Citrus Sinensis ID: 012292
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 466 | ||||||
| 297745325 | 564 | unnamed protein product [Vitis vinifera] | 0.937 | 0.774 | 0.539 | 1e-114 | |
| 255541706 | 525 | protein binding protein, putative [Ricin | 0.877 | 0.779 | 0.535 | 1e-113 | |
| 359489808 | 597 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.738 | 0.505 | 1e-112 | |
| 356560327 | 586 | PREDICTED: uncharacterized protein LOC10 | 0.935 | 0.744 | 0.489 | 1e-102 | |
| 224130394 | 488 | predicted protein [Populus trichocarpa] | 0.607 | 0.579 | 0.659 | 2e-99 | |
| 449495329 | 561 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.786 | 0.461 | 2e-99 | |
| 357504405 | 668 | Methylenetetrahydrofolate reductase, par | 0.931 | 0.649 | 0.472 | 2e-94 | |
| 147862101 | 537 | hypothetical protein VITISV_015061 [Viti | 0.864 | 0.750 | 0.503 | 5e-94 | |
| 28200786 | 508 | potyviral helper component protease-inte | 0.935 | 0.858 | 0.444 | 2e-85 | |
| 15234116 | 506 | TRAF-interacting protein [Arabidopsis th | 0.618 | 0.569 | 0.560 | 3e-79 |
| >gi|297745325|emb|CBI40405.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 419 bits (1076), Expect = e-114, Method: Compositional matrix adjust.
Identities = 246/456 (53%), Positives = 301/456 (66%), Gaps = 19/456 (4%)
Query: 7 FGKTICSICYEDLKPIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCKQRCSSS 66
F KTIC+ICYEDLKPIVEDLQ IS+CGHVFHELCLQQWFEYC++ KK +CPVCKQ CS +
Sbjct: 7 FAKTICTICYEDLKPIVEDLQSISVCGHVFHELCLQQWFEYCANKKKNSCPVCKQTCSLN 66
Query: 67 N-------SIGDQIDLVISQKPKDPEVEDPEVSRAEVKILEVKVSRLHTVLESQGKEIKE 119
SIGD D +SQKP + E EDP R EVK LEVKV+ L +VLE K++KE
Sbjct: 67 GVNRLYFQSIGDASDPTLSQKPLNIE-EDPGALRREVKRLEVKVAGLTSVLERNQKDLKE 125
Query: 120 INEELCLCKERIKEEAALKNEALRQKVSVEQLLHSKSQELDKVTLECLKLKQRNMDLAKE 179
+NEELCLCKE+ KEEAALKNE L+QK ++QLL SKSQ+LDK LEC +L++RNM LAKE
Sbjct: 126 LNEELCLCKEQFKEEAALKNEILKQKAFIQQLLFSKSQDLDKSNLECSRLQERNMALAKE 185
Query: 180 LASLKLVSDLNLDEDEVLKFALLGNGANNKDTIDVLRKSLVIRNKNYTELMAKCNLLGRE 239
LA+LKLVSDL+LDE+ VLK A GN ANNKDTID+L++SLVIRNK+Y ELMAKCNLLGR
Sbjct: 186 LAALKLVSDLSLDEEGVLKLASFGNEANNKDTIDILKRSLVIRNKSYKELMAKCNLLGRG 245
Query: 240 KARFSEKLEKAKEKINKLKTRVQELETAVELKDNEVLRALKVSKKASQKEEILKGATEDN 299
+AR KLEKAK KI KLKTRVQELETA+E+KDNEVLRAL SKK +E L + + N
Sbjct: 246 EARSVRKLEKAKGKIQKLKTRVQELETAIEVKDNEVLRALIASKKRIDEEANLN-SIKCN 304
Query: 300 SISLCTNNVSLEDQREQHSVPIYNLDWTSRVTNDFSFSTKSENFNAIKNIDANHTREGGS 359
S N+ S ED ++Q +VPI D + N S + N N+IK+ H
Sbjct: 305 FSSSPINDFSPEDCKDQPAVPISKSDQIGNLNNGPLSSKTAGNSNSIKDTTM-HELPDPY 363
Query: 360 AKSHGKERNALQRED------TSRFSSVVFGLSNHNSIHQTIADVVQKPTPSRLGSAPTI 413
K + A+Q S S NSI + + + T + AP
Sbjct: 364 LKPKSTKAVAVQNSSILVPGAASAISRKPLAQGPGNSIGLSGS---RTSTEKDMYDAPVA 420
Query: 414 DIDEDVTLIVPDSAQVQPIVNIKKNPPSPVSLSKPG 449
D+ V L+V D Q+QP+ I+K P P+ +KPG
Sbjct: 421 AEDKHVKLLVDDIEQLQPLPQIRKEAPFPIRFAKPG 456
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255541706|ref|XP_002511917.1| protein binding protein, putative [Ricinus communis] gi|223549097|gb|EEF50586.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359489808|ref|XP_002275425.2| PREDICTED: uncharacterized protein LOC100265462 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356560327|ref|XP_003548444.1| PREDICTED: uncharacterized protein LOC100812811 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224130394|ref|XP_002320826.1| predicted protein [Populus trichocarpa] gi|222861599|gb|EEE99141.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449495329|ref|XP_004159801.1| PREDICTED: uncharacterized protein LOC101225984 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357504405|ref|XP_003622491.1| Methylenetetrahydrofolate reductase, partial [Medicago truncatula] gi|355497506|gb|AES78709.1| Methylenetetrahydrofolate reductase, partial [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147862101|emb|CAN80879.1| hypothetical protein VITISV_015061 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|28200786|emb|CAD45374.1| potyviral helper component protease-interacting protein 1 [Solanum tuberosum subsp. andigenum] | Back alignment and taxonomy information |
|---|
| >gi|15234116|ref|NP_192036.1| TRAF-interacting protein [Arabidopsis thaliana] gi|7267624|emb|CAB80936.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|332656602|gb|AEE82002.1| TRAF-interacting protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 466 | ||||||
| TAIR|locus:2125088 | 506 | AT4G01270 [Arabidopsis thalian | 0.815 | 0.750 | 0.463 | 2.8e-82 | |
| TAIR|locus:504955487 | 118 | AT4G01245 "AT4G01245" [Arabido | 0.143 | 0.567 | 0.565 | 2.9e-12 | |
| ZFIN|ZDB-GENE-040801-30 | 453 | traip "TRAF-interacting protei | 0.572 | 0.589 | 0.257 | 1.8e-10 | |
| WB|WBGene00015194 | 451 | B0432.13 [Caenorhabditis elega | 0.658 | 0.680 | 0.225 | 1e-08 | |
| UNIPROTKB|E7EN91 | 266 | TRAIP "TRAF-interacting protei | 0.515 | 0.902 | 0.279 | 2.5e-08 | |
| UNIPROTKB|F1PCW0 | 2240 | GOLGA4 "Uncharacterized protei | 0.603 | 0.125 | 0.246 | 5.3e-07 | |
| TAIR|locus:2162996 | 983 | AT5G41140 "AT5G41140" [Arabido | 0.585 | 0.277 | 0.275 | 7.1e-07 | |
| ZFIN|ZDB-GENE-091204-454 | 155 | si:ch1073-392o20.1 "si:ch1073- | 0.139 | 0.419 | 0.337 | 2e-06 | |
| UNIPROTKB|E2R604 | 467 | TRAIP "Uncharacterized protein | 0.517 | 0.516 | 0.25 | 2.4e-06 | |
| UNIPROTKB|Q9H9V4 | 155 | RNF122 "RING finger protein 12 | 0.139 | 0.419 | 0.315 | 3.3e-06 |
| TAIR|locus:2125088 AT4G01270 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 803 (287.7 bits), Expect = 2.8e-82, Sum P(2) = 2.8e-82
Identities = 184/397 (46%), Positives = 252/397 (63%)
Query: 1 MGIENKFGKTICSICYEDLKPIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCK 60
M EN G ICSICYEDLKP+VE+LQ IS CGHVFHELCLQQWFEYC S+ K CP+CK
Sbjct: 1 MAEENAAGNAICSICYEDLKPVVENLQSISACGHVFHELCLQQWFEYCPSTNKRNCPICK 60
Query: 61 QRCSSSN-------SIGDQIDLVISQKPKDPEVEDPEVSRAEVKILEVKVSRLHTVLESQ 113
Q+CS + S G+Q D + S K E EDP + R EVK LE KV L + LE++
Sbjct: 61 QKCSLKDPCRLYFQSSGNQTDSIASDKVVGIE-EDPVLLRGEVKRLEGKVQNLTSALEAK 119
Query: 114 GKEIKEINEELCLCKERIKEEAALKNEALRQKVSVEQLLHSKSQELDKVTLECLKLKQRN 173
KE E++++L C E++KE+ + EAL++ + + LL KS+E ++ +C+KL++R
Sbjct: 120 KKENVEVSDKLHQCNEQLKEDKVKRWEALQEISTTQHLLKLKSEECIQLNSQCVKLQERT 179
Query: 174 MDLAKELASLKLVSDLNLDEDEVLKFALLGNGANNKDTIDVLRKSLVIRNKNYTELMAKC 233
+ LAKELASLKLVSDL+L+ED+VLK ALLGN A KDTID L KSLVIRN++Y EL+AKC
Sbjct: 180 VALAKELASLKLVSDLSLEEDDVLKLALLGNNAKTKDTIDTLVKSLVIRNRSYKELLAKC 239
Query: 234 NLLGREKARFSEKLEKAKEKINKLKTRVQELETAVELKDNEVLRALKVSKKASQKEEILK 293
N LGR +AR SEKLEKA EKI KLK R++ELE E ++N LR + VSKK S E + +
Sbjct: 240 NQLGRGEARSSEKLEKALEKIEKLKKRMRELELITEERENRALRDINVSKKCSYTE-VSE 298
Query: 294 GATEDNSISLCTNNVSLEDQREQHSVPIYNLDWTSRVTNDFS-FSTKSENF----NAIKN 348
A E S S +S +++ E+ S P L+ T S + ++F +++ +
Sbjct: 299 PAIESMS-SF--RMLSSDNKVEKISTPPGKLEEKDGFTIQGSCLRGREDSFVSRTDSVID 355
Query: 349 IDANHTREGGSAKSHGKERNALQREDTSRFSSVVFGL 385
+D ++ E ++ N ++ D S + F +
Sbjct: 356 VDDDYVPETNTSGIRDWNTNIEEKGDNSMVKDIKFNI 392
|
|
| TAIR|locus:504955487 AT4G01245 "AT4G01245" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-30 traip "TRAF-interacting protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015194 B0432.13 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EN91 TRAIP "TRAF-interacting protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PCW0 GOLGA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162996 AT5G41140 "AT5G41140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091204-454 si:ch1073-392o20.1 "si:ch1073-392o20.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R604 TRAIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H9V4 RNF122 "RING finger protein 122" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 466 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-11 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-09 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 7e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 1e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| pfam11793 | 70 | pfam11793, FANCL_C, FANCL C-terminal domain | 1e-04 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 57.1 bits (138), Expect = 5e-11
Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 8/52 (15%)
Query: 12 CSICYEDLKPIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCKQRC 63
C IC E+ + V V+ CGHVF C+ +W + S K TCP+C+
Sbjct: 2 CPICLEEFREPV----VLLPCGHVFCRSCIDKWLK----SGKNTCPLCRTPI 45
|
Length = 45 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 466 | |||
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.87 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 99.5 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.15 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.13 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.04 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.98 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.94 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.9 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.9 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.89 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.87 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.87 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.87 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.81 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.78 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.77 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.77 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.75 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.69 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.69 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.68 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.67 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.62 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.61 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.51 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.51 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.51 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.46 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.45 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.45 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.4 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.28 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.25 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.2 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.94 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 97.88 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.88 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.8 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.77 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.72 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.71 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.62 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.51 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.48 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.47 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.43 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.41 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.4 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.31 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 97.27 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.27 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.24 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.19 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.17 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.03 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.89 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.88 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.86 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.83 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.73 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.69 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.68 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.66 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 96.66 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.65 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.6 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.55 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 96.48 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.45 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.42 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.42 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.42 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 96.18 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.13 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.13 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.11 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.03 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.01 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.0 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.98 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 95.93 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 95.93 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.87 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.87 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.81 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.72 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.7 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.52 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 95.49 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 95.44 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 95.39 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 95.23 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.21 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.12 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 95.1 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 95.05 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 94.95 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.94 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 94.87 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.81 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.78 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 94.72 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.69 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 94.67 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 94.59 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.55 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 94.44 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 94.41 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 94.35 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.33 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 94.32 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 94.28 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.27 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.26 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 94.2 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.16 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.15 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 94.09 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 94.08 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.07 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.01 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 93.86 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.84 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 93.82 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 93.76 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 93.74 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 93.71 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 93.69 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 93.67 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 93.64 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 93.63 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 93.61 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 93.59 | |
| PRK09039 | 343 | hypothetical protein; Validated | 93.51 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 93.46 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 93.44 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 93.43 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.42 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.41 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 93.36 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.28 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 93.2 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 93.14 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 92.96 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 92.92 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 92.83 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.77 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 92.73 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 92.71 | |
| PF13166 | 712 | AAA_13: AAA domain | 92.68 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 92.61 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 92.58 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 92.58 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.46 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 92.42 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 92.07 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 92.03 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 91.97 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 91.97 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 91.93 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.83 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 91.77 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 91.74 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 91.69 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 91.69 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 91.55 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 91.45 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 91.24 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 90.89 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.86 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 90.86 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 90.41 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 90.33 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 90.17 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 89.87 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 89.83 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 89.77 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 89.66 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 89.59 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 89.41 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 89.35 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 88.98 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 88.68 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 88.67 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 88.63 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 88.49 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 88.4 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 88.35 | |
| KOG1842 | 505 | consensus FYVE finger-containing protein [General | 88.28 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 88.27 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 88.19 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.17 | |
| COG4694 | 758 | Uncharacterized protein conserved in bacteria [Fun | 88.16 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.95 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 87.93 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 87.92 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 87.91 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 87.87 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 87.84 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 87.6 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 87.53 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 87.33 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 87.27 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 87.13 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 86.9 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 86.84 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 86.66 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 86.32 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 86.24 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 86.12 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 85.85 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 85.75 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 85.44 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 85.02 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 84.9 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 84.56 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 84.48 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 84.42 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 84.23 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 84.17 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.02 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 83.99 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 83.95 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 83.76 | |
| PF14182 | 79 | YgaB: YgaB-like protein | 83.74 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 83.68 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 82.94 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 81.91 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 81.57 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 81.3 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 80.93 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 80.85 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.79 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 80.69 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 80.48 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 80.47 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 80.45 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 80.18 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 80.09 |
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.87 E-value=1.5e-21 Score=195.59 Aligned_cols=297 Identities=20% Similarity=0.160 Sum_probs=239.6
Q ss_pred CcccccccccccccccCcceeecCCCcccHHHHHHHHHhcCCCCCCCCcCcCccccCCCCCcchhhhhccCCCCCCC-CC
Q 012292 9 KTICSICYEDLKPIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCKQRCSSSNSIGDQIDLVISQKPKDPE-VE 87 (466)
Q Consensus 9 eltCpICLe~f~P~~~~~~~llpCGHsFC~~CL~~wle~~~~~~s~~CP~CR~~~~~~~~l~~l~~~l~~~~~~~~e-~~ 87 (466)
-..|.|| ..+.|..+++..+-.|||+||..|+.+|++++|. +..||.|+-.+...... ++..++.- .+
T Consensus 4 ~A~C~Ic-~d~~p~~~~l~~i~~cGhifh~~cl~qwfe~~Ps--~R~cpic~ik~~~r~~~--------N~~~~d~vvEe 72 (465)
T KOG0827|consen 4 MAECHIC-IDGRPNDHELGPIGTCGHIFHTTCLTQWFEGDPS--NRGCPICQIKLQERHVA--------NPSTVDHVVEE 72 (465)
T ss_pred cceeeEe-ccCCccccccccccchhhHHHHHHHHHHHccCCc--cCCCCceeecccceeee--------chhhhhhhhcc
Confidence 3589999 5555667788777779999999999999998774 37999999666555411 12222211 14
Q ss_pred ChhhHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHH
Q 012292 88 DPEVSRAEVKILEVKVSRLHTVLESQGKEIKEINEELCLCKERIKEEAALKNEALRQKVSVEQLLHSKSQELDKVTLECL 167 (466)
Q Consensus 88 ~~e~l~~El~rLe~kl~~L~~~Le~~~~~lk~L~eel~~~KeQlkeE~~~l~EkLk~~esLeqLL~~q~eEVeklkeE~~ 167 (466)
++-....++.++.+++..........+.....+.+.+..+-++..+....+++++.++..+...|..+.+++.+...++.
T Consensus 73 ~~Vld~~~~K~~~gkvk~~~s~~~~~K~dn~e~~d~l~~t~e~~~a~vv~~~~al~ki~~~~~~Lk~~~~~l~q~~~et~ 152 (465)
T KOG0827|consen 73 SVVLDWDVGKKCGGKVKYSVSPGWPYKSDNLELQDLLGHTAEDTIAIVVGKIGALKKIVVYSGDLKEDFQDLKQFDPETL 152 (465)
T ss_pred chhhhHHHHHhhccchhhhcCcCCccccccHHHHHHHhhhHHHHHHHHHHHHHHhhhHHHhHHHHHHHHHHHHhhCHHHH
Confidence 55556667777777888777777777777777888888888888888899999999999999999999999999999999
Q ss_pred HHHHhhhHHHHHHHhccccccCChhHHHHHHHHhhcCCCCChhHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHH
Q 012292 168 KLKQRNMDLAKELASLKLVSDLNLDEDEVLKFALLGNGANNKDTIDVLRKSLVIRNKNYTELMAKCNLLGREKARFSEKL 247 (466)
Q Consensus 168 rLq~rn~alakeL~sLKlvsd~~~eEeE~LK~~~lg~~~~~~e~~d~Lkk~l~~~~k~yeeL~~k~e~L~ree~~~~~kL 247 (466)
+++++-.+++..++.++.++.+..+ ++...++..-..+.++.|.++|.+...+|+++-.+|+++.+...+...+|
T Consensus 153 ~lqE~~~~L~~~~~~~~~~~lls~~-----~~~~~~e~~~t~~~~~slv~sl~I~~~slK~~y~k~~~~~~g~~~~~~kL 227 (465)
T KOG0827|consen 153 ELQENPSDLLISHEYIFGAALLSIK-----CFFQTAEHWMTSQPTSSLVGSLSICFESLKQNYDKISAIVCGHIYHHGKL 227 (465)
T ss_pred HHHHhHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHhhcCchHHHHhhhHhhHHHHHHHHHHHHHHhhcccchhhHH
Confidence 9999999999999999965554443 23333444456678899999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhccccchhHHhhhcCCCCCccccccccCChhhhhhccCCCcccccCC
Q 012292 248 EKAKEKINKLKTRVQELETAVELKDNEVLRALKVSKKASQKEEILKGATEDNSISLCTNNVSLEDQREQHSVPIYNLDWT 327 (466)
Q Consensus 248 ek~~~ei~~Lk~~v~eLqk~le~~~ne~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 327 (466)
+++-..+++|+..+.+|.+.-.+..+ +++++.++++...+ +..+ . .+....+++++++.+++|+..++.+
T Consensus 228 ~k~L~~~~kl~~~~rel~~~~~e~k~-A~~Dvq~~~ke~~~-lk~p-l-------tMl~~~~~~~~v~~~t~~~~~lE~~ 297 (465)
T KOG0827|consen 228 SKWLATKRKLPSCRRELPKNGFEEKL-AFFDVQRMGKEAEK-LKPP-L-------TMLEIDYREEHVKLSTSLKVELEKL 297 (465)
T ss_pred HHHHHHHHHhHHHHhhhhhhhHHHHH-HHHHHHhhhcchhh-cCCc-h-------HHHHHhccCccccccccCceeeccc
Confidence 99999999999999999999999888 89999999987765 3333 2 2467889999999999999999988
Q ss_pred CCCC
Q 012292 328 SRVT 331 (466)
Q Consensus 328 ~~~~ 331 (466)
+-+|
T Consensus 298 ~~~~ 301 (465)
T KOG0827|consen 298 GTLN 301 (465)
T ss_pred Ccce
Confidence 7655
|
|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1842 consensus FYVE finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF14182 YgaB: YgaB-like protein | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 466 | |||
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-13 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 7e-13 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-12 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 4e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 1e-10 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 7e-10 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 7e-10 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 1e-09 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-09 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-09 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 3e-09 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 3e-08 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 4e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 7e-08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 1e-07 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 5e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 2e-07 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 3e-07 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 4e-07 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 5e-07 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 6e-07 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 6e-07 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 7e-07 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 1e-06 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 1e-06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-06 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 2e-06 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 3e-06 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 3e-06 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 4e-06 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 5e-06 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 6e-06 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 6e-06 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 7e-06 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 7e-06 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 9e-06 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 9e-06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 1e-05 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 2e-05 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 2e-05 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 3e-05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 3e-05 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 4e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 4e-05 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 7e-05 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 8e-05 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 9e-05 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 1e-04 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 3e-04 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-04 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 4e-04 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 5e-04 |
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
Score = 63.7 bits (155), Expect = 3e-13
Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)
Query: 8 GKTICSICYEDLKPIVEDLQVISI--CGHVFHELCLQQWFEYCSSSKKCTCPVCKQRCSS 65
G C IC + IV++ ++I CGHVF CL+ + TCP C+++ +
Sbjct: 9 GTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLK-----NANTCPTCRKKINH 63
Query: 66 SN 67
Sbjct: 64 KR 65
|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 466 | |||
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.27 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.27 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.26 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.25 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.25 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.24 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.24 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.23 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.23 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.23 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.23 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.23 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.22 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.22 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.22 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.21 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.21 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.21 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.2 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.2 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.2 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.19 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.19 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.19 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.17 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.17 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.16 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.15 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.15 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.15 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.13 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.11 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.11 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.11 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.1 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.09 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.09 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.09 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.05 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.05 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.04 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.03 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.01 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.01 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.0 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.98 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.95 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.93 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.91 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.85 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.81 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.81 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.8 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.79 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.78 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.77 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.76 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.71 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.71 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.64 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.57 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.5 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.44 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.4 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.16 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.12 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.01 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 96.99 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.87 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.17 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.11 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.03 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 95.93 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.87 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.69 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.54 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.34 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.09 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 93.67 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 93.55 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 93.41 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 92.87 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 92.26 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 92.05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 90.69 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 90.6 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 88.36 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 87.47 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 87.47 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 87.16 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 87.13 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 87.02 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 86.21 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 86.04 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 83.68 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 83.55 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 82.67 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 82.23 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 81.99 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 81.62 |
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
Probab=99.27 E-value=2.7e-12 Score=102.42 Aligned_cols=55 Identities=22% Similarity=0.424 Sum_probs=46.1
Q ss_pred CCCCCCCccccccccccc-ccccCcceeecCCCcccHHHHHHHHHhcCCCCCCCCcCcCccccCCC
Q 012292 3 IENKFGKTICSICYEDLK-PIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCKQRCSSSN 67 (466)
Q Consensus 3 ~~~~~~eltCpICLe~f~-P~~~~~~~llpCGHsFC~~CL~~wle~~~~~~s~~CP~CR~~~~~~~ 67 (466)
.....+++.||||++.|. |+ +++|||+||..||..|+.. +...||+||.++....
T Consensus 2 ~~~~~~~~~C~IC~~~~~~Pv------~~~CgH~fc~~Ci~~~~~~----~~~~CP~C~~~~~~~~ 57 (78)
T 1t1h_A 2 SPEFPEYFRCPISLELMKDPV------IVSTGQTYERSSIQKWLDA----GHKTCPKSQETLLHAG 57 (78)
T ss_dssp CCCCSSSSSCTTTSCCCSSEE------EETTTEEEEHHHHHHHHTT----TCCBCTTTCCBCSSCC
T ss_pred CcCCcccCCCCCccccccCCE------EcCCCCeecHHHHHHHHHH----CcCCCCCCcCCCChhh
Confidence 345567899999999998 54 7899999999999999982 4789999999987553
|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 466 | ||||
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 2e-10 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 3e-10 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-09 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 6e-09 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 3e-08 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 4e-08 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 1e-07 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 8e-07 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 8e-07 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-06 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 3e-06 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 2e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 1e-04 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 0.002 |
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Variant RING domain domain: IE1B protein (ORF K3), N-terminal domain species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]
Score = 54.5 bits (130), Expect = 2e-10
Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 3/54 (5%)
Query: 11 ICSICYEDLKPIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCKQRCS 64
+C IC E+L + H CL W + C +C +
Sbjct: 8 VCWICNEELGNERFRACGCTGELENVHRSCLSTWLTIS---RNTACQICGVVYN 58
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 466 | |||
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.31 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.31 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.3 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.29 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.28 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.25 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.19 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.18 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.17 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.16 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.13 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.11 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.96 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.86 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.82 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.36 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 90.44 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 90.42 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 88.82 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 87.34 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 83.32 |
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: TFIIH Mat1 subunit species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.31 E-value=5.5e-13 Score=101.90 Aligned_cols=56 Identities=23% Similarity=0.453 Sum_probs=43.3
Q ss_pred CCcccccccccccccccCcceeecCCCcccHHHHHHHHHhcCCCCCCCCcCcCccccCCC
Q 012292 8 GKTICSICYEDLKPIVEDLQVISICGHVFHELCLQQWFEYCSSSKKCTCPVCKQRCSSSN 67 (466)
Q Consensus 8 ~eltCpICLe~f~P~~~~~~~llpCGHsFC~~CL~~wle~~~~~~s~~CP~CR~~~~~~~ 67 (466)
++.+||||++.+.........+++|||+||..||.+|+.. +...||+||.++...+
T Consensus 2 dd~~CpIC~~~~~~~~~~~~~~~~C~H~fc~~Ci~~~~~~----~~~~CP~CR~~i~~~~ 57 (65)
T d1g25a_ 2 DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVR----GAGNCPECGTPLRKSN 57 (65)
T ss_dssp CTTCCSTTTTHHHHCSSCCEEECTTCCCEEHHHHHHHHHT----TSSSCTTTCCCCSSCC
T ss_pred CCCCCCcCCceeecCCceEEEeCccChHhhHHHHHHHhCc----CcCCCCCCCcCccccc
Confidence 5789999999865212233456799999999999999973 4567999999987553
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|