Citrus Sinensis ID: 012349


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MVQTNEVVNDSLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
cccccccEEcccccccccccccccHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccccccccccccccEEEEccHHHHHccccEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccHHHHHHHHHccccccEEEEcccccHHHHHcccccEEEEEcccccHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHccccHHHHHHHHcccccEEcHHHHHHHHHHHHHcccEEccccccccccccccccHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHcccccccccccccc
ccccEEEEEcccccccccccccccHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHccHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccEEccccccccccEEcccHHHHHccccEEEEEccHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccEEHHHHcHHHHcccccccEEEEccccHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEEcccEEEEEHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHEEEEccccHHHHHHHHHcccccHHHHHHHHccccEEEcHHHHHHHHHHHHHccccEccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHccccccHHccccc
mvqtnevvndslssnglihhtngsLEERLDELRRLMgkaegdplrivgvgagAWGSVFTAMLQDSYGYLRDKVLIRIwrrpgrsvdrATAEHLFEVINSREDVLRRLIRRCAYLKYVEARlgdrtlhadeilkdgfclnmidtplcplkVVTNLQEavwdadivinglpstetKEVFEEISRYWKERITVPVIISLAKGVeaeleavpriitptqminratgvpienilylggpniaseIYNKEYANARICGAEKWRKPLAkflrrphftvwdngdlvtHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLaeepeklagpllADTYVTLLKGRnawygqelakgrltldlgdsikgkgmIQGISAVKAFYELLSQsslsvlhpeenkpvatveLCPILKMLYKILIMRESPIQAILEALRdetmndprDRIEIAQThvfyrpsllgqlp
mvqtnevvndslssnglihhtngsLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWrrpgrsvdrataehlfevinsredVLRRLIRRCAYLKYvearlgdrtlhaDEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADivinglpstetkEVFEEISRywkeritvPVIISLAKGVEAeleavpriitptqminraTGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAqthvfyrpsllgqlp
MVQTNEVVNDSLSSNGLIHHTNGSleerldelrrlMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
***************************************EGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRD********RIEIAQTHVFYRP*******
*********************************************IVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEAL*************IAQTHVFYRPSLLG***
*********DSLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
***TNEVVNDSLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQ**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQTNEVVNDSLSSNGLIHHTxxxxxxxxxxxxxxxxxxxxxPLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query465 2.2.26 [Sep-21-2011]
Q8S0G4456 Probable glycerol-3-phosp yes no 0.972 0.991 0.838 0.0
Q8S2G5467 Probable glycerol-3-phosp no no 0.954 0.950 0.840 0.0
O22216462 Glycerol-3-phosphate dehy yes no 0.974 0.980 0.841 0.0
Q65X70465 Probable glycerol-3-phosp no no 0.935 0.935 0.832 0.0
Q3V7H1357 Glycerol-3-phosphate dehy yes no 0.516 0.672 0.324 8e-14
B3EI28333 Glycerol-3-phosphate dehy yes no 0.548 0.765 0.261 1e-13
Q0SE35335 Glycerol-3-phosphate dehy yes no 0.604 0.838 0.259 2e-13
A5FPU2359 Glycerol-3-phosphate dehy yes no 0.552 0.715 0.267 4e-13
C4LJE8332 Glycerol-3-phosphate dehy yes no 0.625 0.876 0.244 4e-13
Q8KG76333 Glycerol-3-phosphate dehy yes no 0.520 0.726 0.278 5e-13
>sp|Q8S0G4|GPDH1_ORYSJ Probable glycerol-3-phosphate dehydrogenase [NAD(+)] 1, cytosolic OS=Oryza sativa subsp. japonica GN=Os01g0939600 PE=2 SV=1 Back     alignment and function desciption
 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/453 (83%), Positives = 416/453 (91%), Gaps = 1/453 (0%)

Query: 11  SLSSNGLIHHTNGSLEERLDELRRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLR 70
           S+  NG ++  NG+ EERLDELRRL+GK++GD L+IVG+GAGAWGSVF A+LQD+YG  R
Sbjct: 4   SVHVNGSVNGGNGT-EERLDELRRLLGKSDGDLLKIVGIGAGAWGSVFAALLQDAYGRFR 62

Query: 71  DKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADE 130
           +KV IRIWRR GRSVDR TAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTL+ADE
Sbjct: 63  EKVQIRIWRRAGRSVDRTTAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLYADE 122

Query: 131 ILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITV 190
           IL+DGFCLNMIDTPLCPLKVVTNLQEAVWDADIV+NGLPSTET+EVFEEIS+YWKERI+V
Sbjct: 123 ILRDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYWKERISV 182

Query: 191 PVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI 250
           PVIISLAKG+EA L+ +PRIITPTQMI+ ATGVP ENILYLGGPNIASEIYNKEYANARI
Sbjct: 183 PVIISLAKGIEASLDPIPRIITPTQMISSATGVPTENILYLGGPNIASEIYNKEYANARI 242

Query: 251 CGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV 310
           CG+ KWRKPLAKFLR+PHF VWDN DLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV
Sbjct: 243 CGSNKWRKPLAKFLRQPHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV 302

Query: 311 YFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSI 370
           YFAHCTSEM+FITHLL E+PEKLAGPLLADTYVTLLKGRNAWYGQ LAKG L+ D+GDSI
Sbjct: 303 YFAHCTSEMIFITHLLTEQPEKLAGPLLADTYVTLLKGRNAWYGQMLAKGELSPDMGDSI 362

Query: 371 KGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQA 430
           KGKGMIQGISAV AF+ELLSQ SLSV HPEENK VA  ELCPILK LY+ILI RE   + 
Sbjct: 363 KGKGMIQGISAVGAFFELLSQPSLSVQHPEENKQVAPAELCPILKRLYRILIKRELSTRD 422

Query: 431 ILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQ 463
           IL+ALRDETMNDPR+RIE+AQ+H FYRPSLLG+
Sbjct: 423 ILQALRDETMNDPRERIEMAQSHAFYRPSLLGK 455




May be involved in cell redox homeostasis.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8
>sp|Q8S2G5|GPDH2_ORYSJ Probable glycerol-3-phosphate dehydrogenase [NAD(+)] 2, cytosolic OS=Oryza sativa subsp. japonica GN=Os01g0801600 PE=2 SV=1 Back     alignment and function description
>sp|O22216|GPDHC_ARATH Glycerol-3-phosphate dehydrogenase [NAD(+)] GPDHC1, cytosolic OS=Arabidopsis thaliana GN=GPDHC1 PE=2 SV=1 Back     alignment and function description
>sp|Q65X70|GPDH3_ORYSJ Probable glycerol-3-phosphate dehydrogenase [NAD(+)] 3, cytosolic OS=Oryza sativa subsp. japonica GN=Os05g0495700 PE=2 SV=1 Back     alignment and function description
>sp|Q3V7H1|GPDA_ACIAD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter sp. (strain ADP1) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|B3EI28|GPDA_CHLL2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|Q0SE35|GPDA1_RHOSR Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 OS=Rhodococcus sp. (strain RHA1) GN=gpsA1 PE=3 SV=1 Back     alignment and function description
>sp|A5FPU2|GPDA_DEHSB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Dehalococcoides sp. (strain BAV1) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|C4LJE8|GPDA_CORK4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=gpsA PE=3 SV=1 Back     alignment and function description
>sp|Q8KG76|GPDA_CHLTE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=gpsA PE=3 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
TAIR|locus:2062734462 GPDHC1 [Arabidopsis thaliana ( 0.974 0.980 0.821 1e-201
TAIR|locus:2077387466 AT3G07690 [Arabidopsis thalian 0.924 0.922 0.809 8.3e-193
UNIPROTKB|P95113334 gpsA "Glycerol-3-phosphate deh 0.539 0.751 0.245 3.3e-12
TIGR_CMR|DET_1397359 DET_1397 "glycerol-3-phosphate 0.509 0.660 0.278 7.1e-12
UNIPROTKB|I3LLU0351 GPD1L "Uncharacterized protein 0.494 0.655 0.275 4.4e-11
MGI|MGI:1289257351 Gpd1l "glycerol-3-phosphate de 0.496 0.658 0.272 4.9e-11
TIGR_CMR|BA_1526340 BA_1526 "glycerol-3-phosphate 0.492 0.673 0.243 5e-11
UNIPROTKB|F1P0W8380 GPD1L "Uncharacterized protein 0.494 0.605 0.275 7e-11
RGD|1560123351 Gpd1l "glycerol-3-phosphate de 0.494 0.655 0.275 8.4e-11
UNIPROTKB|F1NFY2352 GPD1 "Uncharacterized protein" 0.565 0.747 0.255 8.6e-11
TAIR|locus:2062734 GPDHC1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1952 (692.2 bits), Expect = 1.0e-201, P = 1.0e-201
 Identities = 372/453 (82%), Positives = 404/453 (89%)

Query:    11 SLSSNGLIHHTNGSXXXXXXXXXXXMGKAEGDPLRIVGVGAGAWGSVFTAMLQDSYGYLR 70
             SL SNG +HH   +           +GK+E DPLRIV VGAGAWGSVF A+LQ+SYG  R
Sbjct:     9 SLQSNGSVHHIGLNLEEKLDEFRRLLGKSEKDPLRIVSVGAGAWGSVFAALLQESYGGFR 68

Query:    71 DKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLHADE 130
             DK  IRIWRR GR+VDR TAEHLFEVINSRED+LRRLIRRCAYLKYVEARLGDRTL+ADE
Sbjct:    69 DKFQIRIWRRAGRAVDRETAEHLFEVINSREDILRRLIRRCAYLKYVEARLGDRTLYADE 128

Query:   131 ILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITV 190
             ILKDGFCLNM+DTPLCPLKVVTNLQEAVWDADIV+NGLPSTET+EVFEEIS+YWKERITV
Sbjct:   129 ILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYWKERITV 188

Query:   191 PVIISLAKGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI 250
             P+IISL+KG+E  LE VP IITPT+MI++ATGVPI+N+LYLGGPNIA+EIYNKEYANARI
Sbjct:   189 PIIISLSKGIETALEPVPHIITPTKMIHQATGVPIDNVLYLGGPNIAAEIYNKEYANARI 248

Query:   251 CGAEKWRKPLAKFLRRPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV 310
             CGA KWRKPLAKFLR+PHF VWDN DLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV
Sbjct:   249 CGAAKWRKPLAKFLRQPHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSV 308

Query:   311 YFAHCTSEMVFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSI 370
             YFAHCTSEM+FITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQ LAKG +  D+GDSI
Sbjct:   309 YFAHCTSEMIFITHLLAEEPEKLAGPLLADTYVTLLKGRNAWYGQMLAKGEINRDMGDSI 368

Query:   371 KGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQA 430
              GKGMIQG+SAV AFY+LLSQSSLS+L  EE KPVA VE CPILK LYKILI RE   QA
Sbjct:   369 SGKGMIQGVSAVGAFYQLLSQSSLSILPSEEKKPVAPVESCPILKTLYKILITREQSTQA 428

Query:   431 ILEALRDETMNDPRDRIEIAQTHVFYRPSLLGQ 463
             IL+ALRDET+NDPRDRIEIAQ+H FYRPSLLGQ
Sbjct:   429 ILQALRDETLNDPRDRIEIAQSHAFYRPSLLGQ 461




GO:0000166 "nucleotide binding" evidence=IEA
GO:0004367 "glycerol-3-phosphate dehydrogenase [NAD+
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006072 "glycerol-3-phosphate metabolic process" evidence=IEA;ISS
GO:0009331 "glycerol-3-phosphate dehydrogenase complex" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0046168 "glycerol-3-phosphate catabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2077387 AT3G07690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P95113 gpsA "Glycerol-3-phosphate dehydrogenase [NAD(P)+]" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1397 DET_1397 "glycerol-3-phosphate dehydrogenase, NAD-dependent" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLU0 GPD1L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1289257 Gpd1l "glycerol-3-phosphate dehydrogenase 1-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1526 BA_1526 "glycerol-3-phosphate dehydrogenase (NAD(P)+)" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0W8 GPD1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1560123 Gpd1l "glycerol-3-phosphate dehydrogenase 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFY2 GPD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22216GPDHC_ARATH1, ., 1, ., 1, ., 80.84100.97410.9805yesno
Q65X70GPDH3_ORYSJ1, ., 1, ., 1, ., 80.83210.93540.9354nono
Q8S0G4GPDH1_ORYSJ1, ., 1, ., 1, ., 80.83880.97200.9912yesno
Q8S2G5GPDH2_ORYSJ1, ., 1, ., 1, ., 80.84040.95480.9507nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!
4th Layer1.1.1.94LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_2200005
hypothetical protein (458 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
pfam07479145 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol- 1e-34
COG0240329 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase 1e-26
PRK00094325 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosp 5e-20
PRK12439341 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-p 7e-16
PTZ00345365 PTZ00345, PTZ00345, glycerol-3-phosphate dehydroge 8e-16
TIGR03376342 TIGR03376, glycerol3P_DH, glycerol-3-phosphate deh 3e-15
pfam01210157 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol- 1e-08
PRK14619308 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-p 2e-08
PRK14618328 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-p 3e-08
PRK14620326 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-p 8e-05
>gnl|CDD|116100 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus Back     alignment and domain information
 Score =  126 bits (318), Expect = 1e-34
 Identities = 48/164 (29%), Positives = 65/164 (39%), Gaps = 27/164 (16%)

Query: 276 DLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPE---K 332
           D+V  E+ G LKNV AI AG++  L      +K+        EM+     L   PE    
Sbjct: 2   DVVGVEIGGALKNVIAIAAGILDGLGFG-DNTKAALITRGLMEMIKFGAALGGGPETFFG 60

Query: 333 LAGPLLADTYVTLL--KGRNAWYGQELAKGRLTLDLGDSIKGKGM-IQGISAVKAFYELL 389
           LAG  L D   T     GRN   G+ L KG+    L +  K  G   +G+   K  YEL 
Sbjct: 61  LAG--LGDLITTCTSELGRNRRVGEALGKGK---SLEEIEKELGQVAEGVKTAKEVYELA 115

Query: 390 SQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILE 433
            +  L                 P+   +Y+IL     P +AI  
Sbjct: 116 KRKGLD---------------FPLFTAVYRILYEGLKPEEAIEY 144


NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyzes the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the C-terminal substrate-binding domain. Length = 145

>gnl|CDD|223318 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234629 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|171500 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240373 PTZ00345, PTZ00345, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234190 TIGR03376, glycerol3P_DH, glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>gnl|CDD|201664 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>gnl|CDD|237771 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237770 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173083 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 465
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 100.0
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 100.0
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 100.0
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 100.0
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 100.0
PF07479149 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate 100.0
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.94
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.93
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.91
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.9
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.89
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.88
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.88
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.85
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.75
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.72
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.7
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.65
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.65
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.63
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.61
PRK07680273 late competence protein ComER; Validated 99.57
PLN02688266 pyrroline-5-carboxylate reductase 99.56
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.54
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.49
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.48
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.48
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.48
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.46
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.46
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.4
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.39
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.38
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.37
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.37
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.37
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.36
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.35
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.34
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.34
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.34
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.34
PRK15059292 tartronate semialdehyde reductase; Provisional 99.33
PLN02353473 probable UDP-glucose 6-dehydrogenase 99.32
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.31
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.31
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.3
PRK05479330 ketol-acid reductoisomerase; Provisional 99.3
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.29
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.29
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 99.27
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.25
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.25
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.25
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.25
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.24
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.21
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.2
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.18
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.17
PLN02858 1378 fructose-bisphosphate aldolase 99.17
PRK08655437 prephenate dehydrogenase; Provisional 99.16
PRK08507275 prephenate dehydrogenase; Validated 99.14
PLN02858 1378 fructose-bisphosphate aldolase 99.13
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.11
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.11
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.11
PRK07417279 arogenate dehydrogenase; Reviewed 99.08
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.04
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.03
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.01
PLN02256304 arogenate dehydrogenase 98.98
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.98
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 98.95
PRK06545359 prephenate dehydrogenase; Validated 98.94
PRK11730715 fadB multifunctional fatty acid oxidation complex 98.91
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.88
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.87
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 98.83
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.82
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.81
KOG0409327 consensus Predicted dehydrogenase [General functio 98.78
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.78
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.76
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 98.74
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 98.65
KOG2666481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 98.62
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 98.62
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 98.59
PLN02712667 arogenate dehydrogenase 98.58
PRK13403335 ketol-acid reductoisomerase; Provisional 98.56
PLN02712 667 arogenate dehydrogenase 98.55
PRK08818370 prephenate dehydrogenase; Provisional 98.48
PRK06223307 malate dehydrogenase; Reviewed 98.38
PRK12480330 D-lactate dehydrogenase; Provisional 98.35
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.34
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.33
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.27
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 98.21
PTZ00082321 L-lactate dehydrogenase; Provisional 98.2
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.18
PTZ00117319 malate dehydrogenase; Provisional 98.14
PRK08605332 D-lactate dehydrogenase; Validated 98.13
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.13
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.12
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.09
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.87
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.86
PLN02602350 lactate dehydrogenase 97.83
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.81
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.8
PRK15076431 alpha-galactosidase; Provisional 97.79
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.77
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.76
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 97.7
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 97.7
PRK06444197 prephenate dehydrogenase; Provisional 97.7
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.68
PRK05225487 ketol-acid reductoisomerase; Validated 97.64
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.59
PRK07574385 formate dehydrogenase; Provisional 97.55
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.54
PRK13243333 glyoxylate reductase; Reviewed 97.54
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 97.53
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.53
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.52
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.51
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.48
PLN03139386 formate dehydrogenase; Provisional 97.46
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.46
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.46
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 97.44
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.43
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.41
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.4
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.4
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 97.38
PRK06141314 ornithine cyclodeaminase; Validated 97.36
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.34
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.31
PRK00048257 dihydrodipicolinate reductase; Provisional 97.29
PRK05442326 malate dehydrogenase; Provisional 97.27
TIGR00036266 dapB dihydrodipicolinate reductase. 97.23
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.23
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.22
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.2
PRK06436303 glycerate dehydrogenase; Provisional 97.18
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 97.16
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.16
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.16
PLN00106323 malate dehydrogenase 97.16
PRK08618325 ornithine cyclodeaminase; Validated 97.16
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 97.15
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.14
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.13
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.13
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.08
PRK08291330 ectoine utilization protein EutC; Validated 97.06
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 97.06
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.06
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 97.04
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.03
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.02
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.01
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.0
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.99
PF10100429 DUF2338: Uncharacterized protein conserved in bact 96.98
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 96.97
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.95
PLN00203519 glutamyl-tRNA reductase 96.95
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.94
COG2344211 AT-rich DNA-binding protein [General function pred 96.93
PRK13303265 L-aspartate dehydrogenase; Provisional 96.88
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.87
PRK09496453 trkA potassium transporter peripheral membrane com 96.86
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.85
PRK07589346 ornithine cyclodeaminase; Validated 96.85
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.84
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.82
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.81
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 96.81
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.8
PLN02928347 oxidoreductase family protein 96.8
PRK13940414 glutamyl-tRNA reductase; Provisional 96.79
PRK07340304 ornithine cyclodeaminase; Validated 96.78
PRK05086312 malate dehydrogenase; Provisional 96.77
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.75
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.74
PLN00112444 malate dehydrogenase (NADP); Provisional 96.73
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.71
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.7
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.69
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.69
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.68
PTZ00325321 malate dehydrogenase; Provisional 96.68
PRK09496453 trkA potassium transporter peripheral membrane com 96.68
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.67
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.66
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.65
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.61
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.61
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.59
PLN02306386 hydroxypyruvate reductase 96.55
PRK06407301 ornithine cyclodeaminase; Provisional 96.54
PRK06487317 glycerate dehydrogenase; Provisional 96.53
PRK06823315 ornithine cyclodeaminase; Validated 96.51
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.5
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.46
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.43
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.43
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.42
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.4
PRK06046326 alanine dehydrogenase; Validated 96.39
PLN02494477 adenosylhomocysteinase 96.37
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 96.36
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 96.35
PRK06932314 glycerate dehydrogenase; Provisional 96.33
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.3
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 96.22
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.21
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.16
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.15
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.12
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 96.1
PRK08328231 hypothetical protein; Provisional 96.08
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.08
PRK11579346 putative oxidoreductase; Provisional 96.05
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.04
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.02
PRK06199379 ornithine cyclodeaminase; Validated 96.0
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 95.95
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.94
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.92
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.88
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 95.86
KOG1495332 consensus Lactate dehydrogenase [Energy production 95.84
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 95.83
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 95.8
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.78
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.76
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.73
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.69
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.64
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.62
PRK05600370 thiamine biosynthesis protein ThiF; Validated 95.59
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.59
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 95.56
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.55
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.53
PRK08300302 acetaldehyde dehydrogenase; Validated 95.52
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.52
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.51
COG0673342 MviM Predicted dehydrogenases and related proteins 95.46
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.46
PRK08223287 hypothetical protein; Validated 95.43
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.34
PRK04148134 hypothetical protein; Provisional 95.31
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 95.3
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.26
PTZ00075476 Adenosylhomocysteinase; Provisional 95.24
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.21
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 95.21
PRK06719157 precorrin-2 dehydrogenase; Validated 95.12
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.05
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.04
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 95.01
PRK06153393 hypothetical protein; Provisional 94.98
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 94.98
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.96
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 94.92
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 94.9
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.87
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.74
COG4408431 Uncharacterized protein conserved in bacteria [Fun 94.72
PRK07411390 hypothetical protein; Validated 94.7
PRK10669558 putative cation:proton antiport protein; Provision 94.68
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.65
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 94.57
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 94.53
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 94.45
PRK14027283 quinate/shikimate dehydrogenase; Provisional 94.44
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 94.23
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 94.23
COG2910211 Putative NADH-flavin reductase [General function p 94.16
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 94.1
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 94.1
PRK14982340 acyl-ACP reductase; Provisional 94.06
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 94.06
PRK03659601 glutathione-regulated potassium-efflux system prot 94.05
PRK06270341 homoserine dehydrogenase; Provisional 93.97
CHL00194317 ycf39 Ycf39; Provisional 93.88
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 93.85
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.83
PRK06753373 hypothetical protein; Provisional 93.6
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 93.53
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 93.45
PRK06349426 homoserine dehydrogenase; Provisional 93.37
PRK07236386 hypothetical protein; Provisional 93.32
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 93.23
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.22
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 93.19
PRK07877 722 hypothetical protein; Provisional 93.16
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 93.13
PRK06847375 hypothetical protein; Provisional 93.09
PRK08163396 salicylate hydroxylase; Provisional 93.06
PRK05868372 hypothetical protein; Validated 92.93
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 92.88
PRK03562621 glutathione-regulated potassium-efflux system prot 92.86
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 92.71
PLN02383344 aspartate semialdehyde dehydrogenase 92.66
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 92.62
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.59
PRK07588391 hypothetical protein; Provisional 92.38
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 92.3
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.22
PRK08040336 putative semialdehyde dehydrogenase; Provisional 92.19
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.1
PRK10206344 putative oxidoreductase; Provisional 92.06
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 92.02
PRK07538413 hypothetical protein; Provisional 91.96
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 91.93
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 91.92
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.82
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 91.78
PRK06185407 hypothetical protein; Provisional 91.78
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 91.68
PRK14851 679 hypothetical protein; Provisional 91.64
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 91.59
PF08484160 Methyltransf_14: C-methyltransferase C-terminal do 91.57
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 91.42
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 91.41
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 91.39
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 91.37
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.17
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 91.15
PRK11259376 solA N-methyltryptophan oxidase; Provisional 91.13
PRK06392326 homoserine dehydrogenase; Provisional 90.94
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 90.91
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 90.84
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 90.79
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.49
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 90.48
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 90.36
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 90.33
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 90.33
PRK07045388 putative monooxygenase; Reviewed 90.32
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 90.29
PRK08374336 homoserine dehydrogenase; Provisional 90.28
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 90.28
PRK06475400 salicylate hydroxylase; Provisional 90.26
PRK14852 989 hypothetical protein; Provisional 90.15
PRK10537393 voltage-gated potassium channel; Provisional 90.14
PLN02464 627 glycerol-3-phosphate dehydrogenase 90.08
PRK12770352 putative glutamate synthase subunit beta; Provisio 89.89
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 89.88
COG0300265 DltE Short-chain dehydrogenases of various substra 89.81
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 89.72
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.68
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 89.66
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 89.64
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 89.62
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 89.62
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 89.6
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 89.56
PLN02172461 flavin-containing monooxygenase FMO GS-OX 89.51
PRK08013400 oxidoreductase; Provisional 89.51
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 89.43
PRK12550272 shikimate 5-dehydrogenase; Reviewed 89.36
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 89.31
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 89.18
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 89.17
PLN02852491 ferredoxin-NADP+ reductase 89.12
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 89.05
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 89.03
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 88.77
PTZ00188506 adrenodoxin reductase; Provisional 88.66
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 88.59
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 88.56
PLN02985514 squalene monooxygenase 88.54
PRK11728393 hydroxyglutarate oxidase; Provisional 88.39
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 88.38
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 88.2
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 88.14
PRK08132 547 FAD-dependent oxidoreductase; Provisional 88.06
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 88.01
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 87.99
PRK09126392 hypothetical protein; Provisional 87.98
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 87.95
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 87.84
PTZ00367 567 squalene epoxidase; Provisional 87.78
PRK06126 545 hypothetical protein; Provisional 87.76
PRK12829264 short chain dehydrogenase; Provisional 87.59
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 87.54
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 87.53
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 87.51
PLN02686367 cinnamoyl-CoA reductase 87.49
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 87.41
PRK12814652 putative NADPH-dependent glutamate synthase small 87.31
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 87.3
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 87.3
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 87.25
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 87.18
PRK00536262 speE spermidine synthase; Provisional 87.13
PRK05884223 short chain dehydrogenase; Provisional 87.07
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 87.03
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 87.03
PRK12779 944 putative bifunctional glutamate synthase subunit b 87.01
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 86.96
PLN03075296 nicotianamine synthase; Provisional 86.93
PRK08017256 oxidoreductase; Provisional 86.91
PRK08244493 hypothetical protein; Provisional 86.91
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 86.91
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 86.83
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 86.76
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 86.73
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 86.47
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 86.41
PRK11445351 putative oxidoreductase; Provisional 86.31
PRK07023243 short chain dehydrogenase; Provisional 86.26
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 86.25
PRK13512438 coenzyme A disulfide reductase; Provisional 86.25
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 86.16
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 86.04
PRK10538248 malonic semialdehyde reductase; Provisional 86.02
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 85.8
PLN02214342 cinnamoyl-CoA reductase 85.78
PRK12831464 putative oxidoreductase; Provisional 85.78
PRK07523255 gluconate 5-dehydrogenase; Provisional 85.77
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 85.76
COG3349485 Uncharacterized conserved protein [Function unknow 85.72
PRK05562223 precorrin-2 dehydrogenase; Provisional 85.71
PRK05257494 malate:quinone oxidoreductase; Validated 85.63
PRK06184502 hypothetical protein; Provisional 85.63
PRK07774250 short chain dehydrogenase; Provisional 85.59
PRK11908347 NAD-dependent epimerase/dehydratase family protein 85.49
PRK07454241 short chain dehydrogenase; Provisional 85.38
PRK08340259 glucose-1-dehydrogenase; Provisional 85.32
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 85.18
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 85.02
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 85.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 84.97
PRK00676338 hemA glutamyl-tRNA reductase; Validated 84.91
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 84.85
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 84.83
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 84.71
PRK05993277 short chain dehydrogenase; Provisional 84.57
PRK08267260 short chain dehydrogenase; Provisional 84.54
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 84.48
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.45
PRK10157428 putative oxidoreductase FixC; Provisional 84.42
PRK07102243 short chain dehydrogenase; Provisional 84.42
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 84.29
PRK07326237 short chain dehydrogenase; Provisional 84.19
PRK08294 634 phenol 2-monooxygenase; Provisional 84.16
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 84.07
PRK12939250 short chain dehydrogenase; Provisional 83.9
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.78
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 83.68
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 83.6
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 83.44
PRK07109334 short chain dehydrogenase; Provisional 83.37
KOG1298509 consensus Squalene monooxygenase [Lipid transport 83.34
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 83.3
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 83.27
COG2907447 Predicted NAD/FAD-binding protein [General functio 83.25
PRK06567 1028 putative bifunctional glutamate synthase subunit b 83.25
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 83.06
PRK08177225 short chain dehydrogenase; Provisional 83.05
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 83.04
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 82.97
PRK06124256 gluconate 5-dehydrogenase; Provisional 82.96
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.9
PRK10675338 UDP-galactose-4-epimerase; Provisional 82.82
PLN03129581 NADP-dependent malic enzyme; Provisional 82.78
PRK06834488 hypothetical protein; Provisional 82.77
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 82.77
PRK08309177 short chain dehydrogenase; Provisional 82.68
PRK07233434 hypothetical protein; Provisional 82.68
PRK07190487 hypothetical protein; Provisional 82.65
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 82.57
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 82.54
PRK06057255 short chain dehydrogenase; Provisional 82.53
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.52
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 82.5
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.49
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 82.49
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 82.48
PTZ00383497 malate:quinone oxidoreductase; Provisional 82.48
PRK07024257 short chain dehydrogenase; Provisional 82.47
PRK05866293 short chain dehydrogenase; Provisional 82.47
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 82.46
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 82.37
PLN02695370 GDP-D-mannose-3',5'-epimerase 82.36
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 82.31
PRK07208479 hypothetical protein; Provisional 82.19
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=3.7e-73  Score=566.39  Aligned_cols=325  Identities=27%  Similarity=0.413  Sum_probs=296.9

Q ss_pred             CceEEEECccHHHHHHHHHHHHhcCCCCCCeeEEEEecCchhhhhhhhhhhHHHHhchhhhHHhhhhcccccchhhhhhc
Q 012349           43 PLRIVGVGAGAWGSVFTAMLQDSYGYLRDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLG  122 (465)
Q Consensus        43 ~mkIaIIGaGamGsalA~~La~~~G~~~~~~~V~l~~r~~~~~~~i~~~~l~~~i~~~~~~~~~~~~n~~~l~~~~~~l~  122 (465)
                      +|||+|||+|+|||++|..|+++ |     |+|++|+|+++.+++|+         ..+       +|++|||++.    
T Consensus         1 ~~kI~ViGaGswGTALA~~la~n-g-----~~V~lw~r~~~~~~~i~---------~~~-------~N~~yLp~i~----   54 (329)
T COG0240           1 MMKIAVIGAGSWGTALAKVLARN-G-----HEVRLWGRDEEIVAEIN---------ETR-------ENPKYLPGIL----   54 (329)
T ss_pred             CceEEEEcCChHHHHHHHHHHhc-C-----CeeEEEecCHHHHHHHH---------hcC-------cCccccCCcc----
Confidence            48999999999999999999999 7     99999999998777633         322       5889998762    


Q ss_pred             CCcccchhhhhccccccCCCCCCCCeEEecCHHHHhcCCCEEEEecCcchHHHHHHHHHHhhhccCCCCEEEEeeccccc
Q 012349          123 DRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEA  202 (465)
Q Consensus       123 ~~~l~~~~~~~~~~~~~~~~~~~~~i~~t~dl~eal~~aDiVIlaVps~~l~~vl~~l~~~l~~~~~~~ivIs~~kGi~~  202 (465)
                         +|                  .++.+++|+.++++++|+|+++||+++++++++++++++.+   ++++|+++||+++
T Consensus        55 ---lp------------------~~l~at~Dl~~a~~~ad~iv~avPs~~~r~v~~~l~~~l~~---~~~iv~~sKGie~  110 (329)
T COG0240          55 ---LP------------------PNLKATTDLAEALDGADIIVIAVPSQALREVLRQLKPLLLK---DAIIVSATKGLEP  110 (329)
T ss_pred             ---CC------------------cccccccCHHHHHhcCCEEEEECChHHHHHHHHHHhhhccC---CCeEEEEeccccC
Confidence               32                  26889999999999999999999999999999999988876   7899999999999


Q ss_pred             cccccccCCCHHHHHHhHhCCCCccEEEEeCCchhhhhhccCceEEEEe-CChhHHHHHHHHHcCCCCeEEecCChHHHH
Q 012349          203 ELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARIC-GAEKWRKPLAKFLRRPHFTVWDNGDLVTHE  281 (465)
Q Consensus       203 ~~~~~~~~~~~se~I~e~lg~~~~~i~vlsGP~~a~ev~~g~~t~~~~~-~~~~~~~~l~~ll~~~g~~v~~s~Di~gve  281 (465)
                      +     +.+++|+++++.+|.  .+++++||||||.|++++.|+.++++ .+.+.+++++++|++.+|++|+++|++|+|
T Consensus       111 ~-----t~~l~seii~e~l~~--~~~~vLSGPs~A~EVa~g~pta~~vas~d~~~a~~v~~~f~~~~Frvy~~~Dv~Gve  183 (329)
T COG0240         111 E-----TGRLLSEIIEEELPD--NPIAVLSGPSFAKEVAQGLPTAVVVASNDQEAAEKVQALFSSPYFRVYTSTDVIGVE  183 (329)
T ss_pred             C-----CcchHHHHHHHHcCC--CeEEEEECccHHHHHhcCCCcEEEEecCCHHHHHHHHHHhCCCcEEEEecCchhhhH
Confidence            7     689999999999984  35899999999999999999988765 567888999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhcccCCCcchHHHHHHHHHHHHHHHHHHhCCCcchhccC-chhhhhhccc--CchhHHHHHHHh
Q 012349          282 VMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGP-LLADTYVTLL--KGRNAWYGQELA  358 (465)
Q Consensus       282 ~~galKNviAia~Gi~~gl~~g~~n~~a~li~~~~~E~~~l~~a~G~~~~t~~g~-glgDl~~T~~--~sRN~~~G~~l~  358 (465)
                      ++||+|||+|||+||++|+++| +|++|+++++|++||.+|+.++|++|+||+|+ |+|||++||+  +||||+||..|+
T Consensus       184 igGAlKNViAIA~Gi~dGlg~G-~NakaalitrGL~Em~rlg~~lG~~~~T~~gLsGlGDLilTCts~~SRN~r~G~~lg  262 (329)
T COG0240         184 IGGALKNVIAIAAGIADGLGLG-DNAKAALITRGLAEMTRLGVALGAKPETFMGLSGLGDLILTCTSPLSRNRRFGLLLG  262 (329)
T ss_pred             HHHHHHHHHHHHHHHHHHhhcC-hhHHHHHHHhHHHHHHHHHHHhCCCcchhcccccccceeEecCCCccccHHHHHHHh
Confidence            9999999999999999999998 79999999999999999999999999999998 9999999997  699999999999


Q ss_pred             cCCChhhHhHhhcCCcccchHHHHHHHHHHHHHcCCCCCCCCCCCCCCcccCCcHHHHHHHHHhcCCCHHHHHHHHHhcc
Q 012349          359 KGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRDE  438 (465)
Q Consensus       359 ~g~~~~~~~~~~~~~~~vEG~~t~~~v~~la~~~~~~~~~~~~~~~~~~v~~~Pi~~~vy~il~~~~~~~~~~~~ll~~~  438 (465)
                      +|.++++++..+  ++++||+.|+++++++++++|+              + |||+++||+||+++.+|.+++..||.++
T Consensus       263 ~g~~~~e~l~~~--g~vvEGv~t~k~v~~la~~~~i--------------~-mPI~~~Vy~vl~~~~~~~~~~~~L~~r~  325 (329)
T COG0240         263 QGLSLDEALEEI--GQVVEGVRTAKAVYELAKKLGI--------------E-MPITEAVYRVLYEGLDPKEAIEELMGRD  325 (329)
T ss_pred             CCCCHHHHHHhc--CCeeecHHHHHHHHHHHHHcCC--------------C-CCHHHHHHHHHhCCCCHHHHHHHHhccc
Confidence            999887666443  5789999999999999999994              7 8999999999999999999999999999


Q ss_pred             cCCC
Q 012349          439 TMND  442 (465)
Q Consensus       439 ~~~~  442 (465)
                      .|.|
T Consensus       326 ~k~E  329 (329)
T COG0240         326 LKPE  329 (329)
T ss_pred             cCCC
Confidence            8876



>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF07479 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; InterPro: IPR006109 NAD-dependent glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF08484 Methyltransf_14: C-methyltransferase C-terminal domain; InterPro: IPR013691 This domain is found in bacterial C-methyltransferase proteins, often together with other methyltransferase domains such as IPR013216 from INTERPRO or IPR013217 from INTERPRO Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
1wpq_A349 Ternary Complex Of Glycerol 3-Phosphate Dehydrogena 1e-11
1x0x_A354 Co-Structure Of Homo Sapiens Glycerol-3-Phosphate D 3e-11
2pla_A349 Crystal Structure Of Human Glycerol-3-Phosphate Deh 1e-10
1x0v_A354 Crystal Structure Of Homo Sapien Glycerol-3-Phospha 3e-10
1yj8_A375 Initial Structural Analysis Of Plasmodium Falciparu 8e-10
4fgw_A391 Structure Of Glycerol-3-phosphate Dehydrogenase, Gp 3e-07
1txg_A335 Structure Of Glycerol-3-Phosphate Dehydrogenase Fro 1e-05
1z82_A335 Crystal Structure Of Glycerol-3-Phosphate Dehydroge 5e-05
3k96_A356 2.1 Angstrom Resolution Crystal Structure Of Glycer 1e-04
1evy_A366 Crystal Structure Of Leishmania Mexicana Glycerol-3 2e-04
>pdb|1WPQ|A Chain A, Ternary Complex Of Glycerol 3-Phosphate Dehydrogenase 1 With Nad And Dihydroxyactone Length = 349 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 71/293 (24%), Positives = 124/293 (42%), Gaps = 30/293 (10%) Query: 151 VTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLAKGVEAELEAVPRI 210 V ++ +A DADI+I +P ++ +++ + K P ISL KGV+ + I Sbjct: 76 VPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKAN---PTGISLIKGVDEGPNGLKLI 132 Query: 211 ITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI-CGAEKWRKPLAKFLRRPHF 269 +++I G+P+ ++ G NIASE+ ++++ I C + L + ++ P+F Sbjct: 133 ---SEVIGERLGIPMSVLM---GANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNF 186 Query: 270 TVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEE 329 + ++ T E+ G LKNV A+GAG L T K+ EM+ L Sbjct: 187 RITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNT-KAAVIRLGLMEMIAFAKLFCSG 245 Query: 330 PEKLAGPL----LADTYVTLLKGRNAWYGQELAK-GRLTLDLGDSIKGKGMIQGISAVKA 384 P A L +AD T GRN + A+ G+ L + +QG + Sbjct: 246 PVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARE 305 Query: 385 FYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILEALRD 437 Y +L L V+ P+ +YK+ P+ + L++ Sbjct: 306 LYSILQHKGL-------------VDKFPLFMAVYKVC-YEGQPVGEFIHCLQN 344
>pdb|1X0X|A Chain A, Co-Structure Of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1 Complex With Nad Length = 354 Back     alignment and structure
>pdb|2PLA|A Chain A, Crystal Structure Of Human Glycerol-3-Phosphate Dehydrogenase 1-Like Protein Length = 349 Back     alignment and structure
>pdb|1X0V|A Chain A, Crystal Structure Of Homo Sapien Glycerol-3-Phosphate Dehydrogenase 1 Length = 354 Back     alignment and structure
>pdb|1YJ8|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Glycerol-3- Phosphate Dehydrogenase Length = 375 Back     alignment and structure
>pdb|4FGW|A Chain A, Structure Of Glycerol-3-phosphate Dehydrogenase, Gpd1, From Sacharomyces Cerevisiae Length = 391 Back     alignment and structure
>pdb|1TXG|A Chain A, Structure Of Glycerol-3-Phosphate Dehydrogenase From Archaeoglobus Fulgidus Length = 335 Back     alignment and structure
>pdb|1Z82|A Chain A, Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase (Tm0378) From Thermotoga Maritima At 2.00 A Resolution Length = 335 Back     alignment and structure
>pdb|3K96|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase (Gpsa) From Coxiella Burnetii Length = 356 Back     alignment and structure
>pdb|1EVY|A Chain A, Crystal Structure Of Leishmania Mexicana Glycerol-3-phosphate Dehydrogenase Length = 366 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 9e-34
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 1e-31
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 1e-26
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 2e-19
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 5e-18
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 5e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 4e-06
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 5e-06
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 2e-04
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Length = 375 Back     alignment and structure
 Score =  129 bits (327), Expect = 9e-34
 Identities = 83/422 (19%), Positives = 146/422 (34%), Gaps = 89/422 (21%)

Query: 33  RRLMGKAEGDPLRIVGVGAGAWGSVFTAMLQD---SYGYLRDKVLIRIW-RRPGRSVDRA 88
           R L  K +  PL+I  +G+G W S  + ++     +     ++V  R+W R         
Sbjct: 11  RNLFDKLKDGPLKISILGSGNWASAISKVVGTNAKNNYLFENEV--RMWIRDE-----FV 63

Query: 89  TAEHLFEVINS-REDVLRRLIRRCAYLKYVEARLGDRTLHADEILKDGFCLNMIDTPLCP 147
             E + ++IN+  E+            KY    L    L  +                  
Sbjct: 64  NGERMVDIINNKHENT-----------KY----LKGVPLPHN------------------ 90

Query: 148 LKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERIT-VPVIISLAKGVEAELEA 206
           +   ++L   + DAD++I  +P    + V   I      +I      ISL KG   +   
Sbjct: 91  IVAHSDLASVINDADLLIFIVPCQYLESVLASIKESESIKIASHAKAISLTKGFIVKKNQ 150

Query: 207 VPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARI-CGAEKWRKPLAKFLR 265
           +      +  I+    +P      L G NIA ++  + ++ A I    +       +   
Sbjct: 151 MKLC---SNYISDFLNIPC---SALSGANIAMDVAMENFSEATIGGNDKDSLVIWQRVFD 204

Query: 266 RPHFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAAL---TNESATSKSVYFAHCT---SEM 319
            P+F +    + +  E+ G LKN+  +  G    L   TN  +       A      +EM
Sbjct: 205 LPYFKINCVNETIEVEICGALKNIITLACGFCDGLNLPTNSKS-------AIIRNGINEM 257

Query: 320 V-FITHLLAEEPEK----LAGPLLADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIK--G 372
           + F      +  E       G   AD   + L GRNA    E  K        +      
Sbjct: 258 ILFGKVFFQKFNENILLESCG--FADIITSFLAGRNAKCSAEFIKSTPKKTWEELENEIL 315

Query: 373 KGM-IQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAI 431
           KG  +QG   +K  Y ++ + +++                P+  +L+KI    E P   +
Sbjct: 316 KGQKLQGTVTLKYVYHMIKEKNMT-------------NEFPLFTVLHKISFENEDPSSLL 362

Query: 432 LE 433
             
Sbjct: 363 KT 364


>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Length = 354 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Length = 335 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Length = 356 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Length = 366 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Length = 335 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Length = 359 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Length = 404 Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Length = 358 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 100.0
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 100.0
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 100.0
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 100.0
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 100.0
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 100.0
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 100.0
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.98
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.98
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.97
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.96
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.96
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.95
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.93
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.93
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.93
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.92
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.89
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.86
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.84
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.81
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.79
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.79
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.78
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.77
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.77
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.77
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.76
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.76
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.75
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.74
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.73
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.72
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.72
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.72
4ezb_A317 Uncharacterized conserved protein; structural geno 99.72
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.72
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.71
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.71
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.7
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.7
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.69
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 99.68
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.67
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.67
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.66
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.66
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.66
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.66
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.66
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.65
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.64
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.63
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.63
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.62
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.62
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.61
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.61
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.58
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.57
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.55
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.53
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.52
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.5
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.5
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.48
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.48
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.41
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.41
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.41
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.4
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.39
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.38
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.37
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.37
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.34
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.33
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.98
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.28
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.22
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.19
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.19
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.18
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.17
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.15
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.11
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.07
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.95
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.94
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.9
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.89
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.88
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.82
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.76
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.74
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.68
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 98.63
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.63
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.61
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.56
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 98.56
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.5
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.42
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.41
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 98.4
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.39
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.39
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 98.38
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.36
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.36
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.31
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.29
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.28
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.28
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.27
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.21
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.19
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.18
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.18
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.18
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.18
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.17
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.16
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.16
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.15
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.11
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.11
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.1
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.09
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.06
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.04
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.99
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.97
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.97
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.97
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.96
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.94
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.93
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 97.93
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.88
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.87
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.87
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.87
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.86
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.86
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.85
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.83
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.83
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.83
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.81
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.81
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.81
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.8
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.79
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.79
2duw_A145 Putative COA-binding protein; ligand binding prote 97.78
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.77
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.77
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.75
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.74
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.74
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.72
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.71
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.7
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.68
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.67
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.67
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.65
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.65
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.65
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.64
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.64
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.64
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.63
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.6
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.6
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.59
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.58
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.58
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.57
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.57
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.57
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.56
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.54
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.54
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.52
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.52
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.52
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.51
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.51
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.5
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.48
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.48
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.48
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.47
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.46
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.45
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.44
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.43
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 97.42
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.42
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.39
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.35
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.35
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.35
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.35
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.32
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.31
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.31
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.29
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.29
1ydw_A362 AX110P-like protein; structural genomics, protein 97.28
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.27
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.25
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.24
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.22
4had_A350 Probable oxidoreductase protein; structural genomi 97.22
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.2
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.16
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.16
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.15
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.11
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.11
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.11
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.1
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.09
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.08
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.06
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.05
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.05
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.04
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.03
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.02
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.99
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.97
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 96.96
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 96.95
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 96.92
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.89
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 96.88
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 96.88
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.87
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.83
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.81
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.79
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.76
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.73
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.72
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.71
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.7
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 96.64
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.63
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.63
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 96.61
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.55
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.48
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.48
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.44
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 96.44
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.43
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 96.41
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.41
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.41
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.4
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.38
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.37
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.35
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.33
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 96.3
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.29
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.28
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.26
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.25
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.24
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 96.23
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.22
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.21
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.21
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.2
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.18
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.17
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 96.17
3btv_A438 Galactose/lactose metabolism regulatory protein GA 96.16
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.16
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.09
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.09
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.07
3oqb_A383 Oxidoreductase; structural genomics, protein struc 96.04
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.03
4h3v_A390 Oxidoreductase domain protein; structural genomics 96.0
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 95.99
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 95.95
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 95.93
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 95.87
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 95.83
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.8
3h2z_A382 Mannitol-1-phosphate 5-dehydrogenase; PSI- protein 95.79
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 95.76
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.68
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 95.67
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 95.66
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.65
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.61
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.6
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.59
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 95.58
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.57
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.53
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 95.5
4hb9_A412 Similarities with probable monooxygenase; flavin, 95.5
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.47
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.45
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 95.42
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 95.38
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.37
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 95.31
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.22
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.13
1lnq_A336 MTHK channels, potassium channel related protein; 95.11
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.04
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 95.04
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 95.02
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.92
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.91
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.82
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 94.79
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 94.73
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 94.61
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.57
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 94.41
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 94.41
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 94.27
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 94.27
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.24
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 94.22
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 94.14
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 94.12
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.06
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.02
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 93.98
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 93.97
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 93.91
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 93.82
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.81
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 93.79
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 93.74
2csu_A457 457AA long hypothetical protein; structural genomi 93.67
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 93.67
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 93.66
2ywl_A180 Thioredoxin reductase related protein; uncharacter 93.66
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.58
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 93.57
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 93.56
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 93.54
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 93.54
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.53
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 93.53
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 93.52
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 93.52
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.51
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 93.5
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 93.49
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 93.46
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.43
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 93.29
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.13
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 93.09
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 93.01
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 92.99
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 92.86
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 92.86
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 92.76
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 92.71
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.63
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 92.49
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 92.46
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 92.37
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 92.35
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 92.3
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 92.29
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 92.25
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 92.17
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 92.15
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 92.14
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 92.09
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.08
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 92.07
3dme_A369 Conserved exported protein; structural genomics, P 92.05
3p2o_A285 Bifunctional protein fold; structural genomics, ce 91.99
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 91.98
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 91.97
3l07_A285 Bifunctional protein fold; structural genomics, ID 91.81
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 91.78
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 91.7
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 91.69
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 91.63
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 91.62
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 91.6
3slg_A372 PBGP3 protein; structural genomics, seattle struct 91.6
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 91.55
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 91.5
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 91.5
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 91.36
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 91.35
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 91.32
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 91.32
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 91.26
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 91.25
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 91.13
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 91.08
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 91.07
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 91.02
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 90.99
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 90.99
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 90.98
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 90.96
2bry_A497 NEDD9 interacting protein with calponin homology a 90.94
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 90.91
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 90.84
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 90.84
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 90.8
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 90.77
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 90.73
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 90.7
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 90.68
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 90.65
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 90.54
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 90.36
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 90.34
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 90.34
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 90.23
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 90.22
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 90.16
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 90.15
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 90.1
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 90.03
3rih_A293 Short chain dehydrogenase or reductase; structural 89.93
3r9u_A315 Thioredoxin reductase; structural genomics, center 89.92
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.83
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 89.81
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 89.81
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 89.72
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 89.65
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 89.63
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 89.58
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 89.45
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 89.08
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 89.08
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 89.08
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 88.97
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 88.89
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 88.88
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 88.83
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 88.81
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 88.8
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 88.78
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 88.74
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 88.72
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 88.66
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 88.47
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 88.47
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 88.37
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 88.33
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 88.32
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 88.3
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 88.3
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 88.25
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 88.24
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 88.21
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 88.21
4eso_A255 Putative oxidoreductase; NADP, structural genomics 88.18
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 88.14
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 88.09
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 88.02
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 87.99
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 87.95
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 87.94
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 87.93
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 87.92
1xhl_A297 Short-chain dehydrogenase/reductase family member 87.81
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 87.55
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 87.54
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 87.54
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 87.46
3tjr_A301 Short chain dehydrogenase; structural genomics, se 87.38
3cxt_A291 Dehydrogenase with different specificities; rossma 87.34
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 87.27
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 87.24
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 87.23
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 87.22
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 87.21
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 87.21
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 87.17
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 87.12
2cul_A232 Glucose-inhibited division protein A-related PROT 87.06
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 87.05
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 86.91
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 86.85
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 86.8
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 86.74
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2.1e-68  Score=550.73  Aligned_cols=340  Identities=21%  Similarity=0.290  Sum_probs=285.6

Q ss_pred             CCCceEEEECccHHHHHHHHHHHHhcCC-C--CCCeeEEEEecCchhhhhhhhhhhHHHHhchhhhHHhhhhcccccchh
Q 012349           41 GDPLRIVGVGAGAWGSVFTAMLQDSYGY-L--RDKVLIRIWRRPGRSVDRATAEHLFEVINSREDVLRRLIRRCAYLKYV  117 (465)
Q Consensus        41 ~~~mkIaIIGaGamGsalA~~La~~~G~-~--~~~~~V~l~~r~~~~~~~i~~~~l~~~i~~~~~~~~~~~~n~~~l~~~  117 (465)
                      .++.||+|||+|+||||||..|+++ |. .  ...++|++|.|+++...    +.+.+.|++.+       +|++|||++
T Consensus        32 ~~p~KI~ViGaGsWGTALA~~la~n-g~~~~~~~~~~V~lw~r~~e~~~----~~~~e~in~~~-------~N~~YLpgv   99 (391)
T 4fgw_A           32 EKPFKVTVIGSGNWGTTIAKVVAEN-CKGYPEVFAPIVQMWVFEEEING----EKLTEIINTRH-------QNVKYLPGI   99 (391)
T ss_dssp             -CCEEEEEECCSHHHHHHHHHHHHH-HHHCTTTEEEEEEEECCCCBSSS----CBHHHHHTTTC-------CBTTTBTTC
T ss_pred             CCCCeEEEECcCHHHHHHHHHHHHc-CCCccccCCceEEEEEcchHhhh----HHHHHHHHhcC-------cCcccCCCC
Confidence            3467999999999999999999998 50 0  00025999999986432    34566677765       599999976


Q ss_pred             hhhhcCCcccchhhhhccccccCCCCCCCCeEEecCHHHHhcCCCEEEEecCcchHHHHHHHHHHhhhccCCCCEEEEee
Q 012349          118 EARLGDRTLHADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTETKEVFEEISRYWKERITVPVIISLA  197 (465)
Q Consensus       118 ~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~i~~t~dl~eal~~aDiVIlaVps~~l~~vl~~l~~~l~~~~~~~ivIs~~  197 (465)
                             .||                  .++.+++|++++++++|+||++||+++++++++++++++++   +.++|+++
T Consensus       100 -------~Lp------------------~~i~~t~dl~~al~~ad~ii~avPs~~~r~~l~~l~~~~~~---~~~iv~~~  151 (391)
T 4fgw_A          100 -------TLP------------------DNLVANPDLIDSVKDVDIIVFNIPHQFLPRICSQLKGHVDS---HVRAISCL  151 (391)
T ss_dssp             -------CCC------------------SSEEEESCHHHHHTTCSEEEECSCGGGHHHHHHHHTTTSCT---TCEEEECC
T ss_pred             -------cCC------------------CCcEEeCCHHHHHhcCCEEEEECChhhhHHHHHHhccccCC---CceeEEec
Confidence                   232                  26899999999999999999999999999999999999887   78999999


Q ss_pred             ccccccccccccCCCHHHHHHhHhCCCCccEEEEeCCchhhhhhccCceEEEEeC-C---------hhHHHHHHHHHcCC
Q 012349          198 KGVEAELEAVPRIITPTQMINRATGVPIENILYLGGPNIASEIYNKEYANARICG-A---------EKWRKPLAKFLRRP  267 (465)
Q Consensus       198 kGi~~~~~~~~~~~~~se~I~e~lg~~~~~i~vlsGP~~a~ev~~g~~t~~~~~~-~---------~~~~~~l~~ll~~~  267 (465)
                      ||++..+.   ..+++++++.+.++.   ++++++|||||.|++.+.|+.+++++ +         +...+.++++|+++
T Consensus       152 KGie~~~~---~~~~~se~i~e~~~~---~~~vLsGPs~A~EVa~~~pta~~iA~~~~~~~~~~~~~~~a~~~~~lf~~~  225 (391)
T 4fgw_A          152 KGFEVGAK---GVQLLSSYITEELGI---QCGALSGANIATEVAQEHWSETTVAYHIPKDFRGEGKDVDHKVLKALFHRP  225 (391)
T ss_dssp             CSCEEETT---EEECHHHHHHHHHCC---EEEEEECSCCHHHHHTTCCEEEEEECCCCTTCCCSSSSCCHHHHHHHHCBT
T ss_pred             cccccccc---cchhHHHHHHHHhCc---cceeccCCchHHHhhcCCCceEEEEecChhhhhhhhHHHHHHHHHHHhCCC
Confidence            99987631   347899999998873   57899999999999999999887643 2         12468899999999


Q ss_pred             CCeEEecCChHHHHHHHHHHHHHHHHHHhhhcccCCCcchHHHHHHHHHHHHHHHHHHh---CCCcchhccC-chhhhhh
Q 012349          268 HFTVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLL---AEEPEKLAGP-LLADTYV  343 (465)
Q Consensus       268 g~~v~~s~Di~gve~~galKNviAia~Gi~~gl~~g~~n~~a~li~~~~~E~~~l~~a~---G~~~~t~~g~-glgDl~~  343 (465)
                      +|++|.++|++|+|+|||+|||||||+||++|+++| +|++|+||++|++||.+|+.++   |.++.||.|+ |+|||++
T Consensus       226 ~frvy~s~DviGvElgGAlKNViAIAaGi~dGlg~G-~NakAALitrGl~Em~rlg~al~~~g~~~tt~~glaGlGDLi~  304 (391)
T 4fgw_A          226 YFHVSVIEDVAGISICGALKNVVALGCGFVEGLGWG-NNASAAIQRVGLGEIIRFGQMFFPESREETYYQESAGVADLIT  304 (391)
T ss_dssp             TEEEEEESCHHHHHHHHHHHHHHHHHHHHHHHTTCH-HHHHHHHHHHHHHHHHHHHHHHSTTCCHHHHHHSTTTHHHHHH
T ss_pred             CEEEEEeCCccceehHHHHHHHHHHHHHHHhcCCCC-CCHHHHHHHHHHHHHHHHHHHHhcccCCceeecCCCcccceeE
Confidence            999999999999999999999999999999999997 7999999999999999999999   4456678887 9999999


Q ss_pred             cccCchhHHHHHHHhc-CCChhhHhHhhcCCcccchHHHHHHHHHHHHHcCCCCCCCCCCCCCCcccCCcHHHHHHHHHh
Q 012349          344 TLLKGRNAWYGQELAK-GRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILI  422 (465)
Q Consensus       344 T~~~sRN~~~G~~l~~-g~~~~~~~~~~~~~~~vEG~~t~~~v~~la~~~~~~~~~~~~~~~~~~v~~~Pi~~~vy~il~  422 (465)
                      ||+.||||+||+.|++ |++.+++++++.+++++||+.|+++++++++++|+.            .+ |||+++||+|||
T Consensus       305 Tc~sSRNr~~G~~lg~~G~~~~~~~~~~~~g~v~EGv~ta~~v~~l~~~~~v~------------~e-mPI~~~vy~IL~  371 (391)
T 4fgw_A          305 TCAGGRNVKVARLMATSGKDAWECEKELLNGQSAQGLITCKEVHEWLETCGSV------------ED-FPLFEAVYQIVY  371 (391)
T ss_dssp             HHHSSHHHHHHHHHHHTCCCHHHHHHHHHTTCCCTHHHHHHHHHHHHHHHTCS------------TT-CHHHHHHHHHHH
T ss_pred             EecCCccHHHHHHHHhcCCCHHHHHHHHhCCCEEehHHHHHHHHHHHHHcCCC------------CC-CCHHHHHHHHHh
Confidence            9988999999999996 899988888776667999999999999999999952            25 899999999999


Q ss_pred             cCCCHHHHHHHHHhcccC
Q 012349          423 MRESPIQAILEALRDETM  440 (465)
Q Consensus       423 ~~~~~~~~~~~ll~~~~~  440 (465)
                      ++.+|.+....++++..+
T Consensus       372 ~~~~~~~~~~~l~~~~~~  389 (391)
T 4fgw_A          372 NNYPMKNLPDMIEELDLH  389 (391)
T ss_dssp             SCCCSTTHHHHHCC----
T ss_pred             CCCCHHHHHHHHHhcccC
Confidence            998776655444443433



>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI- protein structure initiative, structural genomics, midwest for structural genomics (MCSG); 1.90A {Shigella flexneri 2a str} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 465
d1txga1155 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydro 6e-15
d1n1ea1160 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydro 5e-13
d1n1ea2189 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogen 4e-06
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 3e-04
d1txga2180 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogen 0.004
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 155 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Glycerol-3-phosphate dehydrogenase
domain: Glycerol-3-phosphate dehydrogenase
species: Archaeoglobus fulgidus [TaxId: 2234]
 Score = 69.7 bits (170), Expect = 6e-15
 Identities = 35/165 (21%), Positives = 63/165 (38%), Gaps = 22/165 (13%)

Query: 276 DLVTHEVMGGLKNVYAIGAGMVAAL----TNESATSKSVYFAHCTSEMVFITHLLAEEPE 331
           D++  E+   LKNVY+I    +         E + +K V      +EM  +  +L  + E
Sbjct: 1   DIIGTEITSALKNVYSIAIAWIRGYESRKNVEMSNAKGVIATRAINEMAELIEILGGDRE 60

Query: 332 KLAGPL-LADTYVTLLKGRNAWYGQELAKGRLTLDLGDSIK--GKGMIQGISAVKAFYEL 388
              G     D   T   GRN   G+ L KG    +  + ++  G G+++G    +  Y L
Sbjct: 61  TAFGLSGFGDLIATFRGGRNGMLGELLGKGLSIDEAMEELERRGVGVVEGYKTAEKAYRL 120

Query: 389 LSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAILE 433
            S+ +                   +L  +Y++L       + + E
Sbjct: 121 SSKINADT---------------KLLDSIYRVLYEGLKVEEVLFE 150


>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 160 Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 189 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
d1n1ea1160 Glycerol-3-phosphate dehydrogenase {Trypanosome (L 100.0
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 100.0
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.97
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.95
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.68
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.66
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.64
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.61
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.52
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 99.5
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.38
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.31
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.29
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.29
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.23
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.19
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.11
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.09
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 99.07
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.07
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.01
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.97
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.63
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.55
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.52
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.49
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.49
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 98.47
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.43
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.39
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.37
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.36
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.3
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.3
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.26
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.21
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.11
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.07
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 98.01
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.95
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.95
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 97.94
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.92
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.89
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.88
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.83
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.82
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.82
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.76
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.7
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.61
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.59
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.52
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.52
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.38
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.37
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.36
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.31
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.26
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.25
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.21
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.14
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.13
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.12
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.11
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.11
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.1
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 96.99
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.99
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.95
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.94
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 96.91
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.87
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.59
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.56
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.56
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.55
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.5
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.49
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.48
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.43
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.26
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.19
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.05
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.99
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.98
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.96
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.95
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.9
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 95.89
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.86
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.85
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.77
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 95.76
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 95.75
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.7
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.68
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.64
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.58
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.5
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.46
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.46
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.46
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.43
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 95.38
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.31
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.14
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.12
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.12
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.07
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.07
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.06
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.03
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.98
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.95
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.94
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.91
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 94.87
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.86
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.8
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.75
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.75
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.74
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.7
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.64
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.63
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.59
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.4
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.38
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.21
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.18
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 94.0
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.96
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 93.86
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 93.65
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.49
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 93.48
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.48
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.48
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.45
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.44
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.26
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.26
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.02
d1yova1529 Amyloid beta precursor protein-binding protein 1, 92.92
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.66
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.65
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 92.43
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 92.07
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.07
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.84
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 91.71
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 91.31
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 91.3
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 90.77
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 90.65
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.6
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 90.57
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 90.47
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 90.33
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.32
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.27
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.21
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 90.16
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 90.12
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 89.75
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 89.67
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 89.36
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.29
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 89.21
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 89.12
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.04
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 89.04
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 89.0
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 88.97
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 88.81
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.81
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 88.78
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.49
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 88.18
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.01
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 87.94
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 87.82
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.76
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 87.31
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.0
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.84
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 86.65
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 86.59
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 86.48
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 86.17
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.96
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 85.91
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 85.25
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 85.07
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 84.98
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 84.56
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 84.42
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 84.07
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 83.91
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 83.89
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 83.81
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 83.5
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 83.48
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 83.44
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 83.21
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.13
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 83.11
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 83.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 82.93
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 82.9
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 82.85
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 82.83
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 82.81
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.77
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.67
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 82.63
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 82.4
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 82.34
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 82.28
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 82.13
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.12
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 82.1
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 81.91
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 81.46
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 81.35
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 81.19
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 81.09
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 80.9
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 80.86
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 80.79
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 80.63
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 80.62
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 80.52
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 80.39
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 80.19
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 80.07
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 80.07
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 80.06
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 80.01
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Glycerol-3-phosphate dehydrogenase
domain: Glycerol-3-phosphate dehydrogenase
species: Trypanosome (Leishmania mexicana) [TaxId: 5665]
Probab=100.00  E-value=9.3e-36  Score=270.22  Aligned_cols=152  Identities=23%  Similarity=0.321  Sum_probs=142.2

Q ss_pred             CChHHHHHHHHHHHHHHHHHHhhhcccCCCcchHHHHHHHHHHHHHHHHHHhCCCcchhccC-chhhhhhccc--CchhH
Q 012349          275 GDLVTHEVMGGLKNVYAIGAGMVAALTNESATSKSVYFAHCTSEMVFITHLLAEEPEKLAGP-LLADTYVTLL--KGRNA  351 (465)
Q Consensus       275 ~Di~gve~~galKNviAia~Gi~~gl~~g~~n~~a~li~~~~~E~~~l~~a~G~~~~t~~g~-glgDl~~T~~--~sRN~  351 (465)
                      +|++|+|+||++||||||++|+++|+++| +|++|++++++++||.++++++|++++|+.++ |+|||++||+  .||||
T Consensus         1 tD~~GvE~~galKNi~Aia~Gi~~gl~~g-~N~~aali~~g~~Em~~~~~~~g~~~~t~~~laGlGDli~Tc~s~~sRN~   79 (160)
T d1n1ea1           1 TDTVGCEVASAVKNVLAIGSGVANGLGMG-LNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNF   79 (160)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHTTCC-HHHHHHHHHHHHHHHHHHHHHTTCCSTTTTSTTTHHHHHHHTTCTTSHHH
T ss_pred             CCchhHHHHHHHHHHHHHHHHHHHHcCCC-hhHHHHHHHHHHHHHHHHHHHhCCCccceeccccchhheeeeecchhHHH
Confidence            69999999999999999999999999997 79999999999999999999999999999996 9999999996  79999


Q ss_pred             HHHHHHhcCCChhhHhHhhcCCcccchHHHHHHHHHHHHHcCCCCCCCCCCCCCCcccCCcHHHHHHHHHhcCCCHHHHH
Q 012349          352 WYGQELAKGRLTLDLGDSIKGKGMIQGISAVKAFYELLSQSSLSVLHPEENKPVATVELCPILKMLYKILIMRESPIQAI  431 (465)
Q Consensus       352 ~~G~~l~~g~~~~~~~~~~~~~~~vEG~~t~~~v~~la~~~~~~~~~~~~~~~~~~v~~~Pi~~~vy~il~~~~~~~~~~  431 (465)
                      +||+.+++|.+.+++++.  .++++||+.|++.++++++++++              + +||+++||+||+++.+|.+++
T Consensus        80 ~~G~~l~~g~~~~e~~~~--~~~~vEG~~t~~~v~~l~~~~~i--------------~-~Pi~~~vy~Il~~~~~p~~~i  142 (160)
T d1n1ea1          80 TVGKKLGKGLPIEEIQRT--SKAVAEGVATADPLMRLAKQLKV--------------K-MPLCHQIYEIVYKKKNPRDAL  142 (160)
T ss_dssp             HHHHHHHHTCCHHHHHHS--CCSCCHHHHHHHHHHHHHHHHTC--------------C-CHHHHHHHHHHHSCCCHHHHH
T ss_pred             HHHHHHhccccHHHHHHh--ccchHHHHHHHHHHHHHHHHcCC--------------C-CcHHHHHHHHHhCcCCHHHHH
Confidence            999999999998887653  34689999999999999999994              6 899999999999999999999


Q ss_pred             HHHHhcccCCCcc
Q 012349          432 LEALRDETMNDPR  444 (465)
Q Consensus       432 ~~ll~~~~~~~~~  444 (465)
                      ..||.++.+.|.-
T Consensus       143 ~~Lm~r~~k~E~~  155 (160)
T d1n1ea1         143 ADLLSCGLQDEGL  155 (160)
T ss_dssp             HHHTTSCSCBCCC
T ss_pred             HHHHCCCCCCCCC
Confidence            9999999988753



>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure