
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.5
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.48
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.4
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.37
PRK05014171 hscB co-chaperone HscB; Provisional 99.3
PRK01356166 hscB co-chaperone HscB; Provisional 99.26
PHA03102153 Small T antigen; Reviewed 99.26
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.24
PRK00294173 hscB co-chaperone HscB; Provisional 99.22
PRK03578176 hscB co-chaperone HscB; Provisional 99.19
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.18
PHA02624 647 large T antigen; Provisional 99.05
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.03
PTZ00100116 DnaJ chaperone protein; Provisional 99.02
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.82
PRK01773173 hscB co-chaperone HscB; Provisional 98.79
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.75
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.69
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.54
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.93
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.68
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 96.74
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.33
KOG0431453 consensus Auxilin-like protein and related protein 96.22
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 95.6
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.81
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.12
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 92.66
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.06
PF1371736 zinc_ribbon_4: zinc-ribbon domain 90.83
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.12
PF1342844 TPR_14: Tetratricopeptide repeat 88.43
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 87.52
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 84.12
PRK00464154 nrdR transcriptional regulator NrdR; Validated 83.03
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 82.93
PRK1182760 hypothetical protein; Provisional 82.26
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 82.04
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.82
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.84  E-value=2e-21  Score=200.82  Aligned_cols=71  Identities=34%  Similarity=0.483  Sum_probs=68.1

Q ss_pred             CCChHhhhccccCCCCHHHHHHHHHHHHHHhCCCCCC-CcchHHHHHHHHHHHHHhCCchhhHhhhhhccccc
Q 011245           71 YHDWYAILQLARFTHSIELIATQYRKLALLLSPERNR-FPFADRSFKLVYDAWSILSNPARKIMYDTDLQLSQ  142 (490)
Q Consensus        71 ~~D~Y~ILgV~~~A~d~~eIKkaYRkLAl~lHPDKn~-~~~AeeaFk~I~eAYevLSDp~kRa~YD~~~~~~~  142 (490)
                      ..|||+||||+++| +.+|||+|||+||++||||+|+ .+.|+++|++|+|||+|||||+||+.||+++....
T Consensus         3 ~~dyYeiLGV~k~A-s~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~   74 (371)
T COG0484           3 KRDYYEILGVSKDA-SEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGF   74 (371)
T ss_pred             ccchhhhcCCCCCC-CHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccc
Confidence            57999999999999 8999999999999999999999 88999999999999999999999999999998764

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-05
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 2e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-04
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-04
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
Query: 73  DWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARKI 132
           D+Y IL ++R   S E +   YR+LAL   P++N  P A  +FK +  A+++LSNP ++ 
Sbjct: 8   DYYEILGVSRGA-SDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRK 66
Query: 133 MYD 135
            YD
Sbjct: 67  QYD 69
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-08
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-08
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 6e-08
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-07
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-07
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-07
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 6e-07
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 9e-07
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-06
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-06
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 7e-06
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 9e-06
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 9e-06
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-05
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-05
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-05
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-05
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-05
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-05
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-05
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-05
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 3e-04
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 7e-04
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 8e-04
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 51.3 bits (123), Expect = 1e-08
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 73  DWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPFADRSFKLVYDAWSILSNPARK 131
           D + +L +     S + +   YRKLA+LL P++   P ++ +FK V +A + L    + 
Sbjct: 28  DSWDMLGVKP-GASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKS 85
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.9
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.77
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.76
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.75
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.75
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.75
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.75
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.74
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.73
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.73
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.73
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.72
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.69
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.69
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.69
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.68
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.67
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.67
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.64
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.59
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.57
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.56
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.55
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.53
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.53
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.53
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.53
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.52
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.51
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.51
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.45
2guz_A71 Mitochondrial import inner membrane translocase su 99.42
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.37
2guz_B65 Mitochondrial import inner membrane translocase su 98.29
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.93
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 91.01
2l6j_A111 TPR repeat-containing protein associated with HSP; 90.9
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 90.7
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 90.67
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 86.87
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 86.52
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 86.36
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 85.44
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 85.25
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 84.39
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 84.16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 81.03
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 80.84
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 80.73
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 80.01
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=4e-24  Score=194.34  Aligned_cols=131  Identities=23%  Similarity=0.375  Sum_probs=100.9

Q ss_pred             CCCCChHhhhccccCCCCHHHHHHHHHHHHHHhCCCCCCCcc-------hHHHHHHHHHHHHHhCCchhhHhhhhhcccc
Q 011245           69 NQYHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRFPF-------ADRSFKLVYDAWSILSNPARKIMYDTDLQLS  141 (490)
Q Consensus        69 ~~~~D~Y~ILgV~~~A~d~~eIKkaYRkLAl~lHPDKn~~~~-------AeeaFk~I~eAYevLSDp~kRa~YD~~~~~~  141 (490)
                      ....|||+||||++.+ +.++||++||+|++++||||+....       |.+.|++|++||++|+||.+|+.||..+...
T Consensus         7 ~~~~~~y~iLgv~~~a-~~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd~~~~~~   85 (155)
T 2l6l_A            7 MPKKDWYSILGADPSA-NISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCED   85 (155)
T ss_dssp             CCCSHHHHHHTCCTTC-CHHHHHHHHHHHHHHHSCCCCCCCCTTHHHHHHHHHHHHHHHHHHHSSSHHHHCHHHHHHHHH
T ss_pred             CCCCChhHhcCCCCCC-CHHHHHHHHHHHHHHHCcCCCCCCCchhHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHcchh
Confidence            3467999999999999 8999999999999999999998643       6789999999999999999999999888643


Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCCccccccccCCCCcccccccccccCC
Q 011245          142 QLGERPRQTQMPPPPQPPQPIQSQPVRRSPPPPARRSPPPQAKISPLNKDKGVSNRTVEEERSSSNNVTESTREARTSRT  221 (490)
Q Consensus       142 ~~~~~~~~~qp~~p~~~~qp~q~~~~~~~pp~p~~~p~~p~~~n~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  221 (490)
                      ....  ..                             +..+.      +.      .          .            
T Consensus        86 ~~~~--~~-----------------------------~~~~~------~~------~----------~------------  100 (155)
T 2l6l_A           86 DLRN--VG-----------------------------PVDAQ------VY------L----------E------------  100 (155)
T ss_dssp             HHHT--TC-----------------------------SSSEE------EE------T----------T------------
T ss_pred             hccc--cc-----------------------------cccce------ee------H----------H------------
Confidence            2110  00                             00000      00      0          0            


Q ss_pred             CCCCCCCCCCCCCceeeeCcchhhhhcchhhhcC--ceeeccccCCceeee
Q 011245          222 ESNRPSEAAYEGPRFWTACPYCYILYEYPKAYED--CTLKCQNCKRAFHGV  270 (490)
Q Consensus       222 ~~~~~~~~~~~~~TFWT~Cp~C~~~YEY~R~YlN--~~LrCqnC~k~F~A~  270 (490)
                      +..    -.....+|||.|+ |...|+|.+..++  ..+.|++|...|.++
T Consensus       101 ~m~----~~e~~~~f~~~Cr-CG~~f~i~~~~l~~~~~v~C~sCSl~~~v~  146 (155)
T 2l6l_A          101 EMS----WNEGDHSFYLSCR-CGGKYSVSKDEAEEVSLISCDTCSLIIELL  146 (155)
T ss_dssp             TSE----EETTTTEEEEECS-SSCEEEEETTHHHHCCEEECSSSSCEEEEE
T ss_pred             Hhc----cccCCcEEEEcCC-CCCeEEecHHHhCCCCEEECCCCceEEEEE
Confidence            000    0002469999998 9999999999998  899999999999875
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 490
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-08
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 6e-06
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-06
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 0.001
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSC20 (HSCB), N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 49.6 bits (118), Expect = 1e-08
 Identities = 10/74 (13%), Positives = 26/74 (35%), Gaps = 7/74 (9%)

Query: 73  DWYAILQLAR-FTHSIELIATQYRKLALLLSPERNRFPFAD------RSFKLVYDAWSIL 125
           D++ +  L   +    + ++ +++ L     P++             +    +  AW  L
Sbjct: 2   DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTL 61

Query: 126 SNPARKIMYDTDLQ 139
            +P  +  Y   L 
Sbjct: 62  RHPLMRAEYLLSLH 75
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.8
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.75
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.68
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.61
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.55
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.49
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.46
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 92.69
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 91.33
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 87.52
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.35
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 80.86
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.80  E-value=4.3e-20  Score=148.46  Aligned_cols=70  Identities=26%  Similarity=0.475  Sum_probs=64.8

Q ss_pred             CCChHhhhccccCCCCHHHHHHHHHHHHHHhCCCCCCC-cchHHHHHHHHHHHHHhCCchhhHhhhhhcccc
Q 011245           71 YHDWYAILQLARFTHSIELIATQYRKLALLLSPERNRF-PFADRSFKLVYDAWSILSNPARKIMYDTDLQLS  141 (490)
Q Consensus        71 ~~D~Y~ILgV~~~A~d~~eIKkaYRkLAl~lHPDKn~~-~~AeeaFk~I~eAYevLSDp~kRa~YD~~~~~~  141 (490)
                      ..|||+||||+++| +.++||++||+|++++|||+++. +.+++.|++|++||+||+||.+|..||..+...
T Consensus         2 k~dyY~vLgv~~~A-s~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           2 KQDYYEILGVSKTA-EEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCTTTTTCCSSSC-CHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCHHHHcCCCCCc-CHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            47999999999999 89999999999999999999984 678889999999999999999999999988643
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure