Citrus Sinensis ID: 011688


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
cccHHHHHHHHHHHHHcccccHHHHHccccccccEEEcccccccccHHHHHHHHccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccHHcHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHHccccccEEEccccccccccHHHHHccccccEEEcccccccccccHHccccccccEEEccccccccccHHHccccccccEEEccccccccccHHHccccccccEEEccccccccHHHHHHHccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHccccccccEEEccccccccHHHHHHHccccccEEcccccccccHHHHHHHHccccccEEEcccccccHHHHHHccccccccEEEcccccccHHHHHHHHHcccccccccccc
cccccHHHHHHHHHHHccccccccHHHcccccccEEEcccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEcccccccccccHHHccccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccHEccccc
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALqdlclgqypgvndkWMDVIASQGSSLlsvdlsgsdvtdsglihlkdcsnlqsldfnFCIQisdgglehlrglsnltslsfRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIkwcncitdsdmkplsgltnlkslQISCSKVTDSGIAYLKGLQKLTllnlegcpvtAACLDSLSALGSLFYLnlnrcqlsddgcekfsrltnleslnldscgigdeglvnltglcnlkclelsdtqvgssglrhlsgltnlesinlsftgisdgslrklaglsslkslnldarQITDTGLAALtsltglthldlfgaritDSGAAYLRNFKNLRSLEIcgggltdagvkhikdlssltllnlsqncnltdkTLELISGLTGlvslnvsnsritsaglrhlkplknlrsltlESCKVTANDIkrlqsrdlpnlvsfrpe
mlprdisqqIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGlvnlkglmkLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSritsaglrhlkplknlrslTLESCKVtandikrlqsrdlpnlvsfrpe
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQgssllsvdlsgsdvtdsglIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYlkglqkltllnlEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQItdtglaaltsltglthlDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDlssltllnlsqncnlTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
********QIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDI*****************
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRP*
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSF***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query479 2.2.26 [Sep-21-2011]
Q8BID8400 F-box/LRR-repeat protein yes no 0.657 0.787 0.305 6e-19
Q17R01400 F-box/LRR-repeat protein yes no 0.657 0.787 0.305 6e-19
Q8N1E6418 F-box/LRR-repeat protein yes no 0.684 0.784 0.301 1e-18
Q723K6 800 Internalin-A OS=Listeria yes no 0.659 0.395 0.310 7e-15
G2K3G6 800 Internalin-A OS=Listeria yes no 0.659 0.395 0.308 2e-14
P0DJM0 800 Internalin-A OS=Listeria yes no 0.659 0.395 0.305 8e-14
Q8NEE6735 F-box/LRR-repeat protein no no 0.751 0.489 0.264 2e-13
Q723X5 1775 Internalin-I OS=Listeria no no 0.720 0.194 0.256 4e-12
Q8YA32 1778 Internalin-I OS=Listeria no no 0.739 0.199 0.271 1e-11
P23799630 Putative adenylate cyclas N/A no 0.787 0.598 0.291 3e-11
>sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 116/380 (30%), Positives = 184/380 (48%), Gaps = 65/380 (17%)

Query: 103 RGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHG---GLVNLKGLMKLES 159
           RG+  +  LS RR+ +   QGM       N+  L+L  C  +     G   ++ +  L +
Sbjct: 68  RGIRRVQILSLRRSLSYVIQGMA------NIESLNLSGCYNLTDNGLGHAFVQEIGSLRA 121

Query: 160 LNIKWCNCITDSDMKPLSGLTNLKSLQI----SCSKVTDSGIAYLK-GLQKLTLLNLEGC 214
           LN+  C  ITDS +  ++    LK L++     CS +T++G+  +  GLQ+L  LNL  C
Sbjct: 122 LNLSLCKQITDSSLGRIA--QYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSC 179

Query: 215 PVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTG 274
                                    LSD G    + +T   +          EG + L  
Sbjct: 180 R-----------------------HLSDVGIGHLAGMTRSAA----------EGCLGLEQ 206

Query: 275 LCNLKCLELSDTQVGSSGLRHLS-GLTNLESINLSFTG-ISDGSLRKLAGLSSLKSLNLD 332
           L    C +L+D       L+H+S GLT L  +NLSF G ISD  L  L+ + SL+SLNL 
Sbjct: 207 LTLQDCQKLTDLS-----LKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLR 261

Query: 333 A-RQITDTGLA--ALTSLTGLTHLDL-FGARITDSGAAYL-RNFKNLRSLEICGGGLTDA 387
           +   I+DTG+   A+ SL  L+ LD+ F  ++ D   AY+ +    L+SL +C   ++D 
Sbjct: 262 SCDNISDTGIMHLAMGSLR-LSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDD 320

Query: 388 GV-KHIKDLSSLTLLNLSQNCNLTDKTLELIS-GLTGLVSLNVSN-SRITSAGLRHLKPL 444
           G+ + ++ +  L  LN+ Q   +TDK LELI+  L+ L  +++   +RIT  GL  +  L
Sbjct: 321 GINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQL 380

Query: 445 KNLRSLTLESCKVTANDIKR 464
             L+ L L   ++T ++  R
Sbjct: 381 PCLKVLNLGLWQMTDSEKVR 400




Substrate-recognition component of some (SKP1-CUL1-F-box protein)-type E3 ubiquitin-protein ligase complexes. The SCF(FBXL14) complex acts by mediating ubiquitination and subsequent degradation of SNAI1.
Mus musculus (taxid: 10090)
>sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 Back     alignment and function description
>sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 Back     alignment and function description
>sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 Back     alignment and function description
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function description
>sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 Back     alignment and function description
>sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=4 SV=1 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
225463572578 PREDICTED: F-box/LRR-repeat protein 14 [ 1.0 0.828 0.771 0.0
359484681578 PREDICTED: insulin-like growth factor-bi 1.0 0.828 0.723 0.0
449436168578 PREDICTED: F-box/LRR-repeat protein 14-l 1.0 0.828 0.743 0.0
356519276577 PREDICTED: F-box/LRR-repeat protein 14-l 0.997 0.828 0.760 0.0
357458869 585 F-box/LRR-repeat protein [Medicago trunc 1.0 0.818 0.720 0.0
182407840 580 F-box-containing protein 1 [Malus x dome 1.0 0.825 0.715 0.0
224120462576 predicted protein [Populus trichocarpa] 0.997 0.829 0.709 0.0
388500850577 unknown [Medicago truncatula] 1.0 0.830 0.721 0.0
297844484578 leucine-rich repeat family protein [Arab 0.997 0.826 0.747 0.0
357468127573 F-box/LRR-repeat protein [Medicago trunc 0.987 0.825 0.718 0.0
>gi|225463572|ref|XP_002270172.1| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera] gi|297743556|emb|CBI36423.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/503 (77%), Positives = 438/503 (87%), Gaps = 24/503 (4%)

Query: 1   MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLL 60
           MLPRDISQQIFNELV+S+CLT+VSL+AF+DCALQD+ LG+YPGV+D WMDVI+SQG SLL
Sbjct: 76  MLPRDISQQIFNELVFSQCLTDVSLKAFQDCALQDIYLGEYPGVSDSWMDVISSQGVSLL 135

Query: 61  SVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAIT 120
           SVDLSGS++T+SGLIHLKDC+NLQ+L+ N+C QISD GL+H+ GLSNLT+LSFRRNNAIT
Sbjct: 136 SVDLSGSEITNSGLIHLKDCTNLQALNLNYCDQISDHGLKHISGLSNLTTLSFRRNNAIT 195

Query: 121 AQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLT 180
           AQGM AF+ L+NLVKLDLERC  IHGGL++LKGL KLESLNI  C+CITD+D+KPLSGLT
Sbjct: 196 AQGMSAFSSLVNLVKLDLERCPGIHGGLIHLKGLTKLESLNINMCHCITDADLKPLSGLT 255

Query: 181 NLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQL 240
           NLK L+IS SKVTD G+AYLKGL KL LLN+EGCPVTAACL+SLS L SL  LNLNR  L
Sbjct: 256 NLKGLEISRSKVTDDGVAYLKGLHKLALLNMEGCPVTAACLESLSDLPSLLSLNLNRSML 315

Query: 241 SDDGCEKFSR------------------------LTNLESLNLDSCGIGDEGLVNLTGLC 276
           SDDGCE F+R                        LTNLESLNLDSC I DEGL NLTGL 
Sbjct: 316 SDDGCENFARQENLRVLNLGFNDLTDACLVHLKGLTNLESLNLDSCRICDEGLANLTGLR 375

Query: 277 NLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQI 336
           +LKCLELSDT+VGS+GLRHLSGL NLESINLSFT ++D  LRKL+ LSSLKSLNLDARQI
Sbjct: 376 HLKCLELSDTEVGSNGLRHLSGLANLESINLSFTAVTDSGLRKLSALSSLKSLNLDARQI 435

Query: 337 TDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLS 396
           TD GLAALTSLTGLTHLDLFGARITDSG +YLRNFKNL+SLEICGGGLTDAGVK+IKDL+
Sbjct: 436 TDAGLAALTSLTGLTHLDLFGARITDSGTSYLRNFKNLQSLEICGGGLTDAGVKNIKDLT 495

Query: 397 SLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCK 456
            LT+LNLSQNCNLTDK+LELISGLT LVSL+VSNSRIT+AGL+HLK LKNL+SLTL+SCK
Sbjct: 496 CLTVLNLSQNCNLTDKSLELISGLTALVSLSVSNSRITNAGLQHLKQLKNLKSLTLDSCK 555

Query: 457 VTANDIKRLQSRDLPNLVSFRPE 479
           VT NDIK+LQS+DLPNLVSFRPE
Sbjct: 556 VTVNDIKKLQSKDLPNLVSFRPE 578




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359484681|ref|XP_002262830.2| PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit-like [Vitis vinifera] gi|296084545|emb|CBI25566.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436168|ref|XP_004135866.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus] gi|449509305|ref|XP_004163550.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356519276|ref|XP_003528299.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|357458869|ref|XP_003599715.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355488763|gb|AES69966.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|182407840|gb|ACB87911.1| F-box-containing protein 1 [Malus x domestica] Back     alignment and taxonomy information
>gi|224120462|ref|XP_002331054.1| predicted protein [Populus trichocarpa] gi|222872984|gb|EEF10115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388500850|gb|AFK38491.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297844484|ref|XP_002890123.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335965|gb|EFH66382.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357468127|ref|XP_003604348.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355505403|gb|AES86545.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
TAIR|locus:2036199585 AT1G15740 [Arabidopsis thalian 0.991 0.811 0.491 1.4e-110
TAIR|locus:2138131597 AT4G23840 "AT4G23840" [Arabido 0.939 0.753 0.253 5.2e-24
FB|FBgn0020257538 ppa "partner of paired" [Droso 0.478 0.425 0.314 5.4e-18
UNIPROTKB|F1NMM1345 FBXL14 "Uncharacterized protei 0.617 0.857 0.281 4.3e-17
UNIPROTKB|Q17R01400 FBXL14 "F-box/LRR-repeat prote 0.617 0.74 0.275 2.2e-15
MGI|MGI:2141676400 Fbxl14 "F-box and leucine-rich 0.617 0.74 0.275 2.2e-15
RGD|1305523400 Fbxl14 "F-box and leucine-rich 0.617 0.74 0.275 2.2e-15
UNIPROTKB|Q8N1E6418 FBXL14 "F-box/LRR-repeat prote 0.617 0.708 0.275 2.6e-15
ZFIN|ZDB-GENE-030131-3556400 fbxl14b "F-box and leucine-ric 0.617 0.74 0.272 2.4e-14
ZFIN|ZDB-GENE-030131-5920411 fbxl14a "F-box and leucine-ric 0.592 0.690 0.285 2.6e-14
TAIR|locus:2036199 AT1G15740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1092 (389.5 bits), Expect = 1.4e-110, P = 1.4e-110
 Identities = 236/480 (49%), Positives = 301/480 (62%)

Query:     2 LPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQXXXXXX 61
             LPRDISQQIF+ELVYS+ LT  SLEAFRDCA+QDL LG+YPGVND WMDVI+SQ      
Sbjct:    83 LPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVNDDWMDVISSQSTSLLS 142

Query:    62 XXXXXXXXXXXXXIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITA 121
                          + LK C+NL+SL+FNFC QIS+ GL HL GLSNLTSLSFRRN AITA
Sbjct:   143 VDFSGSDITDSGLVSLKGCTNLESLNFNFCDQISNRGLVHLSGLSNLTSLSFRRNAAITA 202

Query:   122 QGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTN 181
             QGM+A + L+NL KLDLE+C  I GGLV+L+ L KLESLNIKWCNCITD+DM+PLS LTN
Sbjct:   203 QGMRALSNLVNLKKLDLEKCPGIDGGLVHLRALTKLESLNIKWCNCITDADMEPLSVLTN 262

Query:   182 LKSLQISCSKVTDSGIAYXXXXXXXXXXXXEGCP-VTAACLDSLSALGSLFYLNLNRCQL 240
             L+SLQI CSK+TD GI+Y            EGC  VTAACLD+L+AL  L YLNLNRC  
Sbjct:   263 LRSLQICCSKITDIGISYLKGLNKLNLLNLEGCRHVTAACLDTLTALAGLMYLNLNRCNF 322

Query:   241 SDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLT 300
             SD GCEKFS L NL+ LNL    I +  LV+L GL  L+ L L   ++G  GL HLSG+ 
Sbjct:   323 SDSGCEKFSDLINLKILNLGMNNITNSCLVHLKGLTKLESLNLDSCRIGDEGLVHLSGML 382

Query:   301 NLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQIXXXXXXXXXXXXXXXXXDLFGARI 360
              L+S+ LS T +    LR L+GLS+L+S+NL    +                 +L    +
Sbjct:   383 ELKSLELSDTEVGSNGLRHLSGLSNLESINLSFTVVTDSGLRKLSGLTSLRTLNLDARHV 442

Query:   361 TDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDXXXXXXXXXXXXXXXTDKTLELISGL 420
             TD+G + L +   L  L++ G  +TD+G  H+++               TD  ++ I  L
Sbjct:   443 TDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGL-TDTGVKNIKDL 501

Query:   421 TGLVSLNVS-NSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 479
             + L  LN+S NS +T   L  +  L  L SL + + +V+++ ++ L  + L NL S   E
Sbjct:   502 SSLTLLNLSQNSNLTDKTLELISGLTGLVSLNVSNSRVSSSGLRHL--KPLKNLRSLTLE 559


GO:0005886 "plasma membrane" evidence=ISM
TAIR|locus:2138131 AT4G23840 "AT4G23840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0020257 ppa "partner of paired" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMM1 FBXL14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R01 FBXL14 "F-box/LRR-repeat protein 14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2141676 Fbxl14 "F-box and leucine-rich repeat protein 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305523 Fbxl14 "F-box and leucine-rich repeat protein 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N1E6 FBXL14 "F-box/LRR-repeat protein 14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3556 fbxl14b "F-box and leucine-rich repeat protein 14b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5920 fbxl14a "F-box and leucine-rich repeat protein 14a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00003249001
SubName- Full=Chromosome undetermined scaffold_141, whole genome shotgun sequence; (578 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037306001
SubName- Full=Chromosome undetermined scaffold_87, whole genome shotgun sequence; (446 aa)
       0.412

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-08
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 5e-07
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 4e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
 Score = 59.3 bits (144), Expect = 1e-09
 Identities = 68/232 (29%), Positives = 106/232 (45%), Gaps = 30/232 (12%)

Query: 206 LTLLNLEGCP-VTAACLDSLSALGSLFYLNLNRCQLSDDGC---EKFSRLTNLESLNLDS 261
           L+L      P    + L  L+    L  L+L+   L  DGC   E   R ++L+ L L++
Sbjct: 58  LSLNETGRIPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLESLLRSSSLQELKLNN 117

Query: 262 CGIGDEGLVNL-TGL----CNLKCLELSDTQVGSSGLRHLSGL----TNLESINLSFTGI 312
            G+GD GL  L  GL      L+ L L   ++  +    L+       +L+ +NL+  GI
Sbjct: 118 NGLGDRGLRLLAKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGI 177

Query: 313 SDGSLRKLA----GLSSLKSLNLDARQITDTGLAALT----SLTGLTHLDLFGARITDSG 364
            D  +R LA       +L+ L+L+   +TD G +AL     SL  L  L+L    +TD+G
Sbjct: 178 GDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAG 237

Query: 365 AAYLRN-----FKNLRSLEICGGGLTDAGVKH----IKDLSSLTLLNLSQNC 407
           AA L +       +L +L +    +TD G K     + +  SL  L+L  N 
Sbjct: 238 AAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNK 289


LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 479
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.78
KOG4237498 consensus Extracellular matrix protein slit, conta 99.74
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
KOG4341483 consensus F-box protein containing LRR [General fu 99.54
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.49
KOG4341483 consensus F-box protein containing LRR [General fu 99.46
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.42
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.24
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG0617264 consensus Ras suppressor protein (contains leucine 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.12
KOG0617264 consensus Ras suppressor protein (contains leucine 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.65
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.61
PLN03150623 hypothetical protein; Provisional 98.53
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.5
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.49
PLN03150623 hypothetical protein; Provisional 98.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.46
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.45
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.3
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.23
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.0
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.92
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.86
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.62
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.1
PRK15386 426 type III secretion protein GogB; Provisional 97.02
PRK15386 426 type III secretion protein GogB; Provisional 96.9
KOG4308 478 consensus LRR-containing protein [Function unknown 96.23
KOG4308 478 consensus LRR-containing protein [Function unknown 95.55
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.45
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.13
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.26
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.8
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.86
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.75
smart0037026 LRR Leucine-rich repeats, outliers. 88.75
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 85.87
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.5e-41  Score=349.67  Aligned_cols=418  Identities=20%  Similarity=0.196  Sum_probs=221.6

Q ss_pred             ccceeecCCCCCCCchHHHHHHhcCCCeeEEEeeCCCCCcchhhcccCCCCCCEEecCCCCCCChhHHHHhhCCCCCcEE
Q 011688           32 ALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSL  111 (479)
Q Consensus        32 ~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L  111 (479)
                      .++.+.++++.....    ......++|++|++++|.+....+..+..+++|++|++++| .+....+..++++++|++|
T Consensus       119 ~L~~L~Ls~n~l~~~----~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n-~l~~~~p~~~~~l~~L~~L  193 (968)
T PLN00113        119 SLRYLNLSNNNFTGS----IPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN-VLVGKIPNSLTNLTSLEFL  193 (968)
T ss_pred             CCCEEECcCCccccc----cCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccC-cccccCChhhhhCcCCCee
Confidence            566666665532110    00123566777777777666555666677777777777764 4444455666677777777


Q ss_pred             EcCCCCcccHHHHHHHhCCCCCcEEEccCccccccccccccCCCCCcEEeccCCCCCCccccccccCCCCCcEEEcccCC
Q 011688          112 SFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSK  191 (479)
Q Consensus       112 ~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  191 (479)
                      ++++|. +....|..++++++|++|++++|......+..+.++++|++|+++++. +....+..+.++++|+.|++++|.
T Consensus       194 ~L~~n~-l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~-l~~~~p~~l~~l~~L~~L~L~~n~  271 (968)
T PLN00113        194 TLASNQ-LVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN-LTGPIPSSLGNLKNLQYLFLYQNK  271 (968)
T ss_pred             eccCCC-CcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCce-eccccChhHhCCCCCCEEECcCCe
Confidence            777665 344556666667777777776665544555566666666666666633 333344455666666666666665


Q ss_pred             CChHHHHHhhcCCCCCEEEecCCCCCHHHHHHhhCCCCCcEEEccCCCCCchhhHhhhCCCCCCEEeccCCCCChHHHHH
Q 011688          192 VTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVN  271 (479)
Q Consensus       192 ~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~  271 (479)
                      +.+..+..+..+++|+.|++++|.+....|..+..+++|+.|++++|.+....+..+..+++|+.|++++|.+.+..+..
T Consensus       272 l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~  351 (968)
T PLN00113        272 LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKN  351 (968)
T ss_pred             eeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChH
Confidence            55544555555666666666666555444555555555666666555555444444555555555555555544444444


Q ss_pred             HhcCCCCCEEeccCcccCh------------------------hhhHhhcCCCCCCEEEccCCCCChHHHHHhhCCCCCc
Q 011688          272 LTGLCNLKCLELSDTQVGS------------------------SGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLK  327 (479)
Q Consensus       272 ~~~~~~L~~L~l~~~~~~~------------------------~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~  327 (479)
                      +..+++|+.|++++|.+..                        ..+..+..+++|+.|++.+|.+....+..+..+++|+
T Consensus       352 l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~  431 (968)
T PLN00113        352 LGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVY  431 (968)
T ss_pred             HhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCC
Confidence            4445555555555444433                        3333344444555555555444433334444445555


Q ss_pred             EEecCCCCCCHHHHHHHhcCCCCCEEEcCCCccchhHHHhhhcCCCCcEEEecCCCCCchhHHhhhhcCCCCEEEcCCCC
Q 011688          328 SLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNC  407 (479)
Q Consensus       328 ~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~  407 (479)
                      .|++++|.+.+..+..+..+++|+.|++++|.+.+..+..+ ..++|+.|++++|.+.+..+..+..+++|+.|++++| 
T Consensus       432 ~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N-  509 (968)
T PLN00113        432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN-  509 (968)
T ss_pred             EEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCC-
Confidence            55555444443333333334444444444444332222221 1234444444444444444444444555555555555 


Q ss_pred             CCCHHHHHHHhcCCCCCeeecCCCccCHHHHHcccCCCccceecccccccC
Q 011688          408 NLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVT  458 (479)
Q Consensus       408 ~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~  458 (479)
                      .+....|..+..+++|+.|++++|.++...+..+..+++|+.|++++|+++
T Consensus       510 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  560 (968)
T PLN00113        510 KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLS  560 (968)
T ss_pred             cceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccc
Confidence            444444445555555555555555555444444555555555555555544



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-11
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-11
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 7e-11
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 7e-11
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-09
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 4e-09
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-09
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-09
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure

Iteration: 1

Score = 67.4 bits (163), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 83/244 (34%), Positives = 118/244 (48%), Gaps = 45/244 (18%) Query: 93 QISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLK 152 QI+D + L L+NLT L+ NN IT + L NL +L+L T + L Sbjct: 96 QIAD--ITPLANLTNLTGLTLF-NNQIT--DIDPLKNLTNLNRLELSSNTI--SDISALS 148 Query: 153 GLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYXXXXXXXXXXXXE 212 GL L+ LN + N +TD +KPL+ LT L+ L IS +KV+D Sbjct: 149 GLTSLQQLN--FGNQVTD--LKPLANLTTLERLDISSNKVSD------------------ 186 Query: 213 GCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNL 272 + L L+ L SL N Q+SD LTNL+ L+L+ + D G L Sbjct: 187 -----ISVLAKLTNLESLIATN---NQISD--ITPLGILTNLDELSLNGNQLKDIG--TL 234 Query: 273 TGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLD 332 L NL L+L++ Q+ S L LSGLT L + L IS+ + LAGL++L +L L+ Sbjct: 235 ASLTNLTDLDLANNQI--SNLAPLSGLTKLTELKLGANQISN--ISPLAGLTALTNLELN 290 Query: 333 ARQI 336 Q+ Sbjct: 291 ENQL 294
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-53
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-26
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-22
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-49
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-47
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-37
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-32
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-30
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-30
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-29
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-27
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-26
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-25
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-23
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-26
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-20
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-25
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-20
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-20
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 9e-13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 9e-13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-15
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-10
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-04
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
 Score =  187 bits (476), Expect = 3e-53
 Identities = 94/490 (19%), Positives = 167/490 (34%), Gaps = 49/490 (10%)

Query: 10  IFNELVYSRC--LTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIASQGSSLLSVDLSGS 67
              + +  R   L  + L+     A+ +L    + G    W+  I++    L SV     
Sbjct: 63  ATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRM 122

Query: 68  DVTDSGLIHL--KDCSNLQSLDFNFCIQISDGGLEHL-RGLSNLTSLSFRRNN--AITAQ 122
            V+D  L  L      +L++L  + C   +  GL  +      + +L    ++      +
Sbjct: 123 IVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGK 182

Query: 123 GMKAFA-GLINLVKLDLERCTRIHGGLVNLKGLMK----LESLNIKWCNCITDSD-MKPL 176
            +   A    +L  L+            +L+ + +    L S+ +     +      K  
Sbjct: 183 WLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAA 242

Query: 177 SGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALG-SLFYLNL 235
           + L       ++           L   +KL  L L    +    +  L      +  L+L
Sbjct: 243 ANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGL--SYMGPNEMPILFPFAAQIRKLDL 300

Query: 236 NRCQL-SDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLC-NLKCLELSDTQVGSSGL 293
               L ++D C    +  NLE L   +  IGD GL  L   C  LK L            
Sbjct: 301 LYALLETEDHCTLIQKCPNLEVLETRNV-IGDRGLEVLAQYCKQLKRL------------ 347

Query: 294 RHLSGLTNLESINLSFTGISDGSLRKLA-GLSSLKSLNLDARQITDTGLAAL-TSLTGLT 351
             +    + + +      +S   L  LA G   L+ + +    IT+  L ++ T L  L 
Sbjct: 348 -RIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLC 406

Query: 352 HLDLFG----ARITDSG-----AAYLRNFKNLRSLEI--CGGGLTDAGVKHI-KDLSSLT 399
              L       RITD        + L   K LR        GGLTD G+ +I +   ++ 
Sbjct: 407 DFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVR 466

Query: 400 LLNLSQNCNLTDKTL-ELISGLTGLVSLNVSNSRITSAGLRHL-KPLKNLRSLTLESCKV 457
            + L      +D+ L E   G   L  L +     +   +      L +LR L ++  + 
Sbjct: 467 WMLLG-YVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRA 525

Query: 458 TANDIKRLQS 467
           +      +Q 
Sbjct: 526 SMTGQDLMQM 535


>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.55
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.55
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.23
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.95
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.89
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.85
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.71
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.03
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.02
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.0
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.21
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.07
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 81.72
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-42  Score=342.73  Aligned_cols=396  Identities=21%  Similarity=0.227  Sum_probs=215.0

Q ss_pred             CCeeEEEeeCCCCCcchhhcccCCCCCCEEecCCCCCCChhHHHHhhCCCCCcEEEcCCCCcccHHHHHHHhCCCCCcEE
Q 011688           57 SSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKL  136 (479)
Q Consensus        57 ~~l~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L  136 (479)
                      +.+++|+++++.++...+..|.++++|++|++++| .+....+..|+.+++|++|++++|. +....|..++.+++|++|
T Consensus        33 ~~l~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n-~i~~~~~~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~~l~~L~~L  110 (606)
T 3t6q_A           33 NSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRC-QIYWIHEDTFQSQHRLDTLVLTANP-LIFMAETALSGPKALKHL  110 (606)
T ss_dssp             TTCCEEECTTCCCSEECTTTSTTCTTCSEEECTTC-CCCEECTTTTTTCTTCCEEECTTCC-CSEECTTTTSSCTTCCEE
T ss_pred             CcCcEEEccCCccCcCChhHhccCccceEEECCCC-ccceeChhhccCccccCeeeCCCCc-ccccChhhhcccccccEe
Confidence            45677777777776666666777777777777763 4565556667777777777777765 344455666677777777


Q ss_pred             EccCccccccccccccCCCCCcEEeccCCCCCCccccccccCCCCCcEEEcccCCCChHHHHHhhcCCCCC--EEEecCC
Q 011688          137 DLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLT--LLNLEGC  214 (479)
Q Consensus       137 ~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~--~L~l~~~  214 (479)
                      ++++|......+..+..+++|++|+++++. +.......+..+++|+.|++++|.+....+..++.+++|+  .|+++++
T Consensus       111 ~L~~n~i~~l~~~~~~~l~~L~~L~L~~n~-l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~L~l~~n  189 (606)
T 3t6q_A          111 FFIQTGISSIDFIPLHNQKTLESLYLGSNH-ISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGN  189 (606)
T ss_dssp             ECTTSCCSCGGGSCCTTCTTCCEEECCSSC-CCCCCCCTTCCCTTCCEEECCSSCCCEECHHHHHTTTTCCSEEEECTTC
T ss_pred             eccccCcccCCcchhccCCcccEEECCCCc-ccccCcccccCCcccCEEEcccCcccccChhhhhhhcccceeEEecCCC
Confidence            777765444445556667777777777633 4433333344466677777766666655555555555555  4555544


Q ss_pred             CCCHH---------------------------------------------------------------------------
Q 011688          215 PVTAA---------------------------------------------------------------------------  219 (479)
Q Consensus       215 ~~~~~---------------------------------------------------------------------------  219 (479)
                      .+...                                                                           
T Consensus       190 ~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~~L~~L~l~~n~l~~~  269 (606)
T 3t6q_A          190 DIAGIEPGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNI  269 (606)
T ss_dssp             CCCEECTTTTTTCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGSEEEEEECTTCCCSSC
T ss_pred             ccCccChhHhhhccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcCceeEEEeecCccCcc
Confidence            33221                                                                           


Q ss_pred             HHHHhhCCCCCcEEEccCCCCCchhhHhhhCCCCCCEEeccCCCCChHHHHHHhcCCCCCEEeccCcccChhh-hHhhcC
Q 011688          220 CLDSLSALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSG-LRHLSG  298 (479)
Q Consensus       220 ~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~-~~~~~~  298 (479)
                      .+..+..+++|+.|++++|.+.. .+..+..+++|++|++++|.+....+..+..+++|+.|++++|.+.... ...+..
T Consensus       270 ~~~~~~~l~~L~~L~l~~n~l~~-lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~  348 (606)
T 3t6q_A          270 SSNTFHCFSGLQELDLTATHLSE-LPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLEN  348 (606)
T ss_dssp             CTTTTTTCTTCSEEECTTSCCSC-CCSSCCSCTTCCEEECTTCCCSBGGGGCGGGCTTCSEEECCSCSSCCBCCSSTTTT
T ss_pred             CHHHhccccCCCEEeccCCccCC-CChhhcccccCCEEECccCCcCcCchhhhhccCcCCEEECCCCCcccccchhhhhc
Confidence            12224445566666666665553 2334555566666666666555544444555556666666555443221 223444


Q ss_pred             CCCCCEEEccCCCCChHH--HHHhhCCCCCcEEecCCCCCCHHHHHHHhcCCCCCEEEcCCC------------------
Q 011688          299 LTNLESINLSFTGISDGS--LRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGA------------------  358 (479)
Q Consensus       299 ~~~L~~L~l~~~~~~~~~--~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~------------------  358 (479)
                      +++|+.|++++|.+....  +..+..+++|++|++++|.+....+..+..+++|++|++++|                  
T Consensus       349 l~~L~~L~l~~n~l~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~  428 (606)
T 3t6q_A          349 LENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLK  428 (606)
T ss_dssp             CTTCCEEECCSSCCCEEEESTTTTTTCTTCCEEECCSCSCEEECTTTTTTCTTCSEEECTTCCEECCTTCCTTTTCTTCC
T ss_pred             cCcCCEEECCCCccccccCcchhcccCCCCCEEECCCCcCCcCCHHHhcCCccCCeEECCCCcCCCcccchhhhCcccCC
Confidence            555555555555544332  333444555555555555444433333444444444444444                  


Q ss_pred             -------ccchhHHHhhhcCCCCcEEEecCCCCCchh---HHhhhhcCCCCEEEcCCCCCCCHHHHHHHhcCCCCCeeec
Q 011688          359 -------RITDSGAAYLRNFKNLRSLEICGGGLTDAG---VKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNV  428 (479)
Q Consensus       359 -------~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~---~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l  428 (479)
                             .+....+..+..+++|++|++++|.+.+..   +..+..+++|++|++++| .+....+..+.++++|++|++
T Consensus       429 ~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n-~l~~~~~~~~~~l~~L~~L~L  507 (606)
T 3t6q_A          429 VLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFC-DLSSIDQHAFTSLKMMNHVDL  507 (606)
T ss_dssp             EEECTTCCCBTTCTTTTTTCTTCCEEECTTCBCGGGEECSSCGGGGCTTCCEEECTTS-CCCEECTTTTTTCTTCCEEEC
T ss_pred             EEECCCCccCCcCHHHHhCCCCCCEEECCCCCCCccccccchhhccCCCccEEECCCC-ccCccChhhhccccCCCEEEC
Confidence                   444433334444455555555555443311   123444455555555555 444444444555555555555


Q ss_pred             CCCccCHHHHHcccCCCccceecccccccC
Q 011688          429 SNSRITSAGLRHLKPLKNLRSLTLESCKVT  458 (479)
Q Consensus       429 ~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~  458 (479)
                      ++|++....+..+..++.| .|++++|+++
T Consensus       508 s~N~l~~~~~~~l~~l~~L-~L~L~~N~l~  536 (606)
T 3t6q_A          508 SHNRLTSSSIEALSHLKGI-YLNLASNHIS  536 (606)
T ss_dssp             CSSCCCGGGGGGGTTCCSC-EEECCSSCCC
T ss_pred             CCCccCcCChhHhCccccc-EEECcCCccc
Confidence            5555555555555555555 5555555544



>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 479
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 69.3 bits (168), Expect = 2e-13
 Identities = 82/386 (21%), Positives = 152/386 (39%), Gaps = 37/386 (9%)

Query: 57  SSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRN 116
           +  +   L  ++VTD   +   D   + +L  +    I    ++ +  L+NLT ++F  N
Sbjct: 22  AEKMKTVLGKTNVTD--TVSQTDLDQVTTLQADRL-GIKS--IDGVEYLNNLTQINFSNN 76

Query: 117 NAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPL 176
                  +     L  LV + +          +     +   +L       I        
Sbjct: 77  QL---TDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTN 133

Query: 177 SGLTNLKSLQISCSKVTDSGIAYL-----------KGLQKLTLLNLEGCPV-TAACLDSL 224
                L S  IS         +             K L  LT L          + +  L
Sbjct: 134 LNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVL 193

Query: 225 SALGSLFYLNLNRCQLSDDGCEKFSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELS 284
           + L +L  L     Q+S         LTNL+ L+L+   +  + +  L  L NL  L+L+
Sbjct: 194 AKLTNLESLIATNNQIS--DITPLGILTNLDELSLNGNQL--KDIGTLASLTNLTDLDLA 249

Query: 285 DTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAAL 344
           + Q+  S L  LSGLT L  + L    IS+  +  LAGL++L   NL+  +     ++ +
Sbjct: 250 NNQI--SNLAPLSGLTKLTELKLGANQISN--ISPLAGLTALT--NLELNENQLEDISPI 303

Query: 345 TSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLS 404
           ++L  LT+L L+   I+D     + +   L+ L      ++   V  + +L+++  L+  
Sbjct: 304 SNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVS--DVSSLANLTNINWLSAG 359

Query: 405 QNCNLTDKTLELISGLTGLVSLNVSN 430
            N  ++D  L  ++ LT +  L +++
Sbjct: 360 HN-QISD--LTPLANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.89
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.45
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.01
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.92  E-value=1.1e-23  Score=194.53  Aligned_cols=191  Identities=31%  Similarity=0.415  Sum_probs=126.6

Q ss_pred             hhCCCCCCEEeccCCCCChHHHHHHhcCCCCCEEeccCcccChhhhHhhcCCCCCCEEEccCCCCChHHHHHhhCCCCCc
Q 011688          248 FSRLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLK  327 (479)
Q Consensus       248 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~  327 (479)
                      +..+++++.+.++++.+....+  +..+++|+.++++++.+...  ..+..+++|+.+++.++.+.+..  .+..+++|+
T Consensus       193 ~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~  266 (384)
T d2omza2         193 LAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLA--PLSGLTKLT  266 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCG--GGTTCTTCS
T ss_pred             cccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCC--cccccccCC
Confidence            3445566666666655443322  33455666666666655432  23455667777777776665432  355667777


Q ss_pred             EEecCCCCCCHHHHHHHhcCCCCCEEEcCCCccchhHHHhhhcCCCCcEEEecCCCCCchhHHhhhhcCCCCEEEcCCCC
Q 011688          328 SLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNC  407 (479)
Q Consensus       328 ~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~  407 (479)
                      +|+++++.+....  .+..++.++.+.+..+.+...  ..+..+++++.|++++|.+.+..  .+..+++|++|++++| 
T Consensus       267 ~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n-  339 (384)
T d2omza2         267 ELKLGANQISNIS--PLAGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANN-  339 (384)
T ss_dssp             EEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSS-
T ss_pred             EeeccCcccCCCC--ccccccccccccccccccccc--cccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCC-
Confidence            7777777665443  245677778888877777653  23566788888888888887653  3677888888888888 


Q ss_pred             CCCHHHHHHHhcCCCCCeeecCCCccCHHHHHcccCCCccceeccccc
Q 011688          408 NLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESC  455 (479)
Q Consensus       408 ~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~  455 (479)
                      .++..  ..+.++++|++|++++|++++..+  +.++++|++|++++|
T Consensus       340 ~l~~l--~~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         340 KVSDV--SSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCCCC--GGGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCCC--hhHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            66653  247778888888888888877543  677888888888876



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure