Citrus Sinensis ID: 011382

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------

MSLDDVDSQQQLSGATNYETAGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQQVARGSTAVPCNDGIEEVREQIEEAAGMQSQSFSSAEQGVPSHVDDEFEKWQREVREAEIEAERLKNGSASDSVGGYMGRDDHDGVPASPEGEDEFTDDDGTRYKWDRGLRAWVPQEDTSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNSTEEKVNSADNVVEEKHNGKRKQPDKQVEKKEANKPPDSWFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQVDSKKKKKLKKVEEKMLGWGGRDDAKLTIPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQVI

cccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHcccccccEEEEEccccccccccccccHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHccccccccHHHHHHHcccccccccccccccEEEEccccccccHHHHHHHHHccccccccccccccEEEEEEcccccccEEEEEEEEccHHHHHHHHHHHccccccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccHHcccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEEcccccccccc

cccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHcccccccEEEEcccccccccHHcHHHHHHHHHHHcccccccccccccccccccccccHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEcccccEEEEcHcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccHcccccccccccccccccccEEEEccccccccHHHHHHHHHHccEEEEcccccccEEEEEEEcccccccccEEEEEccHHHHHHHHHHHcccccccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccHHHHHHcHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEEHcccccccc

mslddvdsqqqlsgatnyetageegWYILDenqqhvgpyAISELCEHFLNGYLLETTLVWSqgrsewqplssipqfLSGISQQvargstavpcndgIEEVREQIEEAAgmqsqsfssaeqgvpshvddEFEKWQREVREAEIEAERlkngsasdsvggymgrddhdgvpaspegedeftdddgtrykwdrglrawvpqedtssqndgygieemtflkeeevfptvnvtddlandevgkekLNSTEEKVNSADNVVeekhngkrkqpdkqvekkeankppdswfelkVNTHVYVTGLPDDVTVEEMVEVFSKCgiikedpetkkprikiyvdketgmkkGDALVTYLKEPSVALATQlldgtpfrpdgkipmsVTQAKFEQKGERFIAKQVDSKKKKKLKKVEEKMlgwggrddakltipATVILRFmftpaemradENLRSELEADVQEEcvkigpvdsVKVMKLNVEINCILIIFLLEFMGLPQVI

mslddvdsqqqlsgatnyeTAGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQQVARGSTAVPCNDGIEEVREQIEEAAGMQSQSFSSAEQGVPSHVDDEFEKWQREVREAEieaerlkngsasdsvggymGRDDHDgvpaspegedeftdddgtrYKWDrglrawvpqedtssqndgYGIEEMTFLKEEEVFPTVNVTddlandevgkeklnsteekvnsadnvveekhngkrkqpdkqvekkeankppdswfelkVNTHVYVTGLPDDVTVEEMVEVFSkcgiikedpetkkprikiyvdketgmkKGDALVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQakfeqkgerfiakqvdskkkkklKKVEekmlgwggrddakltiPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQVI

MSLDDVDSQQQLSGATNYETAGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQQVARGSTAVPCNDGIEEVREQIEEAAGMQSQSFSSAEQGVPSHVDDEFEKWQrevreaeieaerLKNGSASDSVGGYMGRDDHDGVPASPegedeftdddgtRYKWDRGLRAWVPQEDTSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNSTEEKVNSADNVVEEKHNGKRKQPDKQVEKKEANKPPDSWFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQVDSkkkkklkkveekMLGWGGRDDAKLTIPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQVI

********************AGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGIS********************************************************************************************************YKWDRGLRAWV***********YGIEEMTFLKEEEVFPTVNV******************************************************WFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDP***KPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDG*********************************************LGWGGRDDAKLTIPATVILRFMFTPAEM**********EADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGL****

**********************EEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSG***************************************************************************************************TDDDGTRYKWDRGLRAWVPQED**************************************************************************************VNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPDGKI************************************************IPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQVI

**************ATNYETAGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQQVARGSTAVPCNDGIEEVREQIEE********************DDEFEKWQREVREAEIEAERLKNGSASDSVGGYMGRDDHD**************DDGTRYKWDRGLRAWVPQEDTSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNSTEEKVNSADN*************************PDSWFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQ***********VEEKMLGWGGRDDAKLTIPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQVI

******************ETAGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQQVARG************************************SHVDDEFEKWQREVREAEIEAERLKN************************GEDEFTDDDGTRYKWDRGLRAWVPQEDTSSQNDGYGIEE********************************************************************SWFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQVDSKKKKKLKKVEEKMLGWGGRDDAKLTIPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQ**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSLDDVDSQQQLSGATNYETAGEEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQQVARGSTAVPCNDGIEEVREQIEEAAGMQSQSFSSAEQGVPSHVDDExxxxxxxxxxxxxxxxxxxxxSASDSVGGYMGRDDHDGVPASPEGEDEFTDDDGTRYKWDRGLRAWVPQEDTSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNSTEEKVNSADNVVEEKHNGKRKQPDKQVEKKEANKPPDSWFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQVDSKKKKKLKKVEEKMLGWGGRDDAKLTIPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFLLEFMGLPQVI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		487	2.2.26 [Sep-21-2011]
O43719		755	HIV Tat-specific factor 1	yes	no	0.509	0.328	0.314	1e-22
Q5RB63		754	HIV Tat-specific factor 1	yes	no	0.509	0.328	0.314	3e-22
Q8BGC0		757	HIV Tat-specific factor 1	yes	no	0.507	0.326	0.336	6e-22
O43120		367	Splicing factor U2AF-asso	yes	no	0.355	0.471	0.371	7e-21
Q61545		655	RNA-binding protein EWS O	no	no	0.158	0.117	0.428	5e-13
P53830		285	Cold sensitive U2 snRNA s	yes	no	0.347	0.592	0.342	5e-13
Q01844		656	RNA-binding protein EWS O	no	no	0.158	0.117	0.428	9e-13
P56959		518	RNA-binding protein FUS O	no	no	0.186	0.175	0.358	4e-10
Q28009		513	RNA-binding protein FUS O	no	no	0.186	0.177	0.358	5e-10
P35637		526	RNA-binding protein FUS O	no	no	0.186	0.173	0.358	5e-10

>sp\|O43719\|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens GN=HTATSF1 PE=1 SV=1	Back alignment and function desciption

 Score =  108 bits (269), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 135/280 (48%), Gaps = 32/280 (11%)

Query: 184 TRYKWDRGLRAWVPQEDTSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNS 243
           T Y+WD   +AW P+              +T    E+   T       +ND       N 
Sbjct: 48  TPYEWDLDKKAWFPK--------------IT----EDFIATYQANYGFSNDGASSSTANV 89

Query: 244 TEEKVNSADNVVEEKHNGKRKQPDKQVEKKEANKPPDSWFELK--VNTHVYVTGLPDDVT 301
            +    +A+   +EK      +P    +K E  K    WF ++   NT+VYV+GLP D+T
Sbjct: 90  EDVHARTAEEPPQEKA----PEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDIT 145

Query: 302 VEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGT 361
           V+E +++ SK GII  DP+T++ ++K+Y D + G  KGD L  YLK  SV LA +LLD  
Sbjct: 146 VDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQ-GNLKGDGLCCYLKRESVELALKLLDED 204

Query: 362 PFRPDGKIPMSVTQAKFEQKGERFIAKQVDSKKKKKLK-KVEEKMLGWGGRDDA---KLT 417
             R      + V  AKF+ KGE   +K+    K  K K  +++K L W     A   ++ 
Sbjct: 205 EIR---GYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQLDWRPERRAGPSRMR 261

Query: 418 IPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPV 457
               VI++ MF P +   D  + +E+  D++ EC K G +
Sbjct: 262 HERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQI 301

Functions as a general transcription factor playing a role in the process of transcriptional elongation. May mediate the reciprocal stimulatory effect of splicing on transcriptional elongation. In case of infection by HIV-1, it is up-regulated by the HIV-1 proteins NEF and gp120, acts as a cofactor required for the Tat-enhanced transcription of the virus.
Homo sapiens (taxid: 9606)

>sp\|Q5RB63\|HTSF1_PONAB HIV Tat-specific factor 1 homolog OS=Pongo abelii GN=HTATSF1 PE=2 SV=1	Back alignment and function description

>sp\|Q8BGC0\|HTSF1_MOUSE HIV Tat-specific factor 1 homolog OS=Mus musculus GN=Htatsf1 PE=1 SV=1	Back alignment and function description

>sp\|O43120\|UAP2_SCHPO Splicing factor U2AF-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap2 PE=1 SV=1	Back alignment and function description

>sp\|Q61545\|EWS_MOUSE RNA-binding protein EWS OS=Mus musculus GN=Ewsr1 PE=1 SV=2	Back alignment and function description

>sp\|P53830\|CUS2_YEAST Cold sensitive U2 snRNA suppressor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUS2 PE=1 SV=1	Back alignment and function description

>sp\|Q01844\|EWS_HUMAN RNA-binding protein EWS OS=Homo sapiens GN=EWSR1 PE=1 SV=1	Back alignment and function description

>sp\|P56959\|FUS_MOUSE RNA-binding protein FUS OS=Mus musculus GN=Fus PE=2 SV=1	Back alignment and function description

>sp\|Q28009\|FUS_BOVIN RNA-binding protein FUS OS=Bos taurus GN=FUS PE=2 SV=2	Back alignment and function description

>sp\|P35637\|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens GN=FUS PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		487
317106644		552	JHL23J11.4 [Jatropha curcas]	0.893	0.788	0.65	1e-158
224112381		497	predicted protein [Populus trichocarpa]	0.856	0.839	0.635	1e-151
356535254		503	PREDICTED: HIV Tat-specific factor 1 hom	0.866	0.838	0.592	1e-144
255543755		518	Splicing factor U2AF-associated protein,	0.860	0.808	0.582	1e-142
297807655		519	RNA recognition motif-containing protein	0.919	0.863	0.581	1e-137
356576634		500	PREDICTED: HIV Tat-specific factor 1 hom	0.860	0.838	0.588	1e-137
15237311		519	HIV Tat-specific factor 1 [Arabidopsis t	0.921	0.865	0.565	1e-136
449518089		498	PREDICTED: HIV Tat-specific factor 1 hom	0.876	0.857	0.584	1e-134
449457363		496	PREDICTED: HIV Tat-specific factor 1 hom	0.870	0.854	0.585	1e-134
413924809		475	hypothetical protein ZEAMMB73_003429 [Ze	0.839	0.861	0.571	1e-130

>gi\|317106644\|dbj\|BAJ53149.1\| JHL23J11.4 [Jatropha curcas]	Back alignment and taxonomy information

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 312/480 (65%), Positives = 363/480 (75%), Gaps = 45/480 (9%)

Query: 23  EEGWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWSQGRSEWQPLSSIPQFLSGISQ 82
           E GWYIL ENQQH+GPYA SEL EHFLNGYL E+TLVWS+GR  WQPLSSIP+ +SGISQ
Sbjct: 35  EVGWYILGENQQHLGPYASSELREHFLNGYLSESTLVWSEGRVVWQPLSSIPELISGISQ 94

Query: 83  QVARGSTAVPCNDGIE-EVREQIEEA----AGMQSQSFSSAEQ------GVPSHVDD-EF 130
           Q A  S A   N   E E  + +EE      G +++S S+ ++       VP   DD EF
Sbjct: 95  QKADSSIAARTNSDNELEKSDDVEETERGNVGFKNESHSTDKEQAKDSSSVPFSDDDAEF 154

Query: 131 EKWQREVREAEIEAERLKNGSASDSVGGYMGRDDHDGVPASPEGEDEFTDDDGTRYKWDR 190
           EKWQREVR+AE EA++LKNGS S S+G  +G        + PEGE+EFTDDDGT YKWDR
Sbjct: 155 EKWQREVRDAEAEAQQLKNGSDSGSIGAGVG------AMSPPEGEEEFTDDDGTTYKWDR 208

Query: 191 GLRAWVPQEDTSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNSTEEKVNS 250
           GLRAWVPQ+DTSS    YG++EMTFL+EEEVFPTVN+ D             +++EK N 
Sbjct: 209 GLRAWVPQDDTSSMGGQYGLDEMTFLQEEEVFPTVNIED------------AASKEKFNG 256

Query: 251 ADNVVEEKHNGKRK-----------QPDK---QVEKKEANKPPDSWFELKVNTHVYVTGL 296
             + +E KHNGKRK           QPDK   Q + KEANK PDSWFELKVNTH+YVTGL
Sbjct: 257 TSDTLEPKHNGKRKLMDMQTDNNEKQPDKKEKQADNKEANKAPDSWFELKVNTHIYVTGL 316

Query: 297 PDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQ 356
           PDDVT EE+VEVFSKCGIIKEDPETKKPR+KIYVDKETG  KGDAL+TYLKEPSV LA Q
Sbjct: 317 PDDVTAEEVVEVFSKCGIIKEDPETKKPRVKIYVDKETGRTKGDALITYLKEPSVDLAMQ 376

Query: 357 LLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQVDSKKKKKLKKVEEKMLGWGGRDDAKL 416
           +LDGTP RP G IPMSV++AKFEQKG+RFI K+VD+KKKKKLK+VEEK+LGWGGRDDAK+
Sbjct: 377 ILDGTPLRPGGTIPMSVSRAKFEQKGDRFIPKKVDNKKKKKLKRVEEKILGWGGRDDAKV 436

Query: 417 TIPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIF 476
            IPATV+LR+MFTPAEMRADENLRSELE DV+EECVK+GPVDSVKV + N     +L+ F
Sbjct: 437 LIPATVVLRYMFTPAEMRADENLRSELELDVKEECVKLGPVDSVKVCE-NHPQGVVLVRF 495

Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224112381\|ref\|XP_002316170.1\| predicted protein [Populus trichocarpa] gi\|222865210\|gb\|EEF02341.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356535254\|ref\|XP_003536163.1\| PREDICTED: HIV Tat-specific factor 1 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|255543755\|ref\|XP_002512940.1\| Splicing factor U2AF-associated protein, putative [Ricinus communis] gi\|223547951\|gb\|EEF49443.1\| Splicing factor U2AF-associated protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|297807655\|ref\|XP_002871711.1\| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297317548\|gb\|EFH47970.1\| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356576634\|ref\|XP_003556435.1\| PREDICTED: HIV Tat-specific factor 1 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|15237311\|ref\|NP_197130.1\| HIV Tat-specific factor 1 [Arabidopsis thaliana] gi\|9755836\|emb\|CAC01867.1\| putative protein [Arabidopsis thaliana] gi\|63003814\|gb\|AAY25436.1\| At5g16260 [Arabidopsis thaliana] gi\|110738266\|dbj\|BAF01062.1\| hypothetical protein [Arabidopsis thaliana] gi\|332004883\|gb\|AED92266.1\| HIV Tat-specific factor 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449518089\|ref\|XP_004166076.1\| PREDICTED: HIV Tat-specific factor 1 homolog [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449457363\|ref\|XP_004146418.1\| PREDICTED: HIV Tat-specific factor 1 homolog [Cucumis sativus]	Back alignment and taxonomy information

>gi\|413924809\|gb\|AFW64741.1\| hypothetical protein ZEAMMB73_003429 [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		487
TAIR\|locus:2181452		519	ELF9 "EARLY FLOWERING 9" [Arab	0.940	0.882	0.498	5.4e-118
ZFIN\|ZDB-GENE-040426-1578		450	htatsf1 "HIV TAT specific fact	0.531	0.575	0.351	8.8e-31
UNIPROTKB\|F1P1G7		450	HTATSF1 "Uncharacterized prote	0.525	0.568	0.342	3e-28
UNIPROTKB\|E2R8T8		750	HTATSF1 "Uncharacterized prote	0.521	0.338	0.310	1.1e-22
UNIPROTKB\|J9NZQ1		768	HTATSF1 "Uncharacterized prote	0.521	0.330	0.310	1.2e-22
ASPGD\|ASPL0000056254		396	AN1188 [Emericella nidulans (t	0.492	0.606	0.320	1.5e-22
UNIPROTKB\|G4MSB8		410	MGG_04442 "Splicing factor U2A	0.205	0.243	0.485	2.2e-22
UNIPROTKB\|I3LC46		760	HTATSF1 "Uncharacterized prote	0.521	0.334	0.306	2.6e-22
UNIPROTKB\|O43719		755	HTATSF1 "HIV Tat-specific fact	0.474	0.305	0.322	4.3e-22
POMBASE\|SPBC1289.02c		367	uap2 "U2 snRNP-associated prot	0.464	0.615	0.326	5e-22

TAIR\|locus:2181452 ELF9 "EARLY FLOWERING 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1162 (414.1 bits), Expect = 5.4e-118, P = 5.4e-118
 Identities = 238/477 (49%), Positives = 306/477 (64%)

Query:     3 LDDVDSQQQLSGATNYETAGEE-GWYILDENQQHVGPYAISELCEHFLNGYLLETTLVWS 61
             + D D+ Q    +T    A  + GWYIL ENQQ++GPY  SELC HF NGYLLETTLVW+
Sbjct:     1 MSDSDNLQLPPSSTGATVAATDVGWYILGENQQNLGPYTFSELCNHFRNGYLLETTLVWA 60

Query:    62 QGRSEWQPLSSIPQFLSGISQQVARGSTAVPCNDGIEEVREQIEEAAGMQSQSFSSAEQG 121
              GRSEWQPLS+IP  +S IS        A P   G   +          + Q ++++   
Sbjct:    61 DGRSEWQPLSAIPDLMSRISG----AEIAYPAV-GSSGLINGSNAGTRQEKQDYTAS--- 112

Query:   122 VPSHVDDEFEKWQXXXXXXXXXXXXLKNGSASDSVGGYMGRDDHDGVPASPXXXXXXXXX 181
               +  +DEFEKWQ            LKNGS S   G  +  DDH+   + P         
Sbjct:   113 --ASTEDEFEKWQREIKDAEAEAERLKNGSVS---GTELVEDDHERASSPPEGEDEFTDD 167

Query:   182 XXXRYKWDRGLRAWVPQEDTSSQN-DGYGIEEMTFLKEEEVFPTVNVTD-DLANDEVGKE 239
                +YKWDR  R WVPQ+D    + D YG+EEMTF KE+EVFPT+N+ D  +   +  K+
Sbjct:   168 DGTKYKWDRARRVWVPQDDPPLGSVDPYGLEEMTFAKEDEVFPTINILDTSVDKKDASKD 227

Query:   240 KLNSTEEKVNSADNVVEEKHNGKRKQPDKQVEKKEANKPPDSWFELKVNTHVYVTGLPDD 299
              +   +E+ + +D   E   NGKRK P+ + EKKE NKPPDSWFELKVN H+YV GLPDD
Sbjct:   228 DVAGKKEE-DGSDETAEINSNGKRKLPEPETEKKEPNKPPDSWFELKVNPHIYVNGLPDD 286

Query:   300 VTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLD 359
             VT+EE+ EVFSKCGIIKED +T KPRIK+Y DK TG  KGDAL++Y+KEPSV LA ++LD
Sbjct:   287 VTIEEVAEVFSKCGIIKED-DTGKPRIKLYSDKATGKLKGDALISYMKEPSVDLAIKILD 345

Query:   360 GTPFRPDGKIPMSVTQAKFEQKGERFIAKQVDSXXXXXXXXXXXXMLGWGGRDDAKLTIP 419
             G P RP  K+ MSV++AKFEQKGERFI KQ D+            +LGWGG DD+K++IP
Sbjct:   346 GAPLRPADKLLMSVSRAKFEQKGERFITKQTDNKKKKKLKKVEQKLLGWGGTDDSKVSIP 405

Query:   420 ATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIF 476
             ATV+LR+MF+PAE+ ADE+L +ELE DV+EE +K GP DSVKV + + +   +L+ F
Sbjct:   406 ATVVLRYMFSPAELMADEDLVAELEEDVKEESLKHGPFDSVKVCEHHPQ-GVVLVRF 461

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003723 "RNA binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=IMP

GO:0003729 "mRNA binding" evidence=IDA

GO:0009910 "negative regulation of flower development" evidence=IMP

GO:0005829 "cytosol" evidence=IDA

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA

GO:0016246 "RNA interference" evidence=RCA

ZFIN\|ZDB-GENE-040426-1578 htatsf1 "HIV TAT specific factor 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P1G7 HTATSF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R8T8 HTATSF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NZQ1 HTATSF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000056254 AN1188 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

UNIPROTKB\|G4MSB8 MGG_04442 "Splicing factor U2AF-associated protein 2" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LC46 HTATSF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|O43719 HTATSF1 "HIV Tat-specific factor 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

POMBASE\|SPBC1289.02c uap2 "U2 snRNP-associated protein Uap2" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		487
cd12281		92	cd12281, RRM1_TatSF1_like, RNA recognition motif 1	6e-47
cd12533		84	cd12533, RRM_EWS, RNA recognition motif in vertebr	2e-17
cd12280		81	cd12280, RRM_FET, RNA recognition motif in the FET	3e-17
cd12534		83	cd12534, RRM_SARFH, RNA recognition motif in Droso	5e-17
cd12535		86	cd12535, RRM_FUS_TAF15, RNA recognition motif in v	1e-13
cd12285		85	cd12285, RRM3_RBM39_like, RNA recognition motif 3	1e-11
smart00360		73	smart00360, RRM, RNA recognition motif	5e-11
pfam14237		45	pfam14237, DUF4339, Domain of unknown function (DU	3e-09
COG0724		306	COG0724, COG0724, RNA-binding proteins (RRM domain	7e-08
pfam00076		70	pfam00076, RRM_1, RNA recognition motif	8e-08
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	1e-07
cd12651		79	cd12651, RRM2_SXL, RNA recognition motif 2 in Dros	5e-07
cd12398		75	cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot	4e-06
cd12241		77	cd12241, RRM_SF3B14, RNA recognition motif found i	4e-06
cd12395		73	cd12395, RRM2_RBM34, RNA recognition motif 2 in RN	5e-06
cd12306		73	cd12306, RRM_II_PABPs, RNA recognition motif in ty	5e-06
cd12316		74	cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot	5e-06
pfam14259		69	pfam14259, RRM_6, RNA recognition motif (a	2e-05
cd12408		77	cd12408, RRM_eIF3G_like, RNA recognition motif in	3e-05
cd12354		73	cd12354, RRM3_TIA1_like, RNA recognition motif 2 i	7e-05
TIGR00239		929	TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenas	1e-04
cd12239		82	cd12239, RRM2_RBM40_like, RNA recognition motif 2	2e-04
cd12249		78	cd12249, RRM1_hnRNPR_like, RNA recognition motif 1	2e-04
cd12393		78	cd12393, RRM_ZCRB1, RNA recognition motif in Zinc	2e-04
cd12376		79	cd12376, RRM2_Hu_like, RNA recognition motif 2 in	3e-04
cd12240		78	cd12240, RRM_NCBP2, RNA recognition motif found in	3e-04
cd12328		73	cd12328, RRM2_hnRNPA_like, RNA recognition motif 2	3e-04
cd12382		80	cd12382, RRM_RBMX_like, RNA recognition motif in h	6e-04
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	7e-04
cd12392		81	cd12392, RRM2_SART3, RNA recognition motif 2 in sq	8e-04
TIGR01642		509	TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la	0.001
cd12652		79	cd12652, RRM2_Hu, RNA recognition motif 2 in the H	0.001
cd12336		75	cd12336, RRM_RBM7_like, RNA recognition motif in R	0.001
cd12384		76	cd12384, RRM_RBM24_RBM38_like, RNA recognition mot	0.002
cd12413		79	cd12413, RRM1_RBM28_like, RNA recognition motif 1	0.002
cd12482		79	cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v	0.002
cd12483		79	cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v	0.003
cd12375		77	cd12375, RRM1_Hu_like, RNA recognition motif 1 in	0.003
cd12362		73	cd12362, RRM3_CELF1-6, RNA recognition motif 3 in	0.003
cd12566		79	cd12566, RRM2_MRD1, RNA recognition motif 2 in yea	0.004

>gnl\|CDD\|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins	Back alignment and domain information

 Score =  157 bits (399), Expect = 6e-47
 Identities = 62/95 (65%), Positives = 71/95 (74%), Gaps = 3/95 (3%)

Query: 288 NTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLK 347
           NT+VYV+GLP D+TVEE VEVFSKCGIIKEDPET KP+IK+Y D+   + KGDAL  YLK
Sbjct: 1   NTNVYVSGLPLDITVEEFVEVFSKCGIIKEDPETGKPKIKLYRDENGNL-KGDALCCYLK 59

Query: 348 EPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKG 382
           E SV LA QLLDGT      K  M V +AKF+ KG
Sbjct: 60  EESVELAIQLLDGTEIGRGYK--MKVERAKFQLKG 92

This subfamily corresponds to the RRM1 of Tat-SF1 and CUS2. Tat-SF1 is the cofactor for stimulation of transcriptional elongation by human immunodeficiency virus-type 1 (HIV-1) Tat. It is a substrate of an associated cellular kinase. Tat-SF1 contains two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a highly acidic carboxyl-terminal half. The family also includes CUS2, a yeast homolog of human Tat-SF1. CUS2 interacts with U2 RNA in splicing extracts and functions as a splicing factor that aids assembly of the splicing-competent U2 snRNP in vivo. CUS2 also associates with PRP11 that is a subunit of the conserved splicing factor SF3a. Like Tat-SF1, CUS2 contains two RRMs as well. . Length = 92

>gnl\|CDD\|240977 cd12533, RRM_EWS, RNA recognition motif in vertebrate Ewing Sarcoma Protein (EWS)	Back alignment and domain information

>gnl\|CDD\|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins	Back alignment and domain information

>gnl\|CDD\|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins	Back alignment and domain information

>gnl\|CDD\|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused in Ewing's sarcoma protein (FUS), TATA-binding protein-associated factor 15 (TAF15) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins	Back alignment and domain information

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|206405 pfam14237, DUF4339, Domain of unknown function (DUF4339)	Back alignment and domain information

>gnl\|CDD\|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|215696 pfam00076, RRM_1, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1)	Back alignment and domain information

>gnl\|CDD\|222631 pfam14259, RRM_6, RNA recognition motif (a	Back alignment and domain information

>gnl\|CDD\|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1	Back alignment and domain information

>gnl\|CDD\|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component	Back alignment and domain information

>gnl\|CDD\|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins	Back alignment and domain information

>gnl\|CDD\|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily	Back alignment and domain information

>gnl\|CDD\|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>gnl\|CDD\|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family	Back alignment and domain information

>gnl\|CDD\|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R)	Back alignment and domain information

>gnl\|CDD\|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)	Back alignment and domain information

>gnl\|CDD\|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins	Back alignment and domain information

>gnl\|CDD\|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		487
KOG1548		382	consensus Transcription elongation factor TAT-SF1	100.0
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.91
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.91
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.9
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	99.89
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.79
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.76
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.76
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.72
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	99.71
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	99.71
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.69
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.68
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.68
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.66
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.66
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.65
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.61
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	99.61
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	99.59
PF14237		45	DUF4339: Domain of unknown function (DUF4339)	99.56
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.53
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	99.53
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.52
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.51
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.51
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.47
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	99.43
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.43
KOG0122		270	consensus Translation initiation factor 3, subunit	99.41
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	99.41
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	99.38
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	99.37
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	99.37
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.35
PLN03120		260	nucleic acid binding protein; Provisional	99.34
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.34
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	99.33
COG0724		306	RNA-binding proteins (RRM domain) [General functio	99.31
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	99.3
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	99.3
smart00362		72	RRM_2 RNA recognition motif.	99.25
PLN03213		759	repressor of silencing 3; Provisional	99.25
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	99.24
PLN03121		243	nucleic acid binding protein; Provisional	99.23
smart00360		71	RRM RNA recognition motif.	99.21
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	99.16
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	99.16
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	99.15
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.14
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	99.12
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	99.12
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	99.12
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	99.12
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	99.11
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	99.08
KOG4207		256	consensus Predicted splicing factor, SR protein su	99.08
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	99.07
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	99.06
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	99.04
KOG1995		351	consensus Conserved Zn-finger protein [General fun	99.0
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	98.99
KOG1789		2235	consensus Endocytosis protein RME-8, contains DnaJ	98.92
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.9
smart00361		70	RRM_1 RNA recognition motif.	98.89
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	98.85
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	98.84
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	98.77
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.73
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	98.68
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.64
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	98.61
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.49
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.47
KOG0533		243	consensus RRM motif-containing protein [RNA proces	98.47
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	98.41
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	98.4
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.35
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	98.28
KOG0226		290	consensus RNA-binding proteins [General function p	98.28
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.24
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	98.2
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	98.14
KOG1457		284	consensus RNA binding protein (contains RRM repeat	98.14
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	98.1
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	98.03
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	97.94
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	97.93
cd00072		57	GYF GYF domain: contains conserved Gly-Tyr-Phe res	97.9
PF02213		57	GYF: GYF domain; InterPro: IPR003169 The glycine-t	97.86
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	97.6
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.56
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	97.52
KOG0151		877	consensus Predicted splicing regulator, contains R	97.5
KOG4660		549	consensus Protein Mei2, essential for commitment t	97.45
KOG4210		285	consensus Nuclear localization sequence binding pr	97.4
smart00444		56	GYF Contains conserved Gly-Tyr-Phe residues. Proli	97.39
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	97.37
KOG1996		378	consensus mRNA splicing factor [RNA processing and	97.16
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	97.13
smart00361		70	RRM_1 RNA recognition motif.	97.03
KOG4849		498	consensus mRNA cleavage factor I subunit/CPSF subu	96.96
KOG2314		698	consensus Translation initiation factor 3, subunit	96.71
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	96.57
KOG3152		278	consensus TBP-binding protein, activator of basal	96.54
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	96.51
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	96.35
COG5175		480	MOT2 Transcriptional repressor [Transcription]	96.33
PF05172		100	Nup35_RRM: Nup53/35/40-type RNA recognition motif;	96.11
KOG1457		284	consensus RNA binding protein (contains RRM repeat	96.05
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	95.98
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	95.97
KOG1548		382	consensus Transcription elongation factor TAT-SF1	95.89
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	95.77
KOG1855		484	consensus Predicted RNA-binding protein [General f	95.77
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	95.72
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	95.67
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	95.6
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	95.55
PLN03120		260	nucleic acid binding protein; Provisional	95.5
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	95.49
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	95.41
PF15519		73	RBM39linker: linker between RRM2 and RRM3 domains	95.35
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	95.35
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	95.11
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	95.07
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	94.86
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	94.66
KOG4210		285	consensus Nuclear localization sequence binding pr	94.58
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	94.08
PLN03121		243	nucleic acid binding protein; Provisional	93.98
KOG0115		275	consensus RNA-binding protein p54nrb (RRM superfam	93.95
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	93.93
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	93.87
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	93.5
PF03467		176	Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120	93.34
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	93.28
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	93.18
smart00362		72	RRM_2 RNA recognition motif.	92.69
smart00360		71	RRM RNA recognition motif.	92.55
PLN03213		759	repressor of silencing 3; Provisional	92.4
KOG2068		327	consensus MOT2 transcription factor [Transcription	92.07
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	91.96
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	91.58
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	91.11
PF08952		146	DUF1866: Domain of unknown function (DUF1866) ; In	91.03
KOG0122		270	consensus Translation initiation factor 3, subunit	89.93
KOG1996		378	consensus mRNA splicing factor [RNA processing and	89.74
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	89.39
KOG4676		479	consensus Splicing factor, arginine/serine-rich [R	89.2
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	88.43
KOG2416		718	consensus Acinus (induces apoptotic chromatin cond	88.18
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	88.11
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	87.29
KOG4207		256	consensus Predicted splicing factor, SR protein su	87.13
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	86.59
KOG2253		668	consensus U1 snRNP complex, subunit SNU71 and rela	85.69
COG0724		306	RNA-binding proteins (RRM domain) [General functio	85.56
KOG1862		673	consensus GYF domain containing proteins [General	85.43
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	84.33
PF08675		87	RNA_bind: RNA binding domain; InterPro: IPR014789	83.76
KOG4285		350	consensus Mitotic phosphoprotein [Cell cycle contr	80.72

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

Probab=100.00  E-value=3.6e-56  Score=444.37  Aligned_cols=267  Identities=39%  Similarity=0.566  Sum_probs=214.9

Q ss_pred             eEEeecccccccccCC---CccccCCCCcccccccccccccCCCCCCccccccccccccccchhhhcccccchhhhccCC
Q 011382          185 RYKWDRGLRAWVPQED---TSSQNDGYGIEEMTFLKEEEVFPTVNVTDDLANDEVGKEKLNSTEEKVNSADNVVEEKHNG  261 (487)
Q Consensus       185 ~y~wD~~~k~w~p~d~---~~~~~~~yg~~~~t~~~~eev~~~~~~~~~~~~~~~~k~k~~~~~~~~~~~~~~~~~~~~~  261 (487)
                      .|.||.++++|||+.+   .+.||++|||++.|+....+.         ..+...++++.             .+..+..
T Consensus        50 dy~wd~~k~~W~pki~~df~a~yq~nyg~~~d~s~~~~e~---------~e~~~a~~~~e-------------~e~~k~~  107 (382)
T KOG1548|consen   50 DYIWDDEKKAWVPKIPEDFIAEYQANYGFEDDTSADATEL---------EEDGHAKKKKE-------------DELLKNP  107 (382)
T ss_pred             cceeehhhccccCCCchhHHHhhhcccCccccccccchhh---------hhhhhhhhccc-------------chhhhcc
Confidence            3999999999999944   467999999976554433321         00001111111             1111223


Q ss_pred             CCCCCchhhhhcccCCCCCCCccCCCCcEEEEcCCCCCCCHHHHHHHhhcCCccccCCCCCCCeEEEEecCCCCCccceE
Q 011382          262 KRKQPDKQVEKKEANKPPDSWFELKVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDA  341 (487)
Q Consensus       262 kr~~~~k~~~k~e~~~~~~~~~~~~~nt~VyV~nLP~diTeeeL~e~Fsk~G~I~~d~~t~~p~ikl~~Dk~tG~~KG~A  341 (487)
                      +|+.+.....++.++.++-.|+....|++|||+|||.+||.+++.++|++||.|++||+||+|+|+||++. .|+.||+|
T Consensus       108 ~r~~~~~~~~kk~~~e~~~~~~~~~~Nt~VYVsgLP~DiT~dE~~~~~sKcGiI~~d~~t~epk~KlYrd~-~G~lKGDa  186 (382)
T KOG1548|consen  108 KRKYKVGKGEKKQKEEGEWFNPEPKVNTSVYVSGLPLDITVDEFAEVMSKCGIIMRDPQTGEPKVKLYRDN-QGKLKGDA  186 (382)
T ss_pred             cccccCccccccccCCCcccCcccccCceEEecCCCCcccHHHHHHHHHhcceEeccCCCCCeeEEEEecC-CCCccCce
Confidence            33322222333333333334445679999999999999999999999999999999999999999999994 69999999


Q ss_pred             EEEeCCHHHHHHHHHhcCCcccCCCCceeEEEEeccccccchhhhhhhhh--HHHHHHHHHHHHHhccCCCCC--CCCCC
Q 011382          342 LVTYLKEPSVALATQLLDGTPFRPDGKIPMSVTQAKFEQKGERFIAKQVD--SKKKKKLKKVEEKMLGWGGRD--DAKLT  417 (487)
Q Consensus       342 fV~F~~~esa~~Ai~~Ldg~~~~~G~~i~I~V~~A~~~~kg~~~~~kk~~--~~kkkklqkl~~kl~~w~~~~--~~~~~  417 (487)
                      +|+|.+.+||++||++||+..|+ |+  .|+|++|+|+++|.++++++.+  .+.++|++++++++++|.+..  +.+.+
T Consensus       187 Lc~y~K~ESVeLA~~ilDe~~~r-g~--~~rVerAkfq~Kge~~~~~k~k~k~~~~kk~~k~q~k~~dw~pd~~~~sk~r  263 (382)
T KOG1548|consen  187 LCCYIKRESVELAIKILDEDELR-GK--KLRVERAKFQMKGEYDASKKEKGKCKDKKKLKKQQQKLLDWRPDRDDPSKAR  263 (382)
T ss_pred             EEEeecccHHHHHHHHhCccccc-Cc--EEEEehhhhhhccCcCcccccccccccHHHHHHHHHhhcccCCCcccccccc
Confidence            99999999999999999999999 75  6899999999999999887754  335788889999999999875  34456


Q ss_pred             CCeEEEeeccCChhhhccchhhHHHHHHHHHHHhccCcceEEEEEecCCCCceEEEEEEe
Q 011382          418 IPATVILRFMFTPAEMRADENLRSELEADVQEECVKIGPVDSVKVMKLNVEINCILIIFL  477 (487)
Q Consensus       418 ~~~~VvLkNMf~p~el~~Dp~~~~ei~EDVreEC~KfG~V~~V~V~~~~p~Gvv~V~f~~  477 (487)
                      ..++|||+|||+|++|+++|+++.+|++||+++|+|||.|.+|+||++||+|||.|.|..
T Consensus       264 ~~~tVi~kn~Ftp~~~~~~~~l~~dlkedl~eec~K~G~v~~vvv~d~hPdGvvtV~f~n  323 (382)
T KOG1548|consen  264 ADRTVILKNMFTPEDFEKNPDLLNDLKEDLTEECEKFGQVRKVVVYDRHPDGVVTVSFRN  323 (382)
T ss_pred             CCcEEEeeecCCHHHhccCHHHHHHHHHHHHHHHHHhCCcceEEEeccCCCceeEEEeCC
Confidence            789999999999999999999999999999999999999999999999999999999975

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF14237 DUF4339: Domain of unknown function (DUF4339)	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG0226 consensus RNA-binding proteins [General function prediction only]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>cd00072 GYF GYF domain: contains conserved Gly-Tyr-Phe residues; Proline-binding domain in CD2-binding and other proteins	Back alignment and domain information

>PF02213 GYF: GYF domain; InterPro: IPR003169 The glycine-tyrosine-phenylalanine (GYF) domain is an around 60-amino acid domain which contains a conserved GP[YF]xxxx[MV]xxWxxx[GN]YF motif	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>smart00444 GYF Contains conserved Gly-Tyr-Phe residues	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1996 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1855 consensus Predicted RNA-binding protein [General function prediction only]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF15519 RBM39linker: linker between RRM2 and RRM3 domains in RBM39 protein; PDB: 3S6E_A 2LQ5_A	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>KOG2068 consensus MOT2 transcription factor [Transcription]	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1996 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification]	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification]	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG1862 consensus GYF domain containing proteins [General function prediction only]	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN)	Back alignment and domain information

>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		487
2cpe_A		113	Solution Structure Of The Rna Recognition Motif Of		5e-14
2lcw_A		116	Solution Structure Of FusTLS RRM DOMAIN Length = 11		6e-11
2la6_A		99	Solution Nmr Structure Of Rrm Domain Of Rna-Binding		1e-10

>pdb|2CPE|A Chain A, Solution Structure Of The Rna Recognition Motif Of Ewing Sarcoma(Ews) Protein Length = 113

Back alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 1/90 (1%) Query: 288 NTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLK 347 N+ +YV GL D VT++++ + F +CG++K + T +P I IY+DKETG KGDA V+Y Sbjct: 15 NSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYED 74 Query: 348 EPSVALATQLLDGTPFRPDGKIPMSVTQAK 377 P+ A + DG F+ K+ +S+ + K Sbjct: 75 PPTAKAAVEWFDGKDFQ-GSKLKVSLARKK 103

PyMOL of 2cpe

>pdb|2LCW|A Chain A, Solution Structure Of FusTLS RRM DOMAIN Length = 116

Back alignment and structure

>pdb|2LA6|A Chain A, Solution Nmr Structure Of Rrm Domain Of Rna-Binding Protein Fus From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6430a Length = 99

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		487
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	2e-32
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	4e-31
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	8e-31
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	5e-11
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	2e-10
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	8e-10
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	2e-09
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	3e-09
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	3e-09
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	4e-09
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	1e-05
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	3e-05
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	5e-09
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	4e-07
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	5e-09
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	6e-09
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	2e-08
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	6e-09
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	8e-09
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	2e-08
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	1e-08
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	1e-07
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	1e-08
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	1e-08
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	1e-08
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	2e-08
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	2e-08
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	2e-08
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	2e-08
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	3e-08
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	4e-08
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	4e-08
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	5e-08
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	6e-08
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	7e-08
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	8e-08
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	9e-08
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	9e-08
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	9e-08
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	1e-07
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	1e-06
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	1e-07
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	1e-07
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	1e-07
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	1e-07
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	2e-05
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	1e-07
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	1e-07
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	1e-07
1x4e_A		85	RNA binding motif, single-stranded interacting pro	2e-07
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	2e-07
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	2e-07
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	2e-06
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	9e-05
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	3e-07
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	3e-07
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	5e-07
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	6e-07
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	6e-07
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	7e-07
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	8e-07
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	9e-07
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	4e-05
2dis_A		109	Unnamed protein product; structural genomics, RRM	1e-06
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	2e-06
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	2e-06
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	2e-06
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	2e-06
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	2e-06
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	2e-06
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	2e-06
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	3e-06
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	3e-06
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	3e-06
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	3e-06
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	4e-06
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	3e-06
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	5e-05
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	3e-06
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	4e-06
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	5e-06
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	5e-06
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	5e-06
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	6e-06
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	6e-06
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	7e-06
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	7e-06
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	7e-06
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	7e-06
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	8e-06
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	8e-06
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	8e-06
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	8e-06
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	1e-05
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	1e-05
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	1e-05
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	1e-05
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	1e-05
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	1e-05
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	2e-05
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	3e-05
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	3e-05
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	9e-04
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	3e-05
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	4e-05
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	4e-05
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	5e-05
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	6e-05
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	6e-05
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	7e-05
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	8e-05
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	1e-04
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	1e-04
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	1e-04
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	1e-04
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	3e-04
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens} Len	1e-04
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	2e-04
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	2e-04
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	2e-04
2div_A		99	TRNA selenocysteine associated protein; structural	2e-04
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	2e-04
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	2e-04
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	2e-04
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	2e-04
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	8e-04
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	3e-04
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	3e-04
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	3e-04
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	3e-04
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	4e-04
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	4e-04
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	5e-04
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	5e-04
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	5e-04
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	5e-04
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	6e-04
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	7e-04
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	7e-04

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99	Back alignment and structure

 Score =  118 bits (297), Expect = 2e-32
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 3/91 (3%)

Query: 286 KVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTY 345
             N  ++V GL ++VT+E + + F + GIIK + +T +P I +Y D+ETG  KG+A V++
Sbjct: 11  SDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSF 70

Query: 346 LKEPSVALATQLLDGTPFRPDGKIPMSVTQA 376
              PS   A    DG  F  +   P+ V+ A
Sbjct: 71  DDPPSAKAAIDWFDGKEFSGN---PIKVSFA 98

PyMOL of 2la6

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		487
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.84
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.83
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.83
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.83
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.82
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.82
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.81
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.8
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.78
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.77
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.74
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.74
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.73
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.73
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.72
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.71
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.71
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.71
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.71
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.71
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.71
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.69
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.69
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.69
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.69
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.68
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.68
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.68
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.68
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.68
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.67
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.67
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.67
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.67
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.67
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.67
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.66
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.66
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.66
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.66
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.66
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.66
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.66
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.66
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	99.66
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.66
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.66
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.66
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.66
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.66
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.65
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	99.65
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.65
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	99.65
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.65
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.65
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.65
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.65
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.64
2div_A		99	TRNA selenocysteine associated protein; structural	99.64
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.64
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.64
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.64
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.64
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.64
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.64
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.64
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.63
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.63
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.63
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.63
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.63
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.63
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.62
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.62
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.62
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.62
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.62
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.62
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.62
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.62
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.62
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.61
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.61
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.61
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.61
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.61
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	99.6
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.6
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.6
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.6
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	99.6
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.6
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.6
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	99.6
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	99.6
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	99.59
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	99.59
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	99.59
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.59
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	99.59
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.59
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	99.59
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.59
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	99.38
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	99.59
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	99.59
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.59
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.58
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	99.58
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.58
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	99.58
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.58
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.58
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	99.58
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.58
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.57
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.57
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.57
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	99.56
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.56
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.54
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.54
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.54
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	99.54
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.54
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	99.54
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.53
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.53
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	99.53
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.53
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.53
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.53
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.52
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.52
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	99.52
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.52
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.52
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.52
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.51
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.51
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.51
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.51
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.51
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.51
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.51
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.5
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	99.5
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.5
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	99.5
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.5
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.5
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.5
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.5
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.5
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	99.5
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.49
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.49
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	99.49
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.48
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	99.48
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	99.47
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.47
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	99.46
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.46
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	99.46
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	99.46
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	99.46
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	99.45
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.45
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	99.45
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	99.45
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.45
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	99.44
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	99.44
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	99.44
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	99.44
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	99.44
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	99.44
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.44
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	99.43
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	99.41
1x5p_A		97	Negative elongation factor E; structure genomics,	99.41
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.41
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	99.39
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	99.37
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	99.36
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.36
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.34
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	99.34
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.34
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.33
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	99.3
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.28
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.27
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	99.24
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	99.22
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.16
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	99.15
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	99.13
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.12
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	99.12
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	99.12
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	99.08
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	99.03
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	99.02
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	98.89
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	98.88
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.74
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.71
1wh2_A		78	Hypothetical protein AT5G08430; GYF domain, struct	98.63
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	98.62
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	98.57
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	98.49
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	98.44
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.37
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	98.25
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.06
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	98.01
3k3v_A		100	Protein SMY2; GYF domain, poly-proline binding, do	97.62
2l9w_A		117	U4/U6 snRNA-associated-splicing factor PRP24; RRM,	97.26
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	97.08
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	96.98
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	96.97
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	96.93
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	96.85
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	96.85
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	96.73
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	96.72
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	96.69
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	96.69
1uw4_A		91	UPF3X; nonsense mediated mRNA decay protein, RNA-b	96.67
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	96.63
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	96.62
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	96.6
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	96.58
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	96.57
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	96.51
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	96.48
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	96.46
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	96.45
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	96.43
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	96.42
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	96.4
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	96.39
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	96.38
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	96.34
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	96.33
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	96.32
1x4e_A		85	RNA binding motif, single-stranded interacting pro	96.31
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	96.31
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	96.3
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	96.3
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	96.26
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	96.25
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	96.25
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	96.24
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	96.24
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	96.2
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	96.2
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	96.19
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	96.18
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	96.16
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	96.15
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	96.13
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	96.12
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	96.11
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	96.1
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	96.1
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	96.1
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	96.08
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	96.08
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	96.07
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	96.07
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	96.06
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	96.06
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	96.06
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	96.03
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	96.03
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	96.03
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	96.03
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	96.02
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	96.01
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	95.99
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	95.99
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	95.98
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	95.97
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	95.96
1x5p_A		97	Negative elongation factor E; structure genomics,	95.96
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	95.93
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	95.91
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	95.89
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	95.87
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	95.87
1x5o_A		114	RNA binding motif, single-stranded interacting pro	95.86
1wey_A		104	Calcipressin 1; structural genomics, RRM domain, r	95.82
2div_A		99	TRNA selenocysteine associated protein; structural	95.81
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	95.81
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	95.81
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	95.8
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	95.79
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	95.78
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	95.77
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	95.77
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	95.76
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	95.75
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	95.74
1wwh_A		119	Nucleoporin 35, nucleoporin; structural genomics,	95.73
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	95.71
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	95.7
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	95.69
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	95.67
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	95.67
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	95.67
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	95.66
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	95.66
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	95.65
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	95.63
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	95.63
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	95.62
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	95.62
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	95.61
1syx_B		86	CD2BP2, CD2 antigen cytoplasmic tail-binding prote	95.61
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	95.61
2dis_A		109	Unnamed protein product; structural genomics, RRM	95.59
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	95.56
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	95.56
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	95.56
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	95.55
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	95.54
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	95.53
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	95.5
1whv_A		100	Poly(A)-specific ribonuclease; RNA recognition mot	95.48
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	95.48
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	95.47
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	95.45
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	95.45
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	95.44
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	95.42
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	95.41
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	95.36
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	95.34
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	95.32
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	95.31
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	95.31
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	95.2
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	95.17
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	95.15
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	95.11
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	95.08
2dhx_A		104	Poly (ADP-ribose) polymerase family, member 10 var	95.05
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	95.04
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	94.94
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	94.93
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	94.93
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	94.91
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	94.85
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	94.82
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	94.78
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	94.72
3ctr_A		101	Poly(A)-specific ribonuclease PARN; protein-RNA-co	94.71
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	94.69
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	94.64
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	94.6
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	94.47
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	94.38
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	94.35
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	94.33
3p3d_A		132	Nucleoporin 53; structural genomics, PSI-2, protei	94.31
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	94.29
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	94.17
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	94.16
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	94.13
3pq1_A		464	Poly(A) RNA polymerase; nucleotidyl transferase, R	94.1
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	93.99
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	93.96
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	93.59
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	93.46
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	93.44
2l08_A		97	Regulator of nonsense transcripts 3A; NESG, nonsen	93.4
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	93.39
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	92.38
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	93.22
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	92.93
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	92.63
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	92.58
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	91.67
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	91.3
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	91.21
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	90.9
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	89.76
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	88.56
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	81.27

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

Probab=99.84  E-value=2.9e-20  Score=171.22  Aligned_cols=141  Identities=13%  Similarity=0.157  Sum_probs=112.7

Q ss_pred             CCCcEEEEcCCCCCCCHHHHHHHhhcCCccccCCCCCCCeEEEEecCCCCCccceEEEEeCCHHHHHHHHHhcCCcccCC
Q 011382          286 KVNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRP  365 (487)
Q Consensus       286 ~~nt~VyV~nLP~diTeeeL~e~Fsk~G~I~~d~~t~~p~ikl~~Dk~tG~~KG~AfV~F~~~esa~~Ai~~Ldg~~~~~  365 (487)
                      ...++|||+|||+++|+++|+++|++||.|.        .|+|++++.+|.++|||||+|.+.++|..||.. ++..|. 
T Consensus        11 ~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~--------~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~-~~~~~~-   80 (196)
T 1l3k_A           11 EQLRKLFIGGLSFETTDESLRSHFEQWGTLT--------DCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA-RPHKVD-   80 (196)
T ss_dssp             GGGGEEEEESCCTTCCHHHHHHHHGGGSCEE--------EEEEEECTTTCCEEEEEEEEESSHHHHHHHHHT-CSCEET-
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHhCCCEE--------EEEEEEcCCCCCccceEEEEeCCHHHHHHHHhc-CCCEEC-
Confidence            4577999999999999999999999999999        999999998999999999999999999999985 999998 


Q ss_pred             CCceeEEEEeccccccchhhhhhhhhHHHHHHHHHHHHHhccCCCCCCCCCCCCeEEEeeccCChhhhccchhhHHHHHH
Q 011382          366 DGKIPMSVTQAKFEQKGERFIAKQVDSKKKKKLKKVEEKMLGWGGRDDAKLTIPATVILRFMFTPAEMRADENLRSELEA  445 (487)
Q Consensus       366 G~~i~I~V~~A~~~~kg~~~~~kk~~~~kkkklqkl~~kl~~w~~~~~~~~~~~~~VvLkNMf~p~el~~Dp~~~~ei~E  445 (487)
                      |+  .|.|..+........                            .......++|+|+||  |.++         .++
T Consensus        81 g~--~l~v~~~~~~~~~~~----------------------------~~~~~~~~~l~V~nL--p~~~---------t~~  119 (196)
T 1l3k_A           81 GR--VVEPKRAVSREDSQR----------------------------PGAHLTVKKIFVGGI--KEDT---------EEH  119 (196)
T ss_dssp             TE--ECEEEECCC---------------------------------------CCSEEEEECC--TTTC---------CHH
T ss_pred             CE--EeeeecccCcccccc----------------------------cccCCCcceEEEeCC--CCCC---------CHH
Confidence            64  577877653211000                            001123479999999  2222         357


Q ss_pred             HHHHHhccCcceEEEEEecC----CCCceEEEEEEe
Q 011382          446 DVQEECVKIGPVDSVKVMKL----NVEINCILIIFL  477 (487)
Q Consensus       446 DVreEC~KfG~V~~V~V~~~----~p~Gvv~V~f~~  477 (487)
                      +|++.|++||.|.+|.|...    .+.|+++|.|..
T Consensus       120 ~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~F~~  155 (196)
T 1l3k_A          120 HLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD  155 (196)
T ss_dssp             HHHHHHTTTSCEEEEEEEECTTTCCEEEEEEEEESS
T ss_pred             HHHHHHhcCCCeEEEEEeecCCCCCccceEEEEECC
Confidence            89999999999999999743    357999999976

PyMOL of 1l3k

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>1wh2_A Hypothetical protein AT5G08430; GYF domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Arabidopsis thaliana} SCOP: d.76.1.1	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>3k3v_A Protein SMY2; GYF domain, poly-proline binding, domain SWAP, ragnya, phosphoprotein, protein binding; 1.80A {Saccharomyces cerevisiae} PDB: 3fma_A	Back alignment and structure

>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>1syx_B CD2BP2, CD2 antigen cytoplasmic tail-binding protein 2, CD; GYF-domain, thioredoxin-like, spliceosomal proteins, transla immune system complex; 2.35A {Homo sapiens} SCOP: d.76.1.1 PDB: 1gyf_A 1l2z_A	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A*	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens}	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii}	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		487
d2cpea1		101	d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma	2e-09
d2disa1		96	d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {	4e-09
d2f9da1		114	d.58.7.1 (A:12-125) Pre-mRNA branch site protein p	2e-08
d1b7fa2		85	d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil	3e-08
d1cvja1		80	d.58.7.1 (A:11-90) Poly(A)-binding protein {Human	7e-07
d1u2fa_		90	d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit	1e-06
d1b7fa1		82	d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil	1e-06
d2cpfa1		85	d.58.7.1 (A:362-446) Probable RNA-binding protein	4e-06
d2u2fa_		85	d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit	4e-06
d2dita1		99	d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma	6e-06
d1fxla2		85	d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho	7e-06
d1uawa_		77	d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax	1e-05
d2cpha1		94	d.58.7.1 (A:454-547) Probable RNA-binding protein	2e-05
d1h2vz_		93	d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro	2e-05
d1x5ua1		93	d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu	2e-05
d1fxla1		82	d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom	3e-05
d2cqpa1		86	d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous	4e-05
d1x4aa1		95	d.58.7.1 (A:9-103) Splicing factor, arginine/serin	5e-05
d2cqca1		83	d.58.7.1 (A:109-191) Arginine/serine-rich splicing	7e-05
d2cq4a1		101	d.58.7.1 (A:132-232) RNA binding protein 23 {Human	7e-05
d2cqba1		89	d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer	1e-04
d1x5ta1		83	d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu	1e-04
d2cqha1		80	d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is	2e-04
d1fjca_		96	d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice	2e-04
d2cpia1		89	d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C	2e-04
d1no8a_		78	d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu	3e-04
d2cq0a1		90	d.58.7.1 (A:231-320) Eukaryotic translation initia	4e-04
d1whwa_		99	d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm	4e-04
d1x4ga1		96	d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s	5e-04
d1x4ba1		103	d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle	5e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	d.58.7.3 (A:) 6e-04
d2adba1		108	d.58.7.1 (A:177-284) Polypyrimidine tract-binding	7e-04
d1u1qa_		183	d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1	0.001
d1wf2a_		98	d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot	0.002
d1x0fa1		75	d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0	0.002
d1cvja2		89	d.58.7.1 (A:91-179) Poly(A)-binding protein {Human	0.003
d2cq3a1		93	d.58.7.1 (A:110-202) RNA-binding protein 9 {Human	0.003
d2cpya1		103	d.58.7.1 (A:536-638) RNA-binding protein 12 {Human	0.004

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein EWS
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.9 bits (126), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 288 NTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLK 347
           N+ +YV GL D VT++++ + F +CG++K +  T +P I IY+DKETG  KGDA V+Y  
Sbjct: 8   NSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYED 67

Query: 348 EPSVALATQLLDGTPFRPDGKIPMSVTQAK 377
            P+   A +  DG  F   G   + V+ A+
Sbjct: 68  PPTAKAAVEWFDGKDF--QGS-KLKVSLAR 94

PyMOL of d2cpea1

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		487
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.79
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.78
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.77
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.75
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	99.75
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.75
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.74
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.74
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.74
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.74
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.73
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.73
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.72
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.72
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	99.72
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.72
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.72
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.72
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.71
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.71
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.71
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.71
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.7
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.7
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.7
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	99.7
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	99.69
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.69
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	99.69
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.69
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.69
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.69
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.68
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.68
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.67
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.67
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	99.65
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.65
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.64
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.64
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.64
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.64
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	99.63
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.63
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.63
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.62
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	99.61
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.6
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	99.59
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.59
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.59
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.57
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.56
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.56
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.56
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.56
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.55
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	99.54
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.54
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.54
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.54
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	99.54
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.53
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.53
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.53
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.53
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.53
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	99.53
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.51
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.5
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.49
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.48
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.48
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	99.48
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.47
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.46
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	99.43
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	99.43
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.42
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	99.39
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	99.32
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.28
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	99.28
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	99.27
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	99.27
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.26
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.26
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	98.94
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.77
d1wh2a_		78	Hypothetical rotein At5g08430 {Thale cress (Arabid	97.63
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	97.49
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	97.22
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	97.1
d1syxb1		62	GYF domain from cd2bp2 protein {Human (Homo sapien	96.98
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	96.98
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	96.83
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	96.8
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	96.74
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	96.71
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.7
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.69
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	96.67
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	96.61
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	96.53
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	96.51
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	96.5
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	96.49
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.49
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	96.47
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	96.47
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	96.46
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	96.45
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	96.43
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	96.42
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	96.42
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	96.39
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	96.38
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	96.34
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	96.33
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	96.33
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	96.27
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	96.26
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	96.25
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	96.19
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	96.19
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	96.17
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	96.16
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	96.09
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	96.08
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	96.03
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	96.02
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	96.01
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	96.0
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	95.97
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	95.96
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	95.87
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	95.85
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	95.82
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	95.72
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	95.69
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	95.65
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	95.65
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	95.64
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	95.58
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	95.58
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	95.58
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	95.49
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	95.45
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	95.45
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	95.4
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	95.34
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	95.33
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	95.25
d1ufwa_		95	Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]	95.25
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	95.2
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	95.06
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	95.0
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	94.96
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	94.92
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	94.91
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	94.57
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	94.46
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	94.42
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	94.01
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	93.97
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	93.93
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	93.65
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	93.44
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	93.24
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	93.08
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	92.34
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	91.73
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	91.22
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	90.8
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	90.74
d2dgxa1		73	Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960	90.7
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	88.74
d1whva_		100	Poly(A)-specific ribonuclease PARN {Mouse (Mus mus	85.86

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Hu antigen D (Hud)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.3e-19  Score=147.55  Aligned_cols=81  Identities=30%  Similarity=0.486  Sum_probs=76.5

Q ss_pred             CCcEEEEcCCCCCCCHHHHHHHhhcCCccccCCCCCCCeEEEEecCCCCCccceEEEEeCCHHHHHHHHHhcCCcccCCC
Q 011382          287 VNTHVYVTGLPDDVTVEEMVEVFSKCGIIKEDPETKKPRIKIYVDKETGMKKGDALVTYLKEPSVALATQLLDGTPFRPD  366 (487)
Q Consensus       287 ~nt~VyV~nLP~diTeeeL~e~Fsk~G~I~~d~~t~~p~ikl~~Dk~tG~~KG~AfV~F~~~esa~~Ai~~Ldg~~~~~G  366 (487)
                      ++++|||+|||+++|+++|+++|++||.|.        .|+|++|+.+|++||||||+|.++++|..|++.|||..+. |
T Consensus         5 k~~~lfV~nLp~~~te~~L~~~F~~~G~v~--------~v~i~~d~~~g~~kg~afV~f~~~~~a~~Ai~~lng~~~~-G   75 (85)
T d1fxla2           5 RDANLYVSGLPKTMTQKELEQLFSQYGRII--------TSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPS-G   75 (85)
T ss_dssp             TTCEEEEESCCTTCCHHHHHHHHGGGSCEE--------EEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCCCT-T
T ss_pred             CCCEEEEeCCCCCCCHHHHHHHHHHhCCcc--------ccccccccccccCCCeeEEEEcCHHHHHHHHHHhCCCEeC-C
Confidence            467999999999999999999999999999        9999999989999999999999999999999999999998 7


Q ss_pred             CceeEEEEec
Q 011382          367 GKIPMSVTQA  376 (487)
Q Consensus       367 ~~i~I~V~~A  376 (487)
                      +..+|+|..|
T Consensus        76 ~~~~i~V~~A   85 (85)
T d1fxla2          76 ATEPITVKFA   85 (85)
T ss_dssp             CSSCCEEEEC
T ss_pred             CCEEEEEEeC
Confidence            7778888865

PyMOL of d1fxla2

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wh2a_ d.76.1.1 (A:) Hypothetical rotein At5g08430 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1syxb1 d.76.1.1 (B:25-86) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure