Citrus Sinensis ID: 012027


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
MECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDFVGSNMAVAKANGSGCCDDYDEEPQPNRFRQLE
cccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccccccccEEEccccccccccccccccccccccEEEccccHHcccccHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEcccccccccEEEcccccccEEEEEcccccccccccEEEEEEEccccccccccccccccEEEEEEEcccccccccccccccEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEccccccccccccHcccccccEEEccccccHcccccHHcccccccEEEccccccHHcccHHcccHHHccEEEcccccccccccccccHHcccEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccHHccEEEcccccccEcccHHHHHHcccEEEcccccHHcccccccccccEEEcccccccEccccccccccccEEEEcccHHHcccccccHHHHHHHHHHHHHccccccccEccccccccHHHcccccccEEEEEcccccccccccccEEEEEEEEcccccccccccEEEccccEEEEcccccccccccccEEEEEEcccccEEcccccccccEEEEEEEEccccEEEEccccccEEEEEccEEEEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHccccc
MECLRellldktdikempLSIELLSGLVQLTLKGcknlvrlpsninslkslktlnllgcfkfENLLETVgqvesleeldisgtaircppssiFLMKNLKTlsfrgcngppssascylpfpinlmrrssdlgalmlpslsglgsltkldlsdcglgegaipsdignlHSLKTLYlsknnfvtlpaSINClfnleklkledckrlqslpqlppnvekvrVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEvvsapshkfsivvpgseipkwfmyqnegssitvtrpsylcnmnqvvgyaacrvfhvpkhstgirrfyryphpahvlhcsmdekfghrgsdhlwllylprqsyycnvkwhfesnhfrlsfmderekhcpagsgtglkvkrcgfhpgymheveefdettKQWTRFTSYNLNEFHHDFVGSNMAVakangsgccddydeepqpnrfrqle
MECLREllldktdikempLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSlpqlppnvekvRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDFVGSNMAVAKANGSGCCDDydeepqpnrfrqle
MECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPsninslkslktlnllGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDlgalmlpslsglgsltkldlsDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDFVGSNMAVAKANGSGCCDDYDEEPQPNRFRQLE
****RELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDFVGSNMAVAKANGSGCC****************
MECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSAS*YLP**IN****SSD**ALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLG**KLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHE**********************************************************
MECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDFVGSNMAVAKANGSGCCDDYDEEPQPNRFRQLE
*ECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEV***************************************CCDDYD**P*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDFVGSNMAVAKANGSGCCDDYDEEPQPNRFRQLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query472 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.614 0.253 0.338 2e-35
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.381 0.175 0.330 6e-13
P0CB161201 Putative disease resistan no no 0.415 0.163 0.304 8e-13
O235301301 Protein SUPPRESSOR OF npr no no 0.434 0.157 0.301 5e-09
Q9SZ671895 Probable WRKY transcripti no no 0.188 0.046 0.39 2e-08
O825001095 Putative disease resistan no no 0.663 0.285 0.235 2e-08
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.438 0.111 0.327 6e-08
P26337630 Putative adenylate cyclas N/A no 0.383 0.287 0.272 1e-07
P23799630 Putative adenylate cyclas N/A no 0.415 0.311 0.270 1e-07
Q96NW7 1537 Leucine-rich repeat-conta yes no 0.444 0.136 0.294 2e-07
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  150 bits (380), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/319 (33%), Positives = 162/319 (50%), Gaps = 29/319 (9%)

Query: 6    ELLLDKTDIKEMPLSI-ELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFEN 64
            ++ +  + I+E+P SI +  + + +L L   KNLV LPS+I  LKSL +L++ GC K E+
Sbjct: 716  QIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLES 775

Query: 65   LLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLM 124
            L E +G +++L   D S T I  PPSSI  +  L  L FRG          +  FP    
Sbjct: 776  LPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKD-----GVHFEFP---- 826

Query: 125  RRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPA 184
                       P   GL SL  L+LS C L +G +P +IG+L SLK L LS+NNF  LP+
Sbjct: 827  -----------PVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPS 875

Query: 185  SINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSCTIIDFV 244
            SI  L  L+ L L+DC+RL  LP+LPP + ++ V+ C   +  +  L  ++     +   
Sbjct: 876  SIAQLGALQSLDLKDCQRLTQLPELPPELNELHVD-CHMALKFIHYLVTKRKKLHRVKLD 934

Query: 245  DSLKLLGKNGLAISMLREFLEV---VSAPSHKFSIVVPGS----EIPKWFMYQNEGSSIT 297
            D+      N  A +M +    +   +SA       V  G     +IP WF +Q   SS++
Sbjct: 935  DAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVS 994

Query: 298  VTRPSYLCNMNQVVGYAAC 316
            V  P      ++ +G+A C
Sbjct: 995  VNLPENWYIPDKFLGFAVC 1013




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.927 0.364 0.390 6e-73
224146780540 predicted protein [Populus trichocarpa] 0.951 0.831 0.389 2e-70
224114331 1119 tir-nbs-lrr resistance protein [Populus 0.781 0.329 0.425 4e-66
359496026 1250 PREDICTED: TMV resistance protein N-like 0.853 0.322 0.407 3e-65
296090591 771 unnamed protein product [Vitis vinifera] 0.853 0.522 0.403 5e-65
224114311 1144 tir-nbs-lrr resistance protein [Populus 0.855 0.353 0.384 3e-64
359493273 1233 PREDICTED: TMV resistance protein N-like 0.919 0.351 0.360 9e-61
224104273 1033 tir-nbs-lrr resistance protein [Populus 0.769 0.351 0.413 4e-60
105922631 1336 TIR-NBS-LRR-TIR type disease resistance 0.769 0.271 0.413 5e-60
224126507 1741 tir-nbs-lrr resistance protein [Populus 0.637 0.172 0.462 1e-59
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  281 bits (719), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 195/499 (39%), Positives = 273/499 (54%), Gaps = 61/499 (12%)

Query: 2    ECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFK 61
            +CLR+L LD+T I+E+P SI+ L GL+ L+LK CK L  LPS+IN LKSLKTL+L GC +
Sbjct: 737  KCLRKLCLDQTSIEELPPSIQYLVGLISLSLKDCKKLSCLPSSINGLKSLKTLHLSGCSE 796

Query: 62   FENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCY---LP 118
             ENL E  GQ+E L ELD+SGTAIR PP SIF +KNLK LSF GC     S +     L 
Sbjct: 797  LENLPENFGQLECLNELDVSGTAIREPPVSIFSLKNLKILSFHGCAESSRSTTNIWQRLM 856

Query: 119  FPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNN 178
            FP+   +R++    ++  SLSGL SLT+L LS+C LGEGA+P+DIG L SL+ L LS+N 
Sbjct: 857  FPLMPGKRANSTSLVLP-SLSGLSSLTRLGLSNCNLGEGAVPNDIGYLSSLRQLNLSRNK 915

Query: 179  FVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCASLVTLLGALKLRKSSC 238
            FV+LP SI+ L  L+ L++EDCK LQSLP+LP N+E+ RVNGC SL  +  + KL + + 
Sbjct: 916  FVSLPTSIDQLSGLQFLRMEDCKMLQSLPELPSNLEEFRVNGCTSLEKMQFSRKLCQLNY 975

Query: 239  TIIDFVDSLKLLGK---NGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSS 295
                F++  +L      N +  ++LR+  +        FS+++PGSEIP WF +Q+EGSS
Sbjct: 976  LRYLFINCWRLSESDCWNNMFPTLLRKCFQGPPNLIESFSVIIPGSEIPTWFSHQSEGSS 1035

Query: 296  ITVTRPSYLCNMNQVVGYAACRVFHVPKHSTGIRR----------------FYRYPHPAH 339
            ++V  P +    ++ +GYA C     P     + R                 Y    P  
Sbjct: 1036 VSVQTPPHSHENDEWLGYAVCASLGYPDFPPNVFRSPMQCFFNGDGNESESIYVRLKPCE 1095

Query: 340  VLHCSMDEKFGHRGSDHLWLLYLPRQSYYCNVKWHFESNHFRLSFMDEREKHCPAGSGTG 399
            +L            SDHLW LY P        ++     H R  F D    +C     + 
Sbjct: 1096 IL------------SDHLWFLYFPS-------RFKRFDRHVRFRFED----NC-----SQ 1127

Query: 400  LKVKRCGFHPGYMHEVEEFDETTKQWTRFTSYNLNEFHHDF-------VGSNMAVAKANG 452
             KV +CG    Y  +VEE +  T  +   T   ++E   +        +G    V +A+G
Sbjct: 1128 TKVIKCGVRLVYQQDVEELNRMTNLYENSTFEGVDECFQESGGALVKRLGHTNDVGEASG 1187

Query: 453  SGCCDDYDEEPQPNRFRQL 471
            S      DE+P   + +Q+
Sbjct: 1188 SVSS---DEQPPTKKLKQI 1203




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114311|ref|XP_002332395.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832718|gb|EEE71195.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224104273|ref|XP_002333965.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222839252|gb|EEE77603.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922631|gb|ABF81427.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126507|ref|XP_002319855.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222858231|gb|EEE95778.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.302 0.110 0.361 2.3e-21
TAIR|locus:21533281231 AT5G45230 [Arabidopsis thalian 0.633 0.242 0.282 3.3e-19
TAIR|locus:21222091179 AT4G36150 [Arabidopsis thalian 0.355 0.142 0.340 5.8e-19
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.345 0.136 0.311 8e-19
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.529 0.218 0.287 2.6e-17
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.345 0.129 0.308 5.6e-17
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.150 0.057 0.416 6.5e-17
TAIR|locus:28276391195 AT2G17060 [Arabidopsis thalian 0.360 0.142 0.291 4.9e-16
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.427 0.129 0.289 9.6e-09
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.423 0.144 0.279 8.1e-08
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 2.3e-21, Sum P(2) = 2.3e-21
 Identities = 60/166 (36%), Positives = 92/166 (55%)

Query:   159 IPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLP-QLPPNVEKVR 217
             IP+ IGNL +L  L LS NNF  +PASI  L  L +L L +C+RLQ+LP +LP  +  + 
Sbjct:   970 IPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIY 1029

Query:   218 VNGCASLVTLLGALK---LRK---SSCTIIDFVDSLKLLGKNGLAISMLREFLEVVSA-P 270
             ++ C SLV++ G      LRK   S+C  +D    + L+ +N          L++ SA P
Sbjct:  1030 IHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQI-LIHRN----------LKLESAKP 1078

Query:   271 SHKFSIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVVGYAAC 316
              H +    PGS+IP  F +Q  G S+ +  P    + + ++G++AC
Sbjct:  1079 EHSY---FPGSDIPTCFNHQVMGPSLNIQLPQSESS-SDILGFSAC 1120


GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
PLN032101153 PLN03210, PLN03210, Resistant to P 5e-18
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 87.2 bits (216), Expect = 5e-18
 Identities = 102/381 (26%), Positives = 152/381 (39%), Gaps = 77/381 (20%)

Query: 4    LRELLL-DKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKF 62
            L  L L D + + E+P SI+ L+ L  L +  C+NL  LP+ IN LKSL  LNL GC + 
Sbjct: 659  LETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKSLYRLNLSGCSRL 717

Query: 63   ENLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSSASCYLPFPIN 122
            ++  +      ++  LD+  TAI   PS++ L +NL  L    C                
Sbjct: 718  KSFPDIS---TNISWLDLDETAIEEFPSNLRL-ENLDELIL--CEMKSEK---------- 761

Query: 123  LMRRSSDLGAL--MLPSLSGLGSLTKLDLSDC-GLGEGAIPSDIGNLHSLKTLYLSK-NN 178
            L  R   L  L  ML       SLT+L LSD   L E  +PS I NLH L+ L +    N
Sbjct: 762  LWERVQPLTPLMTMLSP-----SLTRLFLSDIPSLVE--LPSSIQNLHKLEHLEIENCIN 814

Query: 179  FVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPNVEKVRVNGCA--------------SL 224
              TLP  IN L +LE L L  C RL++ P +  N+  + ++                 S 
Sbjct: 815  LETLPTGIN-LESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSF 873

Query: 225  VTLLGALKLRKSSCTI--------IDFVD--SLKLLGKNGLAISMLREFLEVV----SAP 270
            + + G   L++ S  I        +DF D  +L     NG    +      +     S  
Sbjct: 874  LDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTV 933

Query: 271  SHKF-------------------SIVVPGSEIPKWFMYQNEGSSITVTRPSYLCNMNQVV 311
               F                    +++ G E+P +F ++  G+S+T     ++       
Sbjct: 934  CINFINCFNLDQEALLQQQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFF 993

Query: 312  GYAACRVFHVPKHSTGIRRFY 332
             + AC V            F 
Sbjct: 994  RFRACAVVDSESFFIISVSFD 1014


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 472
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.76
PLN032101153 Resistant to P. syringae 6; Provisional 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.61
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.54
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.49
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.47
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.46
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.43
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.13
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
KOG4237498 consensus Extracellular matrix protein slit, conta 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.88
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.78
PRK15386426 type III secretion protein GogB; Provisional 98.77
PLN03150623 hypothetical protein; Provisional 98.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
KOG4237498 consensus Extracellular matrix protein slit, conta 98.66
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
PRK15386426 type III secretion protein GogB; Provisional 98.58
PLN03150623 hypothetical protein; Provisional 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.41
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.77
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.46
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.4
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.26
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.11
KOG4341483 consensus F-box protein containing LRR [General fu 97.05
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.99
KOG4341483 consensus F-box protein containing LRR [General fu 96.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.0
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.69
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.54
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.35
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.08
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.07
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.89
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.85
smart0037026 LRR Leucine-rich repeats, outliers. 89.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.78
smart0037026 LRR Leucine-rich repeats, outliers. 88.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.29
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=5.9e-36  Score=339.16  Aligned_cols=381  Identities=22%  Similarity=0.328  Sum_probs=265.4

Q ss_pred             CCccEEEeeCCCCeeccccccCCcCCcEEEeecCcCCCccCcccCCCCCCCEEEccCCCCchhhhhhhCCCCCCCEEeee
Q 012027            2 ECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDIS   81 (472)
Q Consensus         2 ~~L~~L~L~~~~l~~lp~si~~L~~L~~L~L~~c~~l~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~L~   81 (472)
                      .+|++|+|.++.+..+|..+..+++|+.|+|++|..++.+|. ++.+++|++|+|++|..+..+|..++++++|+.|+++
T Consensus       611 ~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~  689 (1153)
T PLN03210        611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMS  689 (1153)
T ss_pred             cCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEEeCC
Confidence            578899999999999998899999999999999988999986 8889999999999999999999999999999999999


Q ss_pred             Cc-cCCCCCccccCCCCCcEEEecCCCCCCCCCCC---------------CCCc------chh-----------------
Q 012027           82 GT-AIRCPPSSIFLMKNLKTLSFRGCNGPPSSASC---------------YLPF------PIN-----------------  122 (472)
Q Consensus        82 ~~-~i~~lp~~i~~l~~L~~L~L~~~~~~~~~~~~---------------~~~~------~~~-----------------  122 (472)
                      +| .+..+|..+ ++++|+.|++++|..+...+..               .++.      ...                 
T Consensus       690 ~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~  768 (1153)
T PLN03210        690 RCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQP  768 (1153)
T ss_pred             CCCCcCccCCcC-CCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccccchhhccccccc
Confidence            86 677888876 7899999999998644322110               0000      000                 


Q ss_pred             --------------hhcccCCCCcCCCCC-CCCCCCcCEEeccCCCCCCCCCCCCC--------------------CCCC
Q 012027          123 --------------LMRRSSDLGALMLPS-LSGLGSLTKLDLSDCGLGEGAIPSDI--------------------GNLH  167 (472)
Q Consensus       123 --------------l~~~~~~~~~~~l~~-l~~l~~L~~L~L~~~~l~~~~lp~~l--------------------~~l~  167 (472)
                                    +....+. ....+|. +.++++|+.|++++|... +.+|..+                    ...+
T Consensus       769 l~~~~~~~~~sL~~L~Ls~n~-~l~~lP~si~~L~~L~~L~Ls~C~~L-~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~  846 (1153)
T PLN03210        769 LTPLMTMLSPSLTRLFLSDIP-SLVELPSSIQNLHKLEHLEIENCINL-ETLPTGINLESLESLDLSGCSRLRTFPDIST  846 (1153)
T ss_pred             cchhhhhccccchheeCCCCC-CccccChhhhCCCCCCEEECCCCCCc-CeeCCCCCccccCEEECCCCCcccccccccc
Confidence                          0000000 1112343 677788888888887533 2355432                    1124


Q ss_pred             CCCEEEcCCCCCccCCcccCCCCCcceeeccCccccccCCCCC---CCccEEEEccCCCcccccccccccc---------
Q 012027          168 SLKTLYLSKNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLP---PNVEKVRVNGCASLVTLLGALKLRK---------  235 (472)
Q Consensus       168 ~L~~L~Ls~n~~~~lp~~i~~l~~L~~L~l~~c~~L~~lp~lp---~~L~~L~~~~c~sL~~~~~~~~~~~---------  235 (472)
                      +|+.|+|++|.++.+|.++..+++|+.|++++|++++.+|..+   ++|+.+++.+|.+|+.++.......         
T Consensus       847 nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~  926 (1153)
T PLN03210        847 NISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIH  926 (1153)
T ss_pred             ccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhccccc
Confidence            5667777777788899999999999999999999999998754   4667889999999987654211000         


Q ss_pred             --c-ccceeeecccccccCccchHHHHHHHHHhhccCCCCceEEEecCCCCCcccccCCCCcEEE-EEcCCCCCCCCcee
Q 012027          236 --S-SCTIIDFVDSLKLLGKNGLAISMLREFLEVVSAPSHKFSIVVPGSEIPKWFMYQNEGSSIT-VTRPSYLCNMNQVV  311 (472)
Q Consensus       236 --~-~~~~~~f~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~q~~g~si~-~~lp~~~~~~~~~~  311 (472)
                        . ......|.+|++++....+         +.   ......+++||.++|+||+||+.|++++ |++|+.|+ ...|.
T Consensus       927 ~~~p~~~~l~f~nC~~L~~~a~l---------~~---~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~-~~~~~  993 (1153)
T PLN03210        927 SKLPSTVCINFINCFNLDQEALL---------QQ---QSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISP-CQPFF  993 (1153)
T ss_pred             ccCCchhccccccccCCCchhhh---------cc---cccceEEECCCccCchhccCCcccceeeeeccCCccc-CCCcc
Confidence              0 0012358899988643221         11   1123467899999999999999999998 99999998 78899


Q ss_pred             EEEEEEEEecCCC-------CCceeeEeecCCCCceeeeeccccCCCCCCCeEEEEEeeCcccc----------ccc-cC
Q 012027          312 GYAACRVFHVPKH-------STGIRRFYRYPHPAHVLHCSMDEKFGHRGSDHLWLLYLPRQSYY----------CNV-KW  373 (472)
Q Consensus       312 gfa~c~v~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sdHl~l~y~~~~~~~----------~~~-~~  373 (472)
                      ||++|+|+.+...       .+.+.|.+....+..+ +        ....+|+|+.|....++.          +.. .+
T Consensus       994 ~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~-~--------~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~ 1064 (1153)
T PLN03210        994 RFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHF-D--------SPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLA 1064 (1153)
T ss_pred             ceEEEEEEecCccccCCCceeEEEEEEEECCCCCcc-c--------cCCCceeEeeeccccceEEecccccccccccchh
Confidence            9999999976541       2355677766555443 1        224455555554332111          000 11


Q ss_pred             CcccceEEEEEeecccccCCCCCCCccEEEEccceeeecccc
Q 012027          374 HFESNHFRLSFMDEREKHCPAGSGTGLKVKRCGFHPGYMHEV  415 (472)
Q Consensus       374 ~~~~~~i~~~f~~~~~~~~~~~~~~~~~Vk~CGv~liy~~d~  415 (472)
                      +..++|+++.|.....       ...++||+||||++|+++.
T Consensus      1065 ~~~~~~~~~~f~~~~~-------~~~~~~~~cg~~~~~~~~~ 1099 (1153)
T PLN03210       1065 ELNYDHVDIQFRLTNK-------NSQLKLKGCGIRLSEDDSS 1099 (1153)
T ss_pred             ccCCceeeEEEEEecC-------CCCeEEEeeeEEEeccCCC
Confidence            2357788888876521       2347999999999997654



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 44.7 bits (104), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 62/217 (28%), Positives = 83/217 (38%), Gaps = 50/217 (23%) Query: 4 LRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPXXXXXXXXXXXXXXXGCFKFE 63 L L L + ++ +P SI L+ L +L+++ C L LP Sbjct: 129 LETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASG----------- 177 Query: 64 NLLETVGQVESLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPSS---ASCYLPFP 120 E G V +L+ L + T IR P+SI ++NLK+L R N P S+ A +LP Sbjct: 178 ---EHQGLV-NLQSLRLEWTGIRSLPASIANLQNLKSLKIR--NSPLSALGPAIHHLPKL 231 Query: 121 INLMRRSSDXXXXXXXXXXXXXXXXXXXXXDCGLGEGAIPSDIGNLHSLKTLYLSK-NNF 179 L R P G LK L L +N Sbjct: 232 EELDLRGCTALRN-------------------------YPPIFGGRAPLKRLILKDCSNL 266 Query: 180 VTLPASINCLFNLEKLKLEDCKRLQSLP----QLPPN 212 +TLP I+ L LEKL L C L LP QLP N Sbjct: 267 LTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPAN 303

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  143 bits (362), Expect = 5e-39
 Identities = 65/222 (29%), Positives = 96/222 (43%), Gaps = 35/222 (15%)

Query: 1   MECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCF 60
           +  L+ + +D   + E+P +++  +GL  LTL     L  LP++I SL  L+ L++  C 
Sbjct: 103 LSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACP 161

Query: 61  KFENLLETVGQVE---------SLEELDISGTAIRCPPSSIFLMKNLKTLSFRGCNGPPS 111
           +   L E +   +         +L+ L +  T IR  P+SI  ++NLK+L  R       
Sbjct: 162 ELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP---- 217

Query: 112 SASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKT 171
                             L AL  P++  L  L +LDL  C       P   G    LK 
Sbjct: 218 ------------------LSAL-GPAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKR 257

Query: 172 LYLS-KNNFVTLPASINCLFNLEKLKLEDCKRLQSLPQLPPN 212
           L L   +N +TLP  I+ L  LEKL L  C  L  LP L   
Sbjct: 258 LILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ 299


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.82
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.81
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.8
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.8
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.79
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.78
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.78
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.75
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.74
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.74
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.72
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.71
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.71
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.58
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.47
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.36
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.25
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.93
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.73
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.54
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.53
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.32
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.81
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.97
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.27
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.90  E-value=8.3e-24  Score=208.35  Aligned_cols=202  Identities=24%  Similarity=0.357  Sum_probs=170.3

Q ss_pred             CCccEEEeeCCCCeeccccccCCcCCcEEEeecCcCCCccCcccCCCCCCCEEEccCCCCchhhhhhhCCCCCCCEEeee
Q 012027            2 ECLRELLLDKTDIKEMPLSIELLSGLVQLTLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDIS   81 (472)
Q Consensus         2 ~~L~~L~L~~~~l~~lp~si~~L~~L~~L~L~~c~~l~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~L~   81 (472)
                      ++++.|+|+++.++.+|..++.+++|++|+|++|. +..+|..++++++|++|+|++|.. ..+|..++++++|++|+++
T Consensus        81 ~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~-l~~lp~~~~~l~~L~~L~Ls~n~l-~~lp~~l~~l~~L~~L~L~  158 (328)
T 4fcg_A           81 PGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAG-LMELPDTMQQFAGLETLTLARNPL-RALPASIASLNRLRELSIR  158 (328)
T ss_dssp             TTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSC-CCCCCSCGGGGTTCSEEEEESCCC-CCCCGGGGGCTTCCEEEEE
T ss_pred             cceeEEEccCCCchhcChhhhhCCCCCEEECCCCC-ccchhHHHhccCCCCEEECCCCcc-ccCcHHHhcCcCCCEEECC
Confidence            57899999999999999999999999999999987 569999999999999999999864 4889999999999999999


Q ss_pred             Ccc-CCCCCccccC---------CCCCcEEEecCCCCCCCCCCCCCCcchhhhcccCCCCcCCCCC-CCCCCCcCEEecc
Q 012027           82 GTA-IRCPPSSIFL---------MKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPS-LSGLGSLTKLDLS  150 (472)
Q Consensus        82 ~~~-i~~lp~~i~~---------l~~L~~L~L~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~-l~~l~~L~~L~L~  150 (472)
                      +|. +..+|..+..         +++|+.|++++|...                        .+|. +..+++|++|+++
T Consensus       159 ~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~------------------------~lp~~l~~l~~L~~L~L~  214 (328)
T 4fcg_A          159 ACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIR------------------------SLPASIANLQNLKSLKIR  214 (328)
T ss_dssp             EETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCC------------------------CCCGGGGGCTTCCEEEEE
T ss_pred             CCCCccccChhHhhccchhhhccCCCCCEEECcCCCcC------------------------cchHhhcCCCCCCEEEcc
Confidence            965 4578887765         999999999998632                        1232 6778889999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEcCCCCCc-cCCcccCCCCCcceeeccCccccccCCCC---CCCccEEEEccCCCccc
Q 012027          151 DCGLGEGAIPSDIGNLHSLKTLYLSKNNFV-TLPASINCLFNLEKLKLEDCKRLQSLPQL---PPNVEKVRVNGCASLVT  226 (472)
Q Consensus       151 ~~~l~~~~lp~~l~~l~~L~~L~Ls~n~~~-~lp~~i~~l~~L~~L~l~~c~~L~~lp~l---p~~L~~L~~~~c~sL~~  226 (472)
                      +|.+..  +|..++.+++|++|+|++|++. .+|..+..+++|+.|++++|..+..+|.-   .++|+.|++++|..+..
T Consensus       215 ~N~l~~--l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~  292 (328)
T 4fcg_A          215 NSPLSA--LGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSR  292 (328)
T ss_dssp             SSCCCC--CCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCC
T ss_pred             CCCCCc--CchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhh
Confidence            998863  7778888899999999998765 77888888999999999999888888752   36788899999888888


Q ss_pred             ccccc
Q 012027          227 LLGAL  231 (472)
Q Consensus       227 ~~~~~  231 (472)
                      +|...
T Consensus       293 iP~~l  297 (328)
T 4fcg_A          293 LPSLI  297 (328)
T ss_dssp             CCGGG
T ss_pred             ccHHH
Confidence            87654



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 472
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 57.7 bits (138), Expect = 1e-09
 Identities = 32/169 (18%), Positives = 59/169 (34%), Gaps = 9/169 (5%)

Query: 31  TLKGCKNLVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEELDISGTAIRCPPS 90
            L    N ++    + SL +L  L+L    +  NL   +  +  L EL +    I     
Sbjct: 223 ELSLNGNQLKDIGTLASLTNLTDLDLANN-QISNLAP-LSGLTKLTELKLGANQISNISP 280

Query: 91  SIFLMKNLKTLSFRGCNGPPSSASCYLPFPINLMRRSSDLGALMLPSLSGLGSLTKLDLS 150
            +  +  L  L          S    L     L    +++    +  +S L  L +L  +
Sbjct: 281 -LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNIS--DISPVSSLTKLQRLFFA 337

Query: 151 DCGLGEGAIPSDIGNLHSLKTLYLSKNNFVTLPASINCLFNLEKLKLED 199
           +  + +    S + NL ++  L    N    L   +  L  + +L L D
Sbjct: 338 NNKVSD---VSSLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.98
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.59
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.89
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.2
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.5
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.79  E-value=4.1e-20  Score=178.12  Aligned_cols=204  Identities=22%  Similarity=0.220  Sum_probs=156.6

Q ss_pred             CccEEEeeCCCCe---eccccccCCcCCcEEEeecCcC-CCccCcccCCCCCCCEEEccCCCCchhhhhhhCCCCCCCEE
Q 012027            3 CLRELLLDKTDIK---EMPLSIELLSGLVQLTLKGCKN-LVRLPSNINSLKSLKTLNLLGCFKFENLLETVGQVESLEEL   78 (472)
Q Consensus         3 ~L~~L~L~~~~l~---~lp~si~~L~~L~~L~L~~c~~-l~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L   78 (472)
                      +++.|+|+++++.   .+|+++++|++|++|+|++|.. .+.+|.+|++|++|++|+|++|...+..+..+..+.+|+++
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            5789999998877   6899999999999999998544 45899999999999999999998877778888999999999


Q ss_pred             eeeCccCC-CCCccccCCCCCcEEEecCCCCCCCCCCC--CCCcc-hhhhcc-----------------------cCCCC
Q 012027           79 DISGTAIR-CPPSSIFLMKNLKTLSFRGCNGPPSSASC--YLPFP-INLMRR-----------------------SSDLG  131 (472)
Q Consensus        79 ~L~~~~i~-~lp~~i~~l~~L~~L~L~~~~~~~~~~~~--~~~~~-~~l~~~-----------------------~~~~~  131 (472)
                      ++++|.+. .+|..+.+++.|+.+++++|......+..  .+... ..+...                       .....
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~  210 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE  210 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99998766 67899999999999999998743222211  11111 001111                       11111


Q ss_pred             cCCCCC-CCCCCCcCEEeccCCCCCCCCCCCCCCCCCCCCEEEcCCCCCc-cCCcccCCCCCcceeeccCccccccCCCC
Q 012027          132 ALMLPS-LSGLGSLTKLDLSDCGLGEGAIPSDIGNLHSLKTLYLSKNNFV-TLPASINCLFNLEKLKLEDCKRLQSLPQL  209 (472)
Q Consensus       132 ~~~l~~-l~~l~~L~~L~L~~~~l~~~~lp~~l~~l~~L~~L~Ls~n~~~-~lp~~i~~l~~L~~L~l~~c~~L~~lp~l  209 (472)
                      + ..|. +..+++|+.++++++.+. +. +..++.+++|+.|+|++|+++ .+|.+++++++|+.|+|++|+.-..+|+.
T Consensus       211 ~-~~~~~~~~~~~l~~l~~~~~~l~-~~-~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~  287 (313)
T d1ogqa_         211 G-DASVLFGSDKNTQKIHLAKNSLA-FD-LGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG  287 (313)
T ss_dssp             E-CCGGGCCTTSCCSEEECCSSEEC-CB-GGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS
T ss_pred             c-ccccccccccccccccccccccc-cc-ccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            1 1222 567788999999998875 33 446888899999999999998 89999999999999999998766677754



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure