Citrus Sinensis ID: 011428

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAKTQEACKMVKLARAAMGNKNSSRRQGPRRKFRKSDPLKSFSAEPTKRAGKGRMKREGRNGDDTGKHKKKKSL
cHHHHHHHcccccEEEEEEccccHHHHHHHHcccccEEEEcccHHHHHHcccccccccccccccEEEEEccccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEEEcccccHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccEEcccccccccccccEEEEEccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHccccccEEEEEEcccccHHHHHHHHccccEEEEccHHHHHHHHcccEccHccHcHEEEEEEHHHHHHHHcccHHHHHHHHHHccHHHcEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccHHHccccccEcccccEEEEEcccccHHHHEEEcccccccccccEEEEEEcHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccHHccccHHccccHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MALIELCKGQVQLKVVQLTssmpasdlraalagppdiviatpgcmpkclstgvlqsksfsdsLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCllmsatsssdvdklkklilhnpyiltlpevgdvkdeviPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAIlnaelpqnsrLHILEEFNAGLFDYLIatddtqtkekdqsdegghvdsrkskkhpkakldsefgvvrgidfknvHTVINFempqnaagyvhrigrtgrayntgasvslvspdeMKIFEEIKSfvgddenedsniiapfplLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEklkahfevnpkdldllkhdkdlskkppashlrdvpdyllDAKTQEACKMVKLARAAmgnknssrrqgprrkfrksdplksfsaeptkragkgrmkregrngddtgkhkkkksl
malielckgqVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYIltlpevgdvkdEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQtkekdqsdegghvdsrkskkhpkakldsefgvvrgIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSvtkiavresraqDLRNEilnseklkahfevnpkdldlLKHDkdlskkppashlrdvpDYLLDAKTQEACKMVKLAraamgnknssrrqgprrkfrksdplksfsaeptkragkgrmkregrngddtgkhkkkksl
MALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKllyiltllklelVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEKLKAHFEVNPkdldllkhdkdlskkPPASHLRDVPDYLLDAKTQEACKMVKLARAAMGNKNSSRRQGPRRKFRKSDPLKSFSAEPTKRAGKGRMKREGRNGDDTGKHKKKKSL
***IELCKGQVQLKVVQLTS*****DLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIAT********************************EFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGD****DSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAV****************************************************YLLD******C******************************************************************
*ALIELCKGQVQLKVVQLTSSMPASDL**ALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDV**EVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDD**********************************VRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKS****************************************************************************************************************************************************************************
MALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDT*************************KLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAKTQEACKMVKLARA***********************KSFSA******************************
MALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQ*************************LDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAK***********************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAKTQEACKMVKLARAAMGNKNSSRRQGPRRKFRKSDPLKSFSAEPTKRAGKGRMKREGRNGDDTGKHKKKKSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query486 2.2.26 [Sep-21-2011]
Q9SW44626 DEAD-box ATP-dependent RN yes no 0.981 0.761 0.683 1e-177
Q6ATJ8670 DEAD-box ATP-dependent RN yes no 0.981 0.711 0.609 1e-164
Q2UFL0605 ATP-dependent RNA helicas yes no 0.890 0.715 0.370 7e-85
A7EM78607 ATP-dependent RNA helicas N/A no 0.901 0.721 0.387 1e-84
A7TPC9597 ATP-dependent RNA helicas N/A no 0.878 0.715 0.402 6e-84
Q1DWF4612 ATP-dependent RNA helicas N/A no 0.897 0.712 0.378 1e-83
A6SNX1607 ATP-dependent RNA helicas N/A no 0.901 0.721 0.375 5e-83
A1C7F7621 ATP-dependent RNA helicas N/A no 0.890 0.697 0.360 1e-82
Q0CY48619 ATP-dependent RNA helicas N/A no 0.890 0.699 0.360 2e-82
Q6CUI6594 ATP-dependent RNA helicas yes no 0.901 0.737 0.404 3e-82
>sp|Q9SW44|RH16_ARATH DEAD-box ATP-dependent RNA helicase 16 OS=Arabidopsis thaliana GN=RH16 PE=2 SV=1 Back     alignment and function desciption
 Score =  623 bits (1606), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 337/493 (68%), Positives = 408/493 (82%), Gaps = 16/493 (3%)

Query: 2   ALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSD 61
           +LIELC+  VQLK VQLTSSM ASD+R ALAG P+I+++TP C+PKC + GVL+  + S+
Sbjct: 142 SLIELCR--VQLKAVQLTSSMSASDMRNALAGLPEILVSTPACIPKCFAAGVLEPTAVSE 199

Query: 62  SLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYIL 121
           SL ILVLDEADLLLSYGYED+L++++++IPR CQCLLMSAT+SSDV+KLKKLILHNP +L
Sbjct: 200 SLSILVLDEADLLLSYGYEDNLRSVTSIIPRRCQCLLMSATTSSDVEKLKKLILHNPIVL 259

Query: 122 TLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLK 181
           TL E  D K+E +P NVQQFWISCS +DKLL+IL LLKLE+VQKK LIF NTIDM FRLK
Sbjct: 260 TLTEDND-KEEAVPSNVQQFWISCSAQDKLLHILALLKLEVVQKKILIFINTIDMGFRLK 318

Query: 182 LFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDD-TQTKEKDQSDEG-GHVD 239
           LFLEKFGIKSAILN ELPQNSRLHILE+FNAGLFDYLIATDD +QTK++ +  +G  + +
Sbjct: 319 LFLEKFGIKSAILNGELPQNSRLHILEQFNAGLFDYLIATDDNSQTKKQKEEAKGEANKE 378

Query: 240 SRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVS 299
           ++K+ K  K KLD+EFGVVRGIDFK VHTVINF+MPQ+  GY+HRIGRTGRAY++G+SVS
Sbjct: 379 NKKNNKRSKPKLDAEFGVVRGIDFKKVHTVINFDMPQSVTGYIHRIGRTGRAYSSGSSVS 438

Query: 300 LVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRE 359
           L+SPDEM+ FE+IKSF+  D+N+D +II PFPLL +NAVESLRYRAEDVAKSVTKIAVRE
Sbjct: 439 LISPDEMEGFEDIKSFLASDKNKDIDIITPFPLLTENAVESLRYRAEDVAKSVTKIAVRE 498

Query: 360 SRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAKTQEA 419
           SRAQDLRNEI+NSEKLKAHFE NP+DLDLL+HDK LSK  PA HL+D+P+YL+DAKTQEA
Sbjct: 499 SRAQDLRNEIINSEKLKAHFEANPRDLDLLRHDKPLSKTAPAPHLKDIPEYLVDAKTQEA 558

Query: 420 CKMVKLARAAMGNKNSSRRQGPRRKF------RKSDPLKSFSAEPTKRAGKGRMKREGRN 473
            KMVKLARAAMGN   S   G R         + SDPLK+F+   +KR   G+     ++
Sbjct: 559 SKMVKLARAAMGNTRRSGGGGGRNNKNKKRSRKGSDPLKTFNPNGSKRGAVGQ-----KD 613

Query: 474 GDDTGKHKKKKSL 486
           G D+   KK+K++
Sbjct: 614 GKDSSSTKKQKTV 626

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q6ATJ8|RH16_ORYSJ DEAD-box ATP-dependent RNA helicase 16 OS=Oryza sativa subsp. japonica GN=Os03g0728800 PE=2 SV=1 Back     alignment and function description
>sp|Q2UFL0|DBP9_ASPOR ATP-dependent RNA helicase dbp9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp9 PE=3 SV=1 Back     alignment and function description
>sp|A7EM78|DBP9_SCLS1 ATP-dependent RNA helicase dbp9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp9 PE=3 SV=1 Back     alignment and function description
>sp|A7TPC9|DBP9_VANPO ATP-dependent RNA helicase DBP9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP9 PE=3 SV=2 Back     alignment and function description
>sp|Q1DWF4|DBP9_COCIM ATP-dependent RNA helicase DBP9 OS=Coccidioides immitis (strain RS) GN=DBP9 PE=3 SV=2 Back     alignment and function description
>sp|A6SNX1|DBP9_BOTFB ATP-dependent RNA helicase dbp9 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp9 PE=3 SV=2 Back     alignment and function description
>sp|A1C7F7|DBP9_ASPCL ATP-dependent RNA helicase dbp9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp9 PE=3 SV=1 Back     alignment and function description
>sp|Q0CY48|DBP9_ASPTN ATP-dependent RNA helicase dbp9 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp9 PE=3 SV=2 Back     alignment and function description
>sp|Q6CUI6|DBP9_KLULA ATP-dependent RNA helicase DBP9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP9 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
118481211 619 unknown [Populus trichocarpa] 0.975 0.765 0.800 0.0
359496815545 PREDICTED: DEAD-box ATP-dependent RNA he 0.977 0.871 0.820 0.0
255579537 616 dead box ATP-dependent RNA helicase, put 0.993 0.784 0.763 0.0
224094833 597 predicted protein [Populus trichocarpa] 0.930 0.757 0.756 0.0
356535071 601 PREDICTED: DEAD-box ATP-dependent RNA he 0.989 0.800 0.746 0.0
449451323 596 PREDICTED: DEAD-box ATP-dependent RNA he 0.987 0.805 0.757 0.0
357441703 604 DEAD-box ATP-dependent RNA helicase [Med 0.989 0.796 0.713 0.0
297798432 634 hypothetical protein ARALYDRAFT_491167 [ 0.989 0.758 0.686 1e-177
15236218 626 DEAD-box ATP-dependent RNA helicase 16 [ 0.981 0.761 0.683 1e-176
218193250 661 hypothetical protein OsI_12480 [Oryza sa 0.981 0.721 0.607 1e-162
>gi|118481211|gb|ABK92556.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/477 (80%), Positives = 434/477 (90%), Gaps = 3/477 (0%)

Query: 2   ALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSD 61
           +LI+ CK Q  LKVVQLTS+MPASDLR ALAGPPDI+++TP C+ K LS GVL+S+S +D
Sbjct: 136 SLIDSCKAQ--LKVVQLTSNMPASDLRNALAGPPDILVSTPSCVAKSLSVGVLKSESIND 193

Query: 62  SLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYIL 121
           SL+ILVLDEADLLLS+GYE+DLKAL+A++PR CQCLLMSATSS+DVDKLKKL+LHNPY+L
Sbjct: 194 SLEILVLDEADLLLSFGYEEDLKALTALVPRRCQCLLMSATSSADVDKLKKLVLHNPYVL 253

Query: 122 TLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLK 181
           TLPEV  VKDEVIPKNVQQFW+SC +RDKL++IL LLKL+LVQKK LIFTN IDM+FRLK
Sbjct: 254 TLPEVEGVKDEVIPKNVQQFWVSCGDRDKLVHILALLKLDLVQKKVLIFTNAIDMSFRLK 313

Query: 182 LFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSR 241
           LFLEKFGIKSA+LNAELPQNSRLHILEEFNAGLFDYLIATDD +TKEK++++EG   ++R
Sbjct: 314 LFLEKFGIKSAVLNAELPQNSRLHILEEFNAGLFDYLIATDDRETKEKEKANEGSLAETR 373

Query: 242 KSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLV 301
           KSKKH K KLDSEFGVVRGIDFKNVHTVIN++MP +A GYVHRIGRTGRAY+TG+SVSLV
Sbjct: 374 KSKKHAKQKLDSEFGVVRGIDFKNVHTVINYDMPLSATGYVHRIGRTGRAYSTGSSVSLV 433

Query: 302 SPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESR 361
           SPDEM+I EEIKSF+GDDEN +SN+I+P+PLL +NAVESLRYRAED AKSVTKIAVRE+R
Sbjct: 434 SPDEMEILEEIKSFLGDDENNESNVISPYPLLTKNAVESLRYRAEDTAKSVTKIAVREAR 493

Query: 362 AQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAKTQEACK 421
           AQDLRNEILNSEKLKAHFEVNP+DLDLLKHDK LSKKPPA HL DVPDYLLDA T+EA K
Sbjct: 494 AQDLRNEILNSEKLKAHFEVNPRDLDLLKHDKVLSKKPPAPHLSDVPDYLLDATTKEASK 553

Query: 422 MVKLARAAMGNKNSSRRQGPRRKFRKS-DPLKSFSAEPTKRAGKGRMKREGRNGDDT 477
           MVKLARAAMGN NS RRQGP+R FRKS DPLKSFSAE  +R  KG MKREG++GDDT
Sbjct: 554 MVKLARAAMGNNNSGRRQGPKRNFRKSKDPLKSFSAEGPRRGRKGGMKREGKDGDDT 610

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359496815|ref|XP_002273641.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 16, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|255579537|ref|XP_002530611.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223529859|gb|EEF31791.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224094833|ref|XP_002310257.1| predicted protein [Populus trichocarpa] gi|222853160|gb|EEE90707.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356535071|ref|XP_003536072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 16-like [Glycine max] Back     alignment and taxonomy information
>gi|449451323|ref|XP_004143411.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 16-like [Cucumis sativus] gi|449508529|ref|XP_004163338.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 16-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357441703|ref|XP_003591129.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355480177|gb|AES61380.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297798432|ref|XP_002867100.1| hypothetical protein ARALYDRAFT_491167 [Arabidopsis lyrata subsp. lyrata] gi|297312936|gb|EFH43359.1| hypothetical protein ARALYDRAFT_491167 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15236218|ref|NP_195217.1| DEAD-box ATP-dependent RNA helicase 16 [Arabidopsis thaliana] gi|75337761|sp|Q9SW44.1|RH16_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 16 gi|5123708|emb|CAB45452.1| RNA helicase (RH16) [Arabidopsis thaliana] gi|7270442|emb|CAB80208.1| RNA helicase (RH16) [Arabidopsis thaliana] gi|27754373|gb|AAO22635.1| putative DEAD/DEAH box RNA helicase protein [Arabidopsis thaliana] gi|28394057|gb|AAO42436.1| putative DEAD/DEAH box RNA helicase protein [Arabidopsis thaliana] gi|332661036|gb|AEE86436.1| DEAD-box ATP-dependent RNA helicase 16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|218193250|gb|EEC75677.1| hypothetical protein OsI_12480 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
TAIR|locus:2116920626 AT4G34910 [Arabidopsis thalian 0.977 0.758 0.651 1.2e-161
DICTYBASE|DDB_G0280407685 ddx56 "DEAD/DEAH box helicase" 0.446 0.316 0.4 1.4e-74
SGD|S000004266594 DBP9 "DEAD-box protein require 0.462 0.378 0.397 5.4e-73
ZFIN|ZDB-GENE-040825-3557 ddx56 "DEAD (Asp-Glu-Ala-Asp) 0.909 0.793 0.364 2e-72
ASPGD|ASPL0000000390610 AN6374 [Emericella nidulans (t 0.419 0.334 0.455 3.7e-72
MGI|MGI:1277172546 Ddx56 "DEAD (Asp-Glu-Ala-Asp) 0.886 0.789 0.38 1.4e-69
RGD|1303195482 Ddx56 "DEAD (Asp-Glu-Ala-Asp) 0.882 0.890 0.373 3.8e-69
UNIPROTKB|G3V6M5546 Ddx56 "Protein Ddx56" [Rattus 0.882 0.785 0.373 3.8e-69
UNIPROTKB|Q3SZ40546 DDX56 "Probable ATP-dependent 0.860 0.765 0.361 3.1e-67
UNIPROTKB|F1SSH6545 DDX56 "Uncharacterized protein 0.880 0.785 0.357 8.2e-67
TAIR|locus:2116920 AT4G34910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1574 (559.1 bits), Expect = 1.2e-161, P = 1.2e-161
 Identities = 318/488 (65%), Positives = 384/488 (78%)

Query:     2 ALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSD 61
             +LIELC+  VQLK VQLTSSM ASD+R ALAG P+I+++TP C+PKC + GVL+  + S+
Sbjct:   142 SLIELCR--VQLKAVQLTSSMSASDMRNALAGLPEILVSTPACIPKCFAAGVLEPTAVSE 199

Query:    62 SLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYIL 121
             SL ILVLDEADLLLSYGYED+L++++++IPR CQCLLMSAT+SSDV+KLKKLILHNP +L
Sbjct:   200 SLSILVLDEADLLLSYGYEDNLRSVTSIIPRRCQCLLMSATTSSDVEKLKKLILHNPIVL 259

Query:   122 TLPEVGDVKDEVIPKNVQQFWISCSERDKXXXXXXXXXXXXVQKKALIFTNTIDMAFRLK 181
             TL E  D K+E +P NVQQFWISCS +DK            VQKK LIF NTIDM FRLK
Sbjct:   260 TLTEDND-KEEAVPSNVQQFWISCSAQDKLLHILALLKLEVVQKKILIFINTIDMGFRLK 318

Query:   182 LFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDD-TQTKEKDQSDEG-GHVD 239
             LFLEKFGIKSAILN ELPQNSRLHILE+FNAGLFDYLIATDD +QTK++ +  +G  + +
Sbjct:   319 LFLEKFGIKSAILNGELPQNSRLHILEQFNAGLFDYLIATDDNSQTKKQKEEAKGEANKE 378

Query:   240 SRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVS 299
             ++K+ K  K KLD+EFGVVRGIDFK VHTVINF+MPQ+  GY+HRIGRTGRAY++G+SVS
Sbjct:   379 NKKNNKRSKPKLDAEFGVVRGIDFKKVHTVINFDMPQSVTGYIHRIGRTGRAYSSGSSVS 438

Query:   300 LVSPDEMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRE 359
             L+SPDEM+ FE+IKSF+  D+N+D +II PFPLL +NAVESLRYRAEDVAKSVTKIAVRE
Sbjct:   439 LISPDEMEGFEDIKSFLASDKNKDIDIITPFPLLTENAVESLRYRAEDVAKSVTKIAVRE 498

Query:   360 SRAQDLRNEILNSEKLKAHFEVNPXXXXXXXXXXXXXXXPPASHLRDVPDYLLDAKTQEA 419
             SRAQDLRNEI+NSEKLKAHFE NP                PA HL+D+P+YL+DAKTQEA
Sbjct:   499 SRAQDLRNEIINSEKLKAHFEANPRDLDLLRHDKPLSKTAPAPHLKDIPEYLVDAKTQEA 558

Query:   420 CKMVKLARAAMGNKNSSRRQGPR-----RKFRK-SDPLKSFSAEPTKRAGKGRMKREGRN 473
              KMVKLARAAMGN   S   G R     ++ RK SDPLK+F+   +KR   G+  ++G++
Sbjct:   559 SKMVKLARAAMGNTRRSGGGGGRNNKNKKRSRKGSDPLKTFNPNGSKRGAVGQ--KDGKD 616

Query:   474 GDDTGKHK 481
                T K K
Sbjct:   617 SSSTKKQK 624
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0006606 "protein import into nucleus" evidence=RCA
DICTYBASE|DDB_G0280407 ddx56 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000004266 DBP9 "DEAD-box protein required for 27S rRNA processing" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040825-3 ddx56 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 56" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000000390 AN6374 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
MGI|MGI:1277172 Ddx56 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 56" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303195 Ddx56 "DEAD (Asp-Glu-Ala-Asp) box helicase 56" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6M5 Ddx56 "Protein Ddx56" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ40 DDX56 "Probable ATP-dependent RNA helicase DDX56" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSH6 DDX56 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SW44RH16_ARATH3, ., 6, ., 4, ., 1, 30.68350.98140.7619yesno
Q6ATJ8RH16_ORYSJ3, ., 6, ., 4, ., 1, 30.60940.98140.7119yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00071126
hypothetical protein (597 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.8920.1
annotation not avaliable (110 aa)
  •     0.501
eugene3.68280001
hypothetical protein (65 aa)
  •     0.501
eugene3.01250051
hypothetical protein (100 aa)
  •     0.500
gw1.I.4832.1
hypothetical protein (422 aa)
   •• • 0.465
eugene3.00090493
hypothetical protein (840 aa)
   •• • 0.434
estExt_fgenesh4_pm.C_1070023
hypothetical protein (554 aa)
   •• • 0.401
estExt_fgenesh4_pg.C_1310004
hypothetical protein (402 aa)
  •     0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-57
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 3e-29
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-27
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-27
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 8e-27
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-25
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 3e-22
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-22
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-22
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-21
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 9e-19
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-18
smart0049082 smart00490, HELICc, helicase superfamily c-termina 8e-18
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-17
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-16
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-15
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-11
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-10
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 2e-06
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  198 bits (505), Expect = 1e-57
 Identities = 108/450 (24%), Positives = 177/450 (39%), Gaps = 72/450 (16%)

Query: 3   LIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFS-D 61
           L +L K    L+V  +   +       AL    DIV+ATPG   + L   +++       
Sbjct: 119 LRKLGKNLGGLRVAVVYGGVSIRKQIEALKRGVDIVVATPG---RLLD--LIKRGKLDLS 173

Query: 62  SLKILVLDEADLLLSYGYEDDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYIL 121
            ++ LVLDEAD +L  G+ DD++ +   +P   Q LL SAT   D+ +L +  L++P  +
Sbjct: 174 GVETLVLDEADRMLDMGFIDDIEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEI 233

Query: 122 TLPEVGDVKDEVIPKNVQQFWISC-SERDKLLYILTLLKLELVQKKALIFTNTIDMAFRL 180
              EV   K E   K ++QF++   SE +KL  +L LLK E    + ++F  T  +   L
Sbjct: 234 ---EVSVEKLERTLKKIKQFYLEVESEEEKLELLLKLLKDEDE-GRVIVFVRTKRLVEEL 289

Query: 181 KLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDS 240
              L K G K A L+ +LPQ  R   LE+F  G    L+ATD                  
Sbjct: 290 AESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAA--------------- 334

Query: 241 RKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSL 300
                             RG+D  +V  VIN+++P +   YVHRIGRTGRA   G ++S 
Sbjct: 335 ------------------RGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISF 376

Query: 301 VSPD-EMKIFEEIKSFVGDDENEDSNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRE 359
           V+ + E+K  + I+  +         +                    D  +    +    
Sbjct: 377 VTEEEEVKKLKRIEKRLERKLPSAVLL------------------PLDEPEDAKLLKTTR 418

Query: 360 SRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSKKPPASHLRDVPDYLLDAKTQEA 419
              ++  +     +KLK+  +   + L +      L                +D +    
Sbjct: 419 PGLEEESDISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPGAGDAVTIDPEL--- 475

Query: 420 CKMVKLARAAMGNKNSSRRQGPRRKFRKSD 449
                  R +  + +          +R  +
Sbjct: 476 ------ERRSPNSADDIEYILKGLSYRAEE 499

Length = 513
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 486
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110545 helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK13767 876 ATP-dependent helicase; Provisional 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
PHA02653675 RNA helicase NPH-II; Provisional 99.97
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
PRK106891147 transcription-repair coupling factor; Provisional 99.97
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.96
PRK02362 737 ski2-like helicase; Provisional 99.96
PRK00254 720 ski2-like helicase; Provisional 99.96
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.96
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.96
PRK09401 1176 reverse gyrase; Reviewed 99.96
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.95
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.95
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.95
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.95
PRK14701 1638 reverse gyrase; Provisional 99.95
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.94
PRK01172 674 ski2-like helicase; Provisional 99.94
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.94
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.94
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.94
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.94
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.94
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.93
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.93
PHA02558501 uvsW UvsW helicase; Provisional 99.93
PRK13766 773 Hef nuclease; Provisional 99.92
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.92
PRK04914 956 ATP-dependent helicase HepA; Validated 99.9
COG1202830 Superfamily II helicase, archaea-specific [General 99.9
COG1204 766 Superfamily II helicase [General function predicti 99.87
KOG0354746 consensus DEAD-box like helicase [General function 99.86
COG1205 851 Distinct helicase family with a unique C-terminal 99.86
PRK05580679 primosome assembly protein PriA; Validated 99.86
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.86
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.85
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.85
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.83
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.81
PRK05298652 excinuclease ABC subunit B; Provisional 99.81
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.81
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.8
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.8
PRK09694878 helicase Cas3; Provisional 99.8
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.8
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.78
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.76
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.76
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.74
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.73
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.72
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.72
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.71
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.71
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.7
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.65
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.65
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.62
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.61
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.59
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.58
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.58
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.58
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.57
smart0049082 HELICc helicase superfamily c-terminal domain. 99.53
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.52
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.47
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.43
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.41
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.39
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.38
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.36
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.33
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.29
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.29
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.28
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.27
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.25
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.2
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.14
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.07
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.06
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.05
KOG1123776 consensus RNA polymerase II transcription initiati 99.04
COG4096 875 HsdR Type I site-specific restriction-modification 99.03
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 99.02
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 98.96
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.93
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.89
KOG0387923 consensus Transcription-coupled repair protein CSB 98.86
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.81
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.66
smart00487201 DEXDc DEAD-like helicases superfamily. 98.65
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.6
PRK14873665 primosome assembly protein PriA; Provisional 98.59
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.58
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.47
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.47
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 98.4
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.34
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.29
COG4889 1518 Predicted helicase [General function prediction on 98.17
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.14
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.96
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 97.94
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.92
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 97.83
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.8
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.74
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.7
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.7
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.67
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.66
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.31
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.25
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 97.21
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 96.88
PF04851184 ResIII: Type III restriction enzyme, res subunit; 96.62
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 96.46
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.29
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 95.95
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 95.93
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.58
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.48
KOG4439901 consensus RNA polymerase II transcription terminat 95.44
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.29
PRK05580 679 primosome assembly protein PriA; Validated 95.28
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 95.27
COG0610 962 Type I site-specific restriction-modification syst 95.22
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 95.09
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.94
TIGR00595 505 priA primosomal protein N'. All proteins in this f 94.8
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 94.72
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.5
PF13871278 Helicase_C_4: Helicase_C-like 94.22
PRK14873 665 primosome assembly protein PriA; Provisional 94.16
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 94.13
COG1198 730 PriA Primosomal protein N' (replication factor Y) 93.93
COG1200677 RecG RecG-like helicase [DNA replication, recombin 92.87
PRK10689 1147 transcription-repair coupling factor; Provisional 92.37
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 92.3
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 90.92
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 90.64
PRK14701 1638 reverse gyrase; Provisional 90.47
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 90.46
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 90.18
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 88.62
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 88.15
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 87.87
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 87.1
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 86.41
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 85.85
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 84.72
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 84.57
smart00489289 DEXDc3 DEAD-like helicases superfamily. 84.37
smart00488289 DEXDc2 DEAD-like helicases superfamily. 84.37
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 83.05
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 82.96
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 82.86
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 82.62
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 82.06
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 81.2
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 80.94
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 80.35
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 80.33
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-109  Score=816.52  Aligned_cols=439  Identities=49%  Similarity=0.786  Sum_probs=385.3

Q ss_pred             ChHHHHhhcCCCeeEEEEeCCCCHHHHHHHHcCCCcEEEECcchHHHHHHcCCCCCCcCCCCcceEEecccccccCCCcH
Q 011428            1 MALIELCKGQVQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYE   80 (486)
Q Consensus         1 ~~l~~~~~~~~~i~v~~l~g~~~~~~q~~~l~~~~dIvV~TP~rl~~~l~~~~~~~~~~l~~l~~lViDEad~ll~~g~~   80 (486)
                      ++|++||++  +++++++++++++.++..+|.+.|||||+||++++.|+..+.+   ..++.|++||+||||+++++||+
T Consensus       114 ekL~~~c~k--~lr~~nl~s~~sdsv~~~~L~d~pdIvV~TP~~ll~~~~~~~~---~~~~~l~~LVvDEADLllsfGYe  188 (569)
T KOG0346|consen  114 EKLVEYCSK--DLRAINLASSMSDSVNSVALMDLPDIVVATPAKLLRHLAAGVL---EYLDSLSFLVVDEADLLLSFGYE  188 (569)
T ss_pred             HHHHHHHHH--hhhhhhhhcccchHHHHHHHccCCCeEEeChHHHHHHHhhccc---hhhhheeeEEechhhhhhhcccH
Confidence            479999999  9999999999999999999999999999999999999998853   67899999999999999999999


Q ss_pred             HHHHHHHHHCCCCccEEEEeeecChhHHHHHHHhccCCcEEEcCCcCCcccccccCcceEEEEEcchhhhHHHHHHHHHh
Q 011428           81 DDLKALSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKL  160 (486)
Q Consensus        81 ~~l~~i~~~lp~~~q~il~SATl~~~v~~l~~~~l~~p~~i~l~~~~~~~~~~~~~~l~q~~i~~~~~~k~~~l~~llk~  160 (486)
                      +++..|.+++|+.+|++|||||+++++..|++++|+||+++++.+.    +...+++++||++.|++++|++++|++|++
T Consensus       189 edlk~l~~~LPr~~Q~~LmSATl~dDv~~LKkL~l~nPviLkl~e~----el~~~dqL~Qy~v~cse~DKflllyallKL  264 (569)
T KOG0346|consen  189 EDLKKLRSHLPRIYQCFLMSATLSDDVQALKKLFLHNPVILKLTEG----ELPNPDQLTQYQVKCSEEDKFLLLYALLKL  264 (569)
T ss_pred             HHHHHHHHhCCchhhheeehhhhhhHHHHHHHHhccCCeEEEeccc----cCCCcccceEEEEEeccchhHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999872    223567999999999999999999999999


Q ss_pred             hccCCeEEEEecCHHHHHHHHHHHHHcCCceeecCCCCCHHHHHHHHHHHhcCCCcEEEEcCCCCccccccCC-CCCCcc
Q 011428          161 ELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSD-EGGHVD  239 (486)
Q Consensus       161 ~~~~~k~IIFvns~~~~~~l~~~L~~~gi~~~~lhs~l~~~~R~~i~~~F~~g~~~iLIaTd~~~~~~~~~~~-~~~~~~  239 (486)
                      .+++|++||||||+++||+|.+||++|||++|+|||+||.++|+||+++||.|.|+|+||||..+..+..+++ .++..+
T Consensus       265 ~LI~gKsliFVNtIdr~YrLkLfLeqFGiksciLNseLP~NSR~Hii~QFNkG~YdivIAtD~s~~~~~~eee~kgk~~e  344 (569)
T KOG0346|consen  265 RLIRGKSLIFVNTIDRCYRLKLFLEQFGIKSCILNSELPANSRCHIIEQFNKGLYDIVIATDDSADGDKLEEEVKGKSDE  344 (569)
T ss_pred             HHhcCceEEEEechhhhHHHHHHHHHhCcHhhhhcccccccchhhHHHHhhCcceeEEEEccCccchhhhhccccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999999976422111111 111111


Q ss_pred             cc-cccCCCCCcccccccccccCccCCccEEEEeCCCCChhhHHHhhhhcccCCCCceEEEEeCcchhhHHHHHHHHhcc
Q 011428          240 SR-KSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGD  318 (486)
Q Consensus       240 ~~-~~~~~~~~~~~~~~gvsrGID~~~V~~VI~~d~P~s~~~yihRiGRtgR~g~~G~ai~fv~~~e~~~~~~~~~~l~~  318 (486)
                      .. +..++.+.++|.|||++|||||.+|++|||||+|.++.+||||+|||||+|++|++++||+|.+......+++.+..
T Consensus       345 ~~~kndkkskkK~D~E~GVsRGIDF~~V~~VlNFD~P~t~~sYIHRvGRTaRg~n~GtalSfv~P~e~~g~~~le~~~~d  424 (569)
T KOG0346|consen  345 KNPKNDKKSKKKLDKESGVSRGIDFHHVSNVLNFDFPETVTSYIHRVGRTARGNNKGTALSFVSPKEEFGKESLESILKD  424 (569)
T ss_pred             cCCCCccccccccCchhchhccccchheeeeeecCCCCchHHHHHhccccccCCCCCceEEEecchHHhhhhHHHHHHhh
Confidence            11 11223344899999999999999999999999999999999999999999999999999999999888888888876


Q ss_pred             ccccc-cCCCCCcccccHHHHHHHHhhHHHHHHHHhHHHHHHHHHHHHHHHHhchHHHHHhhccCccchhhhcccccCCC
Q 011428          319 DENED-SNIIAPFPLLAQNAVESLRYRAEDVAKSVTKIAVRESRAQDLRNEILNSEKLKAHFEVNPKDLDLLKHDKDLSK  397 (486)
Q Consensus       319 ~~~~~-~~~~~~~~~~~~~~ve~~~~r~~d~~~~vt~~~~~ear~~e~~~e~l~s~~lk~~f~~n~~dl~~l~~d~~l~~  397 (486)
                      ...+. ...++||+ |+++++|+||||++|+|+++|++||+++|++||++|+++||+||+||++||+||++|+||+++++
T Consensus       425 ~~~~~~~qilqPY~-f~~eevesfryR~eD~~ravTkvAvreaR~kEikqEll~SeKLK~~FeeNprdl~lLrhDkpl~~  503 (569)
T KOG0346|consen  425 ENRQEGRQILQPYQ-FRMEEVESFRYRAEDALRAVTKVAVREARLKEIKQELLNSEKLKAFFEENPRDLQLLRHDKPLRL  503 (569)
T ss_pred             HHhhcCcccccccc-chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhcChHHHHHhhcCCcccc
Confidence            54333 23599999 99999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccccCCCccccchhhHHHHHhHhHHH---hhcCCCCCCCCCCCCCCCCCCCCCcccccCc
Q 011428          398 KPPASHLRDVPDYLLDAKTQEACKMVKLAR---AAMGNKNSSRRQGPRRKFRKSDPLKSFSAEP  458 (486)
Q Consensus       398 ~~~~~~l~~vp~yl~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~pl~~~~~~~  458 (486)
                      ..+++||+|||+||+|+++++.++.+.-.+   +|+++.         ++++..|||++|..++
T Consensus       504 ~~~qphL~dvpeYlvp~alr~~~~~~k~r~~g~~~~r~n---------~~rk~~kp~r~f~~kg  558 (569)
T KOG0346|consen  504 AIVQPHLKDVPEYLVPEALRGVVKSVKTRAPGFSPFRNN---------KRRKVQKPLRKFQPKG  558 (569)
T ss_pred             cccchhhccCchhhCCHHHhhcccccccccCCCccchhh---------hhhhccCchhhcCCCC
Confidence            999999999999999999999755422100   111111         3346778888887644

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-22
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-22
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-22
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-22
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 8e-20
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 9e-20
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-19
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-19
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-19
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-19
2vso_A395 Crystal Structure Of A Translation Initiation Compl 4e-18
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-17
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-17
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 3e-17
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-17
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 1e-16
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-16
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 1e-16
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-16
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 5e-16
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 6e-16
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 8e-16
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 9e-16
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-15
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 4e-14
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-12
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 2e-10
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-10
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 8e-10
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 8e-10
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-09
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 1e-08
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-08
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-08
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-08
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-08
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 3e-08
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 8e-08
2jgn_A185 Ddx3 Helicase Domain Length = 185 1e-07
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 2e-07
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 2e-07
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 4e-07
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 8e-07
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 8e-07
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-06
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-06
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 3e-06
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 4e-06
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 5e-06
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 1e-05
3ly5_A262 Ddx18 Dead-Domain Length = 262 4e-05
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 5e-05
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 5e-05
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 1e-04
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 3e-04
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 6e-04
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 128/286 (44%), Gaps = 51/286 (17%)
Query: 37  IVIATPG-CMPKCLSTGVLQSKSFSDSLKILVLDEADLLL-SYGYEDDLKALSAVIPRGC 94
           IVI TPG  +  C     +  K     +K+ VLDEAD+++ + G++D    +  ++PR C
Sbjct: 213 IVIGTPGTVLDWCSKLKFIDPKK----IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNC 268
Query: 95  QCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKXXXX 154
           Q LL SAT    V K  + ++ +P ++ L      ++E     ++Q+++ CS RD+    
Sbjct: 269 QMLLFSATFEDSVWKFAQKVVPDPNVIKLK-----REEETLDTIKQYYVLCSSRDEKFQA 323
Query: 155 XXXXXXXXVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGL 214
                      +A+IF +T   A  L   L K G + A+L+ E+    R  ++E F  G 
Sbjct: 324 LCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGK 383
Query: 215 FDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEM 274
              L+ T+                                    RGID + V  VINF++
Sbjct: 384 EKVLVTTN---------------------------------VCARGIDVEQVSVVINFDL 410
Query: 275 PQNAAG------YVHRIGRTGRAYNTGASVSLV-SPDEMKIFEEIK 313
           P +  G      Y+HRIGRTGR    G +V++V S   M I   I+
Sbjct: 411 PVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQ 456
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 6e-52
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 8e-52
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 6e-50
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-48
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 7e-48
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-47
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-47
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-45
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-45
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 5e-45
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-44
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-43
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 6e-43
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-40
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-39
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 1e-34
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-33
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 6e-33
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 6e-30
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-28
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 3e-28
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-28
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 1e-27
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 4e-27
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-26
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-18
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 9e-17
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-16
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 3e-13
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-13
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 1e-12
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-12
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-11
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 4e-11
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 6e-11
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 9e-11
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 1e-10
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 3e-10
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-09
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 9e-09
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-06
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 5e-04
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
 Score =  180 bits (458), Expect = 6e-52
 Identities = 79/323 (24%), Positives = 134/323 (41%), Gaps = 58/323 (17%)

Query: 26  DLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKA 85
           D+   L     I++ TPG +    S  V           + ++DEAD +LS  ++  ++ 
Sbjct: 132 DILR-LNETVHILVGTPGRVLDLASRKVADL----SDCSLFIMDEADKMLSRDFKTIIEQ 186

Query: 86  LSAVIPRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISC 145
           + + +P   Q LL SAT    V +     LH PY +       + +E+  K + Q++   
Sbjct: 187 ILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEIN------LMEELTLKGITQYYAFV 240

Query: 146 SERDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLH 205
            ER KL  + TL     +  +A+IF N+ +    L   +   G      +A + Q  R  
Sbjct: 241 EERQKLHCLNTLFSKLQI-NQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNK 299

Query: 206 ILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPKAKLDSEFGVV-RGIDFK 264
           +  EF  G    L+ +D                                  ++ RGID +
Sbjct: 300 VFHEFRQGKVRTLVCSD----------------------------------LLTRGIDIQ 325

Query: 265 NVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPDEMKIFEEIKSFVGDDENEDS 324
            V+ VINF+ P+ A  Y+HRIGR+GR  + G +++L++ ++     +I       E E  
Sbjct: 326 AVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKI-------EQELG 378

Query: 325 NIIAPFPLLAQNAVESLRYRAED 347
             IA  P      ++   Y AE+
Sbjct: 379 TEIAAIPAT----IDKSLYVAEN 397
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.98
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.98
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.98
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.97
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.97
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.97
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.97
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.97
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.96
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.96
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.96
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.96
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.96
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.96
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.96
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.96
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.96
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.96
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.96
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.95
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.95
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.95
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.95
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.95
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.95
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.95
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.95
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.94
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.94
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.94
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.93
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.93
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.93
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.93
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.88
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.93
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.92
3h1t_A590 Type I site-specific restriction-modification syst 99.92
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.92
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.9
3jux_A822 Protein translocase subunit SECA; protein transloc 99.89
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.88
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.84
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.83
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.81
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.74
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.69
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.67
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.66
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.64
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.62
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.62
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.62
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.62
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.61
3bor_A237 Human initiation factor 4A-II; translation initiat 99.61
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.6
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.59
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.58
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.57
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.57
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.44
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.05
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.99
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.8
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.57
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.35
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.07
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.88
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 95.94
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 95.63
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 94.26
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.03
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 90.87
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 90.82
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 90.61
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 86.65
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 83.15
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 81.06
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 80.12
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=4.6e-44  Score=375.05  Aligned_cols=265  Identities=26%  Similarity=0.389  Sum_probs=241.4

Q ss_pred             CCeeEEEEeCCCCHHHHHHHHcCCCcEEEECcchHHHHHHcCCCCCCcCCCCcceEEecccccccCCCcHHHHHHHHHHC
Q 011428           11 VQLKVVQLTSSMPASDLRAALAGPPDIVIATPGCMPKCLSTGVLQSKSFSDSLKILVLDEADLLLSYGYEDDLKALSAVI   90 (486)
Q Consensus        11 ~~i~v~~l~g~~~~~~q~~~l~~~~dIvV~TP~rl~~~l~~~~~~~~~~l~~l~~lViDEad~ll~~g~~~~l~~i~~~l   90 (486)
                      .++++..++||.+...|...+..+++|+|+||++|++++..+.    ..++++++|||||||+|+++||..++..|+..+
T Consensus       156 ~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~----~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~  231 (434)
T 2db3_A          156 SYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTF----ITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHV  231 (434)
T ss_dssp             SSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTS----CCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCT
T ss_pred             CCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCC----cccccCCeEEEccHhhhhccCcHHHHHHHHHhc
Confidence            4688999999999999999999999999999999999999765    678999999999999999999999999999885


Q ss_pred             --CCCccEEEEeeecChhHHHHHHHhccCCcEEEcCCcCCcccccccCcceEEEEEcchhhhHHHHHHHHHhhccCCeEE
Q 011428           91 --PRGCQCLLMSATSSSDVDKLKKLILHNPYILTLPEVGDVKDEVIPKNVQQFWISCSERDKLLYILTLLKLELVQKKAL  168 (486)
Q Consensus        91 --p~~~q~il~SATl~~~v~~l~~~~l~~p~~i~l~~~~~~~~~~~~~~l~q~~i~~~~~~k~~~l~~llk~~~~~~k~I  168 (486)
                        +...|+++||||+|.++..+...++.+|..+.+..     ......++.|.+..+...+|...+..++....  .++|
T Consensus       232 ~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~-----~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~--~~~l  304 (434)
T 2db3_A          232 TMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGI-----VGGACSDVKQTIYEVNKYAKRSKLIEILSEQA--DGTI  304 (434)
T ss_dssp             TSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESS-----TTCCCTTEEEEEEECCGGGHHHHHHHHHHHCC--TTEE
T ss_pred             CCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEecc-----ccccccccceEEEEeCcHHHHHHHHHHHHhCC--CCEE
Confidence              57899999999999999999999999999988765     33455678999999999999999999887643  4599


Q ss_pred             EEecCHHHHHHHHHHHHHcCCceeecCCCCCHHHHHHHHHHHhcCCCcEEEEcCCCCccccccCCCCCCcccccccCCCC
Q 011428          169 IFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPK  248 (486)
Q Consensus       169 IFvns~~~~~~l~~~L~~~gi~~~~lhs~l~~~~R~~i~~~F~~g~~~iLIaTd~~~~~~~~~~~~~~~~~~~~~~~~~~  248 (486)
                      |||+++..|..++.+|...|+.+..+||++++.+|..+++.|++|..+||||||+                         
T Consensus       305 VF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v-------------------------  359 (434)
T 2db3_A          305 VFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSV-------------------------  359 (434)
T ss_dssp             EECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGG-------------------------
T ss_pred             EEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchh-------------------------
Confidence            9999999999999999999999999999999999999999999999999999998                         


Q ss_pred             CcccccccccccCccCCccEEEEeCCCCChhhHHHhhhhcccCCCCceEEEEeCcc-hhhHHHHHHHHhccc
Q 011428          249 AKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGRAYNTGASVSLVSPD-EMKIFEEIKSFVGDD  319 (486)
Q Consensus       249 ~~~~~~~gvsrGID~~~V~~VI~~d~P~s~~~yihRiGRtgR~g~~G~ai~fv~~~-e~~~~~~~~~~l~~~  319 (486)
                              ++||||+|+|++|||||+|.+..+|+||+|||||+|+.|.|++|+++. +...+..+.+++...
T Consensus       360 --------~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~~l~~~  423 (434)
T 2db3_A          360 --------ASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGS  423 (434)
T ss_dssp             --------GTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHHHHHHHHHT
T ss_pred             --------hhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHHHHHHHHHc
Confidence                    469999999999999999999999999999999999999999999965 556777777777544
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 486
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-18
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-17
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-16
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-16
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-15
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-14
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 3e-13
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-13
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-12
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 3e-12
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-11
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-11
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 2e-10
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-10
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 3e-10
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 6e-10
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-09
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 4e-09
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 6e-08
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-07
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-07
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 6e-07
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 6e-04
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 0.001
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 0.001
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.004
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

 Score = 84.2 bits (208), Expect = 1e-18
 Identities = 27/165 (16%), Positives = 47/165 (28%), Gaps = 43/165 (26%)

Query: 137 NVQQFWISCSERDKLLYILTLLKLELVQ-KKALIFTNTIDMAFRLKLFLEKFGIKSAILN 195
           N+++  +S +      +    + LE+++  + LIF ++      L   L   GI +    
Sbjct: 10  NIEEVALSTTGEIP--FYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYY 67

Query: 196 AELPQNSRLH----------ILEEFNAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKK 245
             L  +               L     G FD +I  +                       
Sbjct: 68  RGLDVSVIPTSGDVVVVATDALMTGFTGDFDSVIDCNTC--------------------- 106

Query: 246 HPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGR 290
                                 T+    +PQ+A     R GRTGR
Sbjct: 107 --------VTQT-VDFSLDPTFTIETTTLPQDAVSRTQRRGRTGR 142
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.98
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.98
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.97
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.96
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.92
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.92
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.88
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.83
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.8
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.8
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.79
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.79
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.78
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.77
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.75
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.75
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.73
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.72
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.72
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.71
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.7
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.69
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.58
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.36
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.35
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.34
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.18
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.7
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.69
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.66
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.6
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.44
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.07
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.92
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.85
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.07
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.04
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.92
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.84
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.57
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 95.65
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 89.76
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 88.52
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 88.21
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 82.06
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.2e-32  Score=247.47  Aligned_cols=154  Identities=28%  Similarity=0.501  Sum_probs=142.5

Q ss_pred             ccccCcceEEEEEcch-hhhHHHHHHHHHhhccCCeEEEEecCHHHHHHHHHHHHHcCCceeecCCCCCHHHHHHHHHHH
Q 011428          132 EVIPKNVQQFWISCSE-RDKLLYILTLLKLELVQKKALIFTNTIDMAFRLKLFLEKFGIKSAILNAELPQNSRLHILEEF  210 (486)
Q Consensus       132 ~~~~~~l~q~~i~~~~-~~k~~~l~~llk~~~~~~k~IIFvns~~~~~~l~~~L~~~gi~~~~lhs~l~~~~R~~i~~~F  210 (486)
                      +.+..+++|+|+.|+. ++|+..|..+++.. ...++||||++.+.|+.++..|...|+.+..+||++++++|..+++.|
T Consensus         2 ~~tl~~i~q~~v~v~~~~~K~~~L~~ll~~~-~~~k~iiF~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f   80 (168)
T d2j0sa2           2 ELTLEGIKQFFVAVEREEWKFDTLCDLYDTL-TITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEF   80 (168)
T ss_dssp             GCSCTTEEEEEEEESSTTHHHHHHHHHHHHH-TSSEEEEECSSHHHHHHHHHHHHHTTCCCEEECTTSCHHHHHHHHHHH
T ss_pred             CCCCCCcEEEEEEecChHHHHHHHHHHHHhC-CCCceEEEeeeHHHHHHHHHHhhhcccchhhhhhhhhHHHHHHHHHHH
Confidence            3456799999999986 45999999998764 467999999999999999999999999999999999999999999999


Q ss_pred             hcCCCcEEEEcCCCCccccccCCCCCCcccccccCCCCCcccccccccccCccCCccEEEEeCCCCChhhHHHhhhhccc
Q 011428          211 NAGLFDYLIATDDTQTKEKDQSDEGGHVDSRKSKKHPKAKLDSEFGVVRGIDFKNVHTVINFEMPQNAAGYVHRIGRTGR  290 (486)
Q Consensus       211 ~~g~~~iLIaTd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gvsrGID~~~V~~VI~~d~P~s~~~yihRiGRtgR  290 (486)
                      +.|.+++|||||.                                 ++||||+|+|++|||||+|.+..+|+||+|||||
T Consensus        81 k~g~~~iLv~Td~---------------------------------~~rGiDi~~v~~VIn~d~P~~~~~yihR~GR~gR  127 (168)
T d2j0sa2          81 RSGASRVLISTDV---------------------------------WARGLDVPQVSLIINYDLPNNRELYIHRIGRSGR  127 (168)
T ss_dssp             HHTSSCEEEECGG---------------------------------GSSSCCCTTEEEEEESSCCSSHHHHHHHHTTSSG
T ss_pred             hcCCccEEeccch---------------------------------hcccccccCcceEEEecCCcCHHHHHhhhccccc
Confidence            9999999999999                                 5799999999999999999999999999999999


Q ss_pred             CCCCceEEEEeCcchhhHHHHHHHHhccc
Q 011428          291 AYNTGASVSLVSPDEMKIFEEIKSFVGDD  319 (486)
Q Consensus       291 ~g~~G~ai~fv~~~e~~~~~~~~~~l~~~  319 (486)
                      +|+.|.+++|+++.|...+..+++.++..
T Consensus       128 ~g~~G~~i~~~~~~d~~~~~~i~~~~~~~  156 (168)
T d2j0sa2         128 YGRKGVAINFVKNDDIRILRDIEQYYSTQ  156 (168)
T ss_dssp             GGCCEEEEEEEEGGGHHHHHHHHHHTTCC
T ss_pred             cCCCcEEEEEECHHHHHHHHHHHHHHcCc
Confidence            99999999999999999888888877544
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure