Citrus Sinensis ID: 012504


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--
MISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKETAA
cccHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHccccccccEEEHHHHHHHHHccccccHHHHHHHHHHHcccccccEEHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHHccccccccHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEcccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEccccc
MISRHIETLIQLSKTVHHLHQLHTLFLktsldhntciISRFILTSLSISLHFTRSLfnnlpvtpplfAYNTLIRAYAKTSCSIESIKLFDEMLktglrpdnftypFVVKACGRClligiggsVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVfeempvrdvvSWSSMIAGfvacdspsdALKVFHRMklanespnsVTLVSLVSACTSLInvragesiHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIqtglkpdsiSFSAILSACshlglvdegKNYFDEMARVynikptmehYGCMVDMLGRAGLIEEAYHIIrnmptepnAVILRSFLGACrnhgqvlyldDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQkglnkvpgcswvkvndgsaeemsketaa
MISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINqkglnkvpgcswvkvndgsaeemsketaa
MISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVlylddnlgklllklepelgANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKETAA
*****IETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKV**************
**SRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKE***
MISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVND************
*ISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKETAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query462 2.2.26 [Sep-21-2011]
Q9FJY7 620 Pentatricopeptide repeat- yes no 0.958 0.714 0.351 2e-84
Q9FI80 646 Pentatricopeptide repeat- no no 0.958 0.685 0.342 9e-83
Q9ZQA1501 Pentatricopeptide repeat- no no 0.941 0.868 0.382 1e-82
A8MQA3 595 Pentatricopeptide repeat- no no 0.952 0.739 0.366 4e-82
Q9LN01 741 Pentatricopeptide repeat- no no 0.852 0.531 0.389 9e-81
Q9C6T2 606 Pentatricopeptide repeat- no no 0.976 0.744 0.359 1e-80
Q9STF3 657 Pentatricopeptide repeat- no no 0.924 0.649 0.364 2e-77
Q9LW63 715 Putative pentatricopeptid no no 0.854 0.552 0.355 2e-77
Q9FG16 622 Pentatricopeptide repeat- no no 0.950 0.705 0.333 2e-77
Q9SN85 591 Pentatricopeptide repeat- no no 0.971 0.759 0.357 3e-77
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function desciption
 Score =  313 bits (802), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/481 (35%), Positives = 277/481 (57%), Gaps = 38/481 (7%)

Query: 10  IQLSKTVHHLHQLHTLFLKTSLDHNTCIISRF----ILTSLSISLHFTRSLFNNLPVTPP 65
           +Q       L Q+H   LKT L  ++  I++F    I ++ S  L + + +F+     P 
Sbjct: 21  LQRCSKQEELKQIHARMLKTGLMQDSYAITKFLSFCISSTSSDFLPYAQIVFDGFD-RPD 79

Query: 66  LFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHS 125
            F +N +IR ++ +     S+ L+  ML +    + +T+P ++KAC           +H+
Sbjct: 80  TFLWNLMIRGFSCSDEPERSLLLYQRMLCSSAPHNAYTFPSLLKACSNLSAFEETTQIHA 139

Query: 126 LIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSM------------ 173
            I K+G ++D Y  N+L+  YA      +A  +F+ +P  D VSW+S+            
Sbjct: 140 QITKLGYENDVYAVNSLINSYAVTGNFKLAHLLFDRIPEPDDVSWNSVIKGYVKAGKMDI 199

Query: 174 -------------------IAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTS 214
                              I+G+V  D   +AL++FH M+ ++  P++V+L + +SAC  
Sbjct: 200 ALTLFRKMAEKNAISWTTMISGYVQADMNKEALQLFHEMQNSDVEPDNVSLANALSACAQ 259

Query: 215 LINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIM 274
           L  +  G+ IHSY     + +D  LG  L++MY+KCG +E+A +VF  +++K++Q+WT +
Sbjct: 260 LGALEQGKWIHSYLNKTRIRMDSVLGCVLIDMYAKCGEMEEALEVFKNIKKKSVQAWTAL 319

Query: 275 ISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYN 334
           ISG A +G G  AIS F +M + G+KP+ I+F+A+L+ACS+ GLV+EGK  F  M R YN
Sbjct: 320 ISGYAYHGHGREAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYN 379

Query: 335 IKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNL 394
           +KPT+EHYGC+VD+LGRAGL++EA   I+ MP +PNAVI  + L ACR H  +  L + +
Sbjct: 380 LKPTIEHYGCIVDLLGRAGLLDEAKRFIQEMPLKPNAVIWGALLKACRIHKNI-ELGEEI 438

Query: 395 GKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAE 454
           G++L+ ++P  G  YV  A++ ++   WD AAE    + ++G+ KVPGCS + + +G+  
Sbjct: 439 GEILIAIDPYHGGRYVHKANIHAMDKKWDKAAETRRLMKEQGVAKVPGCSTISL-EGTTH 497

Query: 455 E 455
           E
Sbjct: 498 E 498





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQA1|PP188_ARATH Pentatricopeptide repeat-containing protein At2g36730 OS=Arabidopsis thaliana GN=PCMP-E44 PE=3 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protein At1g31920 OS=Arabidopsis thaliana GN=PCMP-H11 PE=2 SV=1 Back     alignment and function description
>sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32 PE=3 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN85|PP267_ARATH Pentatricopeptide repeat-containing protein At3g47530 OS=Arabidopsis thaliana GN=PCMP-H76 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query462
225435652461 PREDICTED: pentatricopeptide repeat-cont 0.991 0.993 0.648 1e-180
356528208444 PREDICTED: pentatricopeptide repeat-cont 0.956 0.995 0.613 1e-154
297746423430 unnamed protein product [Vitis vinifera] 0.766 0.823 0.692 1e-149
449442178 606 PREDICTED: pentatricopeptide repeat-cont 0.954 0.727 0.390 8e-94
356562016 705 PREDICTED: pentatricopeptide repeat-cont 0.928 0.608 0.391 2e-92
225425100 622 PREDICTED: pentatricopeptide repeat-cont 0.961 0.713 0.376 5e-92
297740547506 unnamed protein product [Vitis vinifera] 0.965 0.881 0.367 7e-92
296088765 595 unnamed protein product [Vitis vinifera] 0.965 0.749 0.375 1e-91
147832325 622 hypothetical protein VITISV_030261 [Viti 0.961 0.713 0.376 2e-91
225435834 576 PREDICTED: pentatricopeptide repeat-cont 0.956 0.767 0.367 8e-91
>gi|225435652|ref|XP_002283361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  637 bits (1644), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 297/458 (64%), Positives = 371/458 (81%)

Query: 2   ISRHIETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSISLHFTRSLFNNLP 61
           +SR I+ L+Q SKT  HL QLH+L LKT+ DHN  +IS+FI +  S+S+ F R +F+ LP
Sbjct: 1   MSRQIQILLQRSKTTTHLLQLHSLILKTAKDHNPDLISQFIFSISSVSIEFARLVFDRLP 60

Query: 62  VTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGG 121
           +  P+FA+N++IRAY K+S  IE++KLF +M + GL+PDNFTYPFVVKACGR L++G GG
Sbjct: 61  IRAPIFAWNSIIRAYTKSSVPIEAVKLFSQMQRVGLKPDNFTYPFVVKACGRSLVVGAGG 120

Query: 122 SVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACD 181
           ++HS+I K G DSD+Y+GNTLLRMYA    + +A+ VF EM VRDVVSWSSMIAG+VAC+
Sbjct: 121 AMHSIIVKAGFDSDRYVGNTLLRMYANLNAVGLARRVFNEMTVRDVVSWSSMIAGYVACN 180

Query: 182 SPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGT 241
             +DAL VF  M LANE PNSVTLVSL+SACT L+N+  GESIHSY +VN + LDVALGT
Sbjct: 181 CQADALMVFRHMMLANEKPNSVTLVSLLSACTRLLNIGVGESIHSYIIVNCIGLDVALGT 240

Query: 242 ALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKP 301
           A++EMYSKCGH+EKA KVFN + EKNLQSWTIMISGLAD+  G  AISLF +M QTGL+P
Sbjct: 241 AILEMYSKCGHIEKALKVFNSLTEKNLQSWTIMISGLADHSHGEDAISLFTQMEQTGLQP 300

Query: 302 DSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHI 361
           DS+SFS ILSACSHLGLVDEG+ +F +M ++YNI+PTMEHYGCMVDM  RAG+IEEAY I
Sbjct: 301 DSMSFSEILSACSHLGLVDEGQTFFSQMVKIYNIRPTMEHYGCMVDMFARAGMIEEAYEI 360

Query: 362 IRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGN 421
           I+NMP EPN+VILRSF+GACRN G+V   D+NL +LLL++EP+LGANYVLA+ VSSLSG 
Sbjct: 361 IKNMPMEPNSVILRSFIGACRNDGRVFGFDENLRRLLLEIEPDLGANYVLASGVSSLSGC 420

Query: 422 WDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKE 459
           W+ AA+L V++ +KGL KVPG S V+V+    EE  +E
Sbjct: 421 WNEAADLRVSMKEKGLKKVPGWSRVEVSGSHTEETIEE 458




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356528208|ref|XP_003532697.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Back     alignment and taxonomy information
>gi|297746423|emb|CBI16479.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442178|ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] gi|449529652|ref|XP_004171812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356562016|ref|XP_003549271.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Back     alignment and taxonomy information
>gi|225425100|ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740547|emb|CBI30729.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088765|emb|CBI38215.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147832325|emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225435834|ref|XP_002283791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query462
TAIR|locus:2034456 606 AT1G31920 [Arabidopsis thalian 0.971 0.740 0.347 9.3e-75
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.852 0.531 0.374 8.4e-74
TAIR|locus:4010713895 595 AT4G21065 "AT4G21065" [Arabido 0.941 0.731 0.358 2.2e-73
TAIR|locus:2040565501 AT2G36730 [Arabidopsis thalian 0.965 0.890 0.366 9.6e-73
TAIR|locus:2079187 591 AT3G47530 "AT3G47530" [Arabido 0.965 0.754 0.357 2.9e-71
TAIR|locus:2056740 603 OTP85 "ORGANELLE TRANSCRIPT PR 0.952 0.729 0.316 1.8e-69
TAIR|locus:2057574 583 AT2G33760 [Arabidopsis thalian 0.956 0.758 0.320 6.3e-69
TAIR|locus:2121055559 AT4G38010 "AT4G38010" [Arabido 0.839 0.694 0.350 8e-69
TAIR|locus:2025946 638 CRR28 "CHLORORESPIRATORY REDUC 0.984 0.713 0.338 1e-68
TAIR|locus:2103483 890 OTP84 "ORGANELLE TRANSCRIPT PR 0.926 0.480 0.346 1.3e-68
TAIR|locus:2034456 AT1G31920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 754 (270.5 bits), Expect = 9.3e-75, P = 9.3e-75
 Identities = 159/457 (34%), Positives = 259/457 (56%)

Query:     9 LIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFILTSLSIS-----LHFTRSLFNNLPVT 63
             L++    +    Q+H  F+K SL +++   +  +L   + S     +++  S+F  +   
Sbjct:    36 LLKRCHNIDEFKQVHARFIKLSLFYSSSFSASSVLAKCAHSGWENSMNYAASIFRGID-D 94

Query:    64 PPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSV 123
             P  F +NT+IR Y       E++  ++EM++ G  PDNFTYP ++KAC R   I  G  +
Sbjct:    95 PCTFDFNTMIRGYVNVMSFEEALCFYNEMMQRGNEPDNFTYPCLLKACTRLKSIREGKQI 154

Query:   124 HSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSP 183
             H  +FK+GL++D ++ N+L+ MY  C E++++ AVFE++  +   SWSSM++        
Sbjct:   155 HGQVFKLGLEADVFVQNSLINMYGRCGEMELSSAVFEKLESKTAASWSSMVSARAGMGMW 214

Query:   184 SDALKVFHRM-KLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTA 242
             S+ L +F  M    N       +VS + AC +   +  G SIH + + N  EL++ + T+
Sbjct:   215 SECLLLFRGMCSETNLKAEESGMVSALLACANTGALNLGMSIHGFLLRNISELNIIVQTS 274

Query:   243 LVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPD 302
             LV+MY KCG ++KA  +F  M ++N  +++ MISGLA +G G  A+ +F+KMI+ GL+PD
Sbjct:   275 LVDMYVKCGCLDKALHIFQKMEKRNNLTYSAMISGLALHGEGESALRMFSKMIKEGLEPD 334

Query:   303 SISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHII 362
              + + ++L+ACSH GLV EG+  F EM +   ++PT EHYGC+VD+LGRAGL+EEA   I
Sbjct:   335 HVVYVSVLNACSHSGLVKEGRRVFAEMLKEGKVEPTAEHYGCLVDLLGRAGLLEEALETI 394

Query:   363 RNMPTEPNAVILRSFLGACRNHGQVXXXXXXXXXXXXXXXXXXXANYVLAASVSSLSGNW 422
             +++P E N VI R+FL  CR    +                    +Y+L +++ S    W
Sbjct:   395 QSIPIEKNDVIWRTFLSQCRVRQNIELGQIAAQELLKLSSHNP-GDYLLISNLYSQGQMW 453

Query:   423 DTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKE 459
             D  A     I  KGL + PG S V++   +   +S++
Sbjct:   454 DDVARTRTEIAIKGLKQTPGFSIVELKGKTHRFVSQD 490




GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0010075 "regulation of meristem growth" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040565 AT2G36730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079187 AT3G47530 "AT3G47530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056740 OTP85 "ORGANELLE TRANSCRIPT PROCESSING 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057574 AT2G33760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121055 AT4G38010 "AT4G38010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025946 CRR28 "CHLORORESPIRATORY REDUCTION28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-92
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-83
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-61
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-42
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-30
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-15
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-13
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 7e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.003
pfam0153531 pfam01535, PPR, PPR repeat 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  297 bits (762), Expect = 3e-92
 Identities = 143/429 (33%), Positives = 240/429 (55%), Gaps = 5/429 (1%)

Query: 21  QLHTLFLKTSLDHNTCIISRFILTSLSI-SLHFTRSLFNNLPVTPPLFAYNTLIRAYAKT 79
           ++H   +KT    +  + +  I   LS+ S      +F+ +  T    ++  +I  Y K 
Sbjct: 309 EMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME-TKDAVSWTAMISGYEKN 367

Query: 80  SCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIG 139
               ++++ +  M +  + PD  T   V+ AC     + +G  +H L  + GL S   + 
Sbjct: 368 GLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVA 427

Query: 140 NTLLRMYAACKEIDVAKAVFEEMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANES 199
           N L+ MY+ CK ID A  VF  +P +DV+SW+S+IAG    +   +AL  F +M L  + 
Sbjct: 428 NALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLTLK- 486

Query: 200 PNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKV 259
           PNSVTL++ +SAC  +  +  G+ IH++ +  G+  D  L  AL+++Y +CG +  A+  
Sbjct: 487 PNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQ 546

Query: 260 FNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLV 319
           FN   EK++ SW I+++G   +G+G+ A+ LF +M+++G+ PD ++F ++L ACS  G+V
Sbjct: 547 FNS-HEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMV 605

Query: 320 DEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLG 379
            +G  YF  M   Y+I P ++HY C+VD+LGRAG + EAY+ I  MP  P+  +  + L 
Sbjct: 606 TQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLN 665

Query: 380 ACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNK 439
           ACR H  V  L +   + + +L+P     Y+L  ++ + +G WD  A +   + + GL  
Sbjct: 666 ACRIHRHVE-LGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTV 724

Query: 440 VPGCSWVKV 448
            PGCSWV+V
Sbjct: 725 DPGCSWVEV 733


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 462
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.72
KOG2003840 consensus TPR repeat-containing protein [General f 99.72
KOG2076 895 consensus RNA polymerase III transcription factor 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.7
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.66
KOG0547606 consensus Translocase of outer mitochondrial membr 99.65
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
KOG2003 840 consensus TPR repeat-containing protein [General f 99.63
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.62
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.61
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.61
KOG1126638 consensus DNA-binding cell division cycle control 99.6
KOG1915677 consensus Cell cycle control protein (crooked neck 99.6
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.59
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.57
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.55
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.55
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG2076 895 consensus RNA polymerase III transcription factor 99.52
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.5
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.45
PF1304150 PPR_2: PPR repeat family 99.38
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.38
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.38
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.37
KOG0547606 consensus Translocase of outer mitochondrial membr 99.36
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.36
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.36
PRK12370553 invasion protein regulator; Provisional 99.35
KOG1129478 consensus TPR repeat-containing protein [General f 99.35
KOG1129478 consensus TPR repeat-containing protein [General f 99.31
PF1304150 PPR_2: PPR repeat family 99.31
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.28
PRK11189296 lipoprotein NlpI; Provisional 99.27
PRK12370553 invasion protein regulator; Provisional 99.27
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.25
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.24
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.24
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.23
PRK11189296 lipoprotein NlpI; Provisional 99.21
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.18
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.18
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.13
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.12
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.1
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.1
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.08
KOG1125579 consensus TPR repeat-containing protein [General f 99.08
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.08
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.07
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.06
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.06
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.05
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.03
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.01
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.97
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.94
PRK04841 903 transcriptional regulator MalT; Provisional 98.93
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.93
PRK10370198 formate-dependent nitrite reductase complex subuni 98.88
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.87
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.86
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.85
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.81
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.8
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.8
KOG1125579 consensus TPR repeat-containing protein [General f 98.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.78
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.74
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.73
PRK15359144 type III secretion system chaperone protein SscB; 98.73
PRK04841903 transcriptional regulator MalT; Provisional 98.73
KOG1128777 consensus Uncharacterized conserved protein, conta 98.73
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.69
PRK15359144 type III secretion system chaperone protein SscB; 98.67
PLN02789320 farnesyltranstransferase 98.66
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.65
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.65
PF1285434 PPR_1: PPR repeat 98.63
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.6
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.6
PF1285434 PPR_1: PPR repeat 98.59
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.59
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.54
PLN02789320 farnesyltranstransferase 98.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.52
PRK10370198 formate-dependent nitrite reductase complex subuni 98.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.51
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.5
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.5
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.5
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.46
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.39
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.37
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.37
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.35
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.34
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.34
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.31
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.3
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.27
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.26
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.26
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.17
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.16
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.12
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.11
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.1
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.09
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.08
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.06
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.03
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.02
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.94
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.93
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.92
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.91
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.9
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.9
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.89
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.86
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.86
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.84
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.82
PF1337173 TPR_9: Tetratricopeptide repeat 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.79
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.79
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.77
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.77
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.76
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.75
PRK15331165 chaperone protein SicA; Provisional 97.73
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.72
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.72
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.7
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.7
KOG0553304 consensus TPR repeat-containing protein [General f 97.68
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.65
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.65
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.64
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.61
KOG0553304 consensus TPR repeat-containing protein [General f 97.61
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.58
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.56
COG4700251 Uncharacterized protein conserved in bacteria cont 97.55
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.55
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.54
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.52
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.52
COG4700251 Uncharacterized protein conserved in bacteria cont 97.5
COG3898531 Uncharacterized membrane-bound protein [Function u 97.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.49
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.48
PRK10803263 tol-pal system protein YbgF; Provisional 97.47
PF12688120 TPR_5: Tetratrico peptide repeat 97.47
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.45
KOG20411189 consensus WD40 repeat protein [General function pr 97.43
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.43
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.43
PF12688120 TPR_5: Tetratrico peptide repeat 97.42
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.38
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.33
PF1343134 TPR_17: Tetratricopeptide repeat 97.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.3
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.23
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.16
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.1
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.09
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.09
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.08
PF1342844 TPR_14: Tetratricopeptide repeat 97.0
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.98
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.97
PRK10803263 tol-pal system protein YbgF; Provisional 96.96
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.94
PF1337173 TPR_9: Tetratricopeptide repeat 96.91
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.87
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.86
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.8
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.77
PF13512142 TPR_18: Tetratricopeptide repeat 96.69
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.66
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.61
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.6
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.45
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.44
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.44
PRK11906458 transcriptional regulator; Provisional 96.39
KOG20411189 consensus WD40 repeat protein [General function pr 96.36
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.33
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.31
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.24
PRK15331165 chaperone protein SicA; Provisional 96.13
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.07
PRK11619 644 lytic murein transglycosylase; Provisional 96.05
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.92
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.86
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.83
KOG3941406 consensus Intermediate in Toll signal transduction 95.83
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.81
KOG1585308 consensus Protein required for fusion of vesicles 95.79
KOG1585308 consensus Protein required for fusion of vesicles 95.76
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.7
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.69
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.5
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.39
PF13512142 TPR_18: Tetratricopeptide repeat 95.33
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.32
KOG3941406 consensus Intermediate in Toll signal transduction 95.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.18
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.18
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.1
smart00299140 CLH Clathrin heavy chain repeat homology. 95.08
PF1342844 TPR_14: Tetratricopeptide repeat 94.98
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.96
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.93
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.92
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.89
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.84
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.75
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.58
smart00299140 CLH Clathrin heavy chain repeat homology. 94.57
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.55
KOG4555175 consensus TPR repeat-containing protein [Function 94.53
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.49
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.47
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.42
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.33
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.17
COG3629280 DnrI DNA-binding transcriptional activator of the 94.1
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.08
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.04
PRK11906458 transcriptional regulator; Provisional 93.94
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.94
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.76
KOG1586288 consensus Protein required for fusion of vesicles 93.73
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.72
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.56
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.53
KOG1258 577 consensus mRNA processing protein [RNA processing 93.53
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.47
KOG4234271 consensus TPR repeat-containing protein [General f 93.44
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.39
KOG4555175 consensus TPR repeat-containing protein [Function 93.29
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.13
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.97
KOG1258577 consensus mRNA processing protein [RNA processing 92.88
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.77
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.74
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.56
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.53
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.45
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.38
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.22
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.17
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.88
COG3629280 DnrI DNA-binding transcriptional activator of the 91.82
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.81
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.68
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.61
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 91.59
PRK09687280 putative lyase; Provisional 91.25
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.04
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.94
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 90.94
PF13929292 mRNA_stabil: mRNA stabilisation 90.66
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.63
PRK11619 644 lytic murein transglycosylase; Provisional 90.6
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.17
KOG4570418 consensus Uncharacterized conserved protein [Funct 90.14
KOG4648 536 consensus Uncharacterized conserved protein, conta 90.1
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.97
PF1343134 TPR_17: Tetratricopeptide repeat 89.95
KOG1550552 consensus Extracellular protein SEL-1 and related 89.81
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.69
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.65
PRK12798421 chemotaxis protein; Reviewed 89.59
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 89.17
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.07
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.69
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.58
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.5
PRK10941269 hypothetical protein; Provisional 87.38
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.14
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 86.95
KOG4648 536 consensus Uncharacterized conserved protein, conta 86.81
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.42
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.78
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.45
COG3947361 Response regulator containing CheY-like receiver a 85.29
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 84.9
KOG4570 418 consensus Uncharacterized conserved protein [Funct 84.75
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.62
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.59
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 84.49
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 84.44
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 84.41
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.05
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.81
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.65
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 83.65
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.4
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.31
PRK09687280 putative lyase; Provisional 83.27
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.13
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.04
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.96
COG4455 273 ImpE Protein of avirulence locus involved in tempe 82.94
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 82.89
KOG1586288 consensus Protein required for fusion of vesicles 82.85
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 81.94
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 81.6
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 81.57
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 80.51
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.5e-72  Score=556.92  Aligned_cols=454  Identities=29%  Similarity=0.549  Sum_probs=441.3

Q ss_pred             HHHHHHHhh---cChhHHHHHHHHHHHhCCCCchhhhhhHh-hhhhcCCHHHHHHHhccCCCCCCcccHHHHHHHHHhCC
Q 012504            5 HIETLIQLS---KTVHHLHQLHTLFLKTSLDHNTCIISRFI-LTSLSISLHFTRSLFNNLPVTPPLFAYNTLIRAYAKTS   80 (462)
Q Consensus         5 ~~~~~l~~~---~~~~~a~~~~~~~~~~g~~~~~~~~~~ll-~~~~~~~~~~A~~~~~~~~~~~~~~~y~~li~~~~~~g   80 (462)
                      .+..++..|   ++++.+.+++..|.+.|+.||..+||.++ .+...|+++.|+++|++|+. ||..+||.+|.+|++.|
T Consensus       125 t~~~ll~a~~~~~~~~~a~~l~~~m~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~-~~~~t~n~li~~~~~~g  203 (697)
T PLN03081        125 TYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDEMPE-RNLASWGTIIGGLVDAG  203 (697)
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCcchHHHHHHHHHHhcCCCHHHHHHHHhcCCC-CCeeeHHHHHHHHHHCc
Confidence            344555555   67899999999999999999999999999 66666799999999999998 99999999999999999


Q ss_pred             CchhHHHHHHHHHHCCCCCCcchHHHHHHHhhhhcCchhHHHHHHHHHHhCCCCccchHhHHHHHHHhcCChhHHHHHHh
Q 012504           81 CSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFE  160 (462)
Q Consensus        81 ~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~  160 (462)
                      ++++|+++|++|.+.|+.||..+|+.++.+|++.|+.+.+.+++..+.+.|+.||..+++.|+++|++.|++++|.++|+
T Consensus       204 ~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~  283 (697)
T PLN03081        204 NYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFD  283 (697)
T ss_pred             CHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCChhhHHHHHHHHHcCCChhHHHHHHHHhHHCCCCCCHHHHHHHHHHHhcccchHhHHHHHHHHHHhCCCchHhHH
Q 012504          161 EMPVRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALG  240 (462)
Q Consensus       161 ~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  240 (462)
                      +|.++|..+||.++.+|.+.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.|.+++..|.+.|++|+..++
T Consensus       284 ~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~  363 (697)
T PLN03081        284 GMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVAN  363 (697)
T ss_pred             hCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeeh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCChHHHHHHHhhccCCChhhHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHhhccCcHH
Q 012504          241 TALVEMYSKCGHVEKAFKVFNLMREKNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVD  320 (462)
Q Consensus       241 ~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~  320 (462)
                      +.|+++|+++|++++|.++|++|.++|+.+|+.||.+|++.|+.++|.++|++|.+.|+.||..||+.++.+|.+.|..+
T Consensus       364 ~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~  443 (697)
T PLN03081        364 TALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSE  443 (697)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCchhHHHHHHHHHHhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHh
Q 012504          321 EGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEAYHIIRNMPTEPNAVILRSFLGACRNHGQVLYLDDNLGKLLLK  400 (462)
Q Consensus       321 ~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~a~~~~~~~~~  400 (462)
                      +|.++|+.|.+.+++.|+..+|+.++++|++.|++++|.+++++|+..|+..+|++|+.+|...|+. +.|..+++++.+
T Consensus       444 ~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~-~~a~~~~~~l~~  522 (697)
T PLN03081        444 QGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNL-ELGRLAAEKLYG  522 (697)
T ss_pred             HHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCc-HHHHHHHHHHhC
Confidence            9999999998877999999999999999999999999999999999999999999999999999999 999999999999


Q ss_pred             cCCCCCchHHHHHHHHhhcCCHHHHHHHHHHHhcCCCccCCccceEEECCeEEEEecCCc
Q 012504          401 LEPELGANYVLAASVSSLSGNWDTAAELMVAINQKGLNKVPGCSWVKVNDGSAEEMSKET  460 (462)
Q Consensus       401 ~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  460 (462)
                      +.|++...|..++.+|.+.|++++|.++++.|++.|+.+.|+++|+++++.+|.|.++|.
T Consensus       523 ~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~  582 (697)
T PLN03081        523 MGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDR  582 (697)
T ss_pred             CCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCC
Confidence            999999999999999999999999999999999999999999999999999999999875



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 76.8 bits (187), Expect = 6e-15
 Identities = 27/198 (13%), Positives = 62/198 (31%), Gaps = 9/198 (4%)

Query: 182 SPSDALKVFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGT 241
           S   A  +    + A ESP    L  L+      +++   ++         L        
Sbjct: 72  SKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLL 131

Query: 242 ALVEMYSKCGHVEKAFKVFNLMREK-------NLQSWTIMISGLADNGRGNYAISLFAKM 294
           A  +       +  A  +  +   +        L  +  ++ G A  G     + +   +
Sbjct: 132 AFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMV 191

Query: 295 IQTGLKPDSISFSAILSACSHLGLVDEG-KNYFDEMARVYNIKPTMEHYGCMVDMLGRAG 353
              GL PD +S++A L             +   ++M++   +K        ++    RA 
Sbjct: 192 KDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQ-EGLKLQALFTAVLLSEEDRAT 250

Query: 354 LIEEAYHIIRNMPTEPNA 371
           +++  + +       P  
Sbjct: 251 VLKAVHKVKPTFSLPPQL 268


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query462
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.8
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.72
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.7
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.66
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.65
3u4t_A272 TPR repeat-containing protein; structural genomics 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.61
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.61
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.61
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.61
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.6
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.6
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.59
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.58
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.53
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.49
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.49
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.47
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.46
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.45
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.38
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.38
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.37
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.36
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.36
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.31
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.3
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.27
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.26
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.24
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.21
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.19
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.17
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.16
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.14
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.13
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.05
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.05
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.01
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.01
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.0
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.98
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.98
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.96
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.95
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.94
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.94
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.92
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.92
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.89
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.89
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.89
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.89
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.88
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.88
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.87
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.86
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.85
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.84
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.81
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.79
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.76
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.75
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.73
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.72
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.71
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.71
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.69
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.67
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.67
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.67
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.65
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.64
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.61
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.6
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.59
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.57
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.55
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.55
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.54
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.5
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.49
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.47
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.47
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.41
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.4
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.37
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.37
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.35
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.34
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.33
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.33
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.32
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.31
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.28
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.27
3k9i_A117 BH0479 protein; putative protein binding protein, 98.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.24
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.23
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.22
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.17
3k9i_A117 BH0479 protein; putative protein binding protein, 98.12
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.11
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.02
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.02
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.0
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.96
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.95
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.94
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.94
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.88
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.87
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.84
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.82
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.81
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.66
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.65
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.65
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.64
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.5
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.45
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.34
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.33
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.21
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.11
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.09
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.02
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.01
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.99
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.95
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.82
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.76
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.69
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.68
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.5
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.45
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.44
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.35
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.29
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.28
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.09
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.08
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.4
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.26
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.85
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.34
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.27
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.23
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.22
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.18
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 93.16
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.04
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.9
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.9
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.53
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.89
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 91.6
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.22
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.29
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.61
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.34
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.79
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.6
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.31
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.2
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.97
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.81
2p58_C116 Putative type III secretion protein YSCG; type III 86.79
2p58_C116 Putative type III secretion protein YSCG; type III 86.19
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.29
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 83.52
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 82.93
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.83
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 80.66
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.38
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.7e-38  Score=312.24  Aligned_cols=424  Identities=9%  Similarity=-0.065  Sum_probs=369.3

Q ss_pred             HHHHHHhhcChhHHHHHHHHHHHhCCCCchhhhhhHh-hhhhcCCHHHHHHHhccCCC-CCCcccHHHHHHHHHhCCCch
Q 012504            6 IETLIQLSKTVHHLHQLHTLFLKTSLDHNTCIISRFI-LTSLSISLHFTRSLFNNLPV-TPPLFAYNTLIRAYAKTSCSI   83 (462)
Q Consensus         6 ~~~~l~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~ll-~~~~~~~~~~A~~~~~~~~~-~~~~~~y~~li~~~~~~g~~~   83 (462)
                      +...+...|+++.|..+++.+..  ..|+..++..+. .+...|++++|..+|+++.. .++..+++.++.+|.+.|+++
T Consensus        90 ~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~  167 (597)
T 2xpi_A           90 WRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQ  167 (597)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHHHHhhHH
Confidence            34445556899999999999985  456777887777 67777899999999999842 388999999999999999999


Q ss_pred             hHHHHHHHHHHC---------------CCCCCcchHHHHHHHhhhhcCchhHHHHHHHHHHhCCCCccchH---------
Q 012504           84 ESIKLFDEMLKT---------------GLRPDNFTYPFVVKACGRCLLIGIGGSVHSLIFKVGLDSDKYIG---------  139 (462)
Q Consensus        84 ~a~~~~~~m~~~---------------g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~---------  139 (462)
                      +|+++|+++...               |..++..+|..++.++.+.|++++|.++|+.+.+.++. +...+         
T Consensus       168 ~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~~~l~~~~~~  246 (597)
T 2xpi_A          168 GALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAFDQLVSNHLL  246 (597)
T ss_dssp             HHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHTTCS
T ss_pred             HHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHHHHHHHhhcc
Confidence            999999953221               22335789999999999999999999999999987632 22222         


Q ss_pred             -----------------------------hHHHHHHHhcCChhHHHHHHhcCCC--CChhhHHHHHHHHHcCCChhHHHH
Q 012504          140 -----------------------------NTLLRMYAACKEIDVAKAVFEEMPV--RDVVSWSSMIAGFVACDSPSDALK  188 (462)
Q Consensus       140 -----------------------------~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~a~~  188 (462)
                                                   +.++..|.+.|++++|.++|+++..  ++..+|+.++..|.+.|++++|.+
T Consensus       247 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~  326 (597)
T 2xpi_A          247 TADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLA  326 (597)
T ss_dssp             CHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             cchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHH
Confidence                                         2235566788999999999999987  789999999999999999999999


Q ss_pred             HHHHhHHCCCCCCHHHHHHHHHHHhcccchHhHHHHHHHHHHhCCCchHhHHHHHHHHHHhcCChHHHHHHHhhccC---
Q 012504          189 VFHRMKLANESPNSVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMRE---  265 (462)
Q Consensus       189 ~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~---  265 (462)
                      +|+++.+.+ +.+..++..++.++.+.|++++|..+++++.+.. +.+..+++.++.+|.+.|++++|.++|+++.+   
T Consensus       327 ~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~  404 (597)
T 2xpi_A          327 ITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDP  404 (597)
T ss_dssp             HHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCC
Confidence            999998865 4477889999999999999999999999999765 66788999999999999999999999998863   


Q ss_pred             CChhhHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHhhccCcHHHHHHHHHHHHHhcCCCCchhHHHHH
Q 012504          266 KNLQSWTIMISGLADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCM  345 (462)
Q Consensus       266 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l  345 (462)
                      .+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..++..++.+|.+.|++++|.++|+++.+.  .+.+..+|..+
T Consensus       405 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l  481 (597)
T 2xpi_A          405 QFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--FQYDPLLLNEL  481 (597)
T ss_dssp             TCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--CCCCHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCChHHHHHH
Confidence            467899999999999999999999999999874 347789999999999999999999999999874  34568899999


Q ss_pred             HHHHHhcCCHHHHHHHHHhC-------CCCCC--HHHHHHHHHHHHHcCChHHHHHHHHHHHHhcCCCCCchHHHHHHHH
Q 012504          346 VDMLGRAGLIEEAYHIIRNM-------PTEPN--AVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVS  416 (462)
Q Consensus       346 ~~~~~~~~~~~~A~~~~~~~-------~~~~~--~~~~~~l~~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~  416 (462)
                      +..|.+.|++++|.++|+++       +..|+  ..+|..++.+|...|++ ++|...++++.+..|+++.+|..++.+|
T Consensus       482 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~-~~A~~~~~~~~~~~p~~~~~~~~l~~~~  560 (597)
T 2xpi_A          482 GVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMY-DAAIDALNQGLLLSTNDANVHTAIALVY  560 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCH-HHHHHHHHHHHHHSSCCHHHHHHHHHHH
T ss_pred             HHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCH-HHHHHHHHHHHHhCCCChHHHHHHHHHH
Confidence            99999999999999999988       33566  78999999999999999 9999999999999999999999999999


Q ss_pred             hhcCCHHHHHHHHHHHhcCCCc
Q 012504          417 SLSGNWDTAAELMVAINQKGLN  438 (462)
Q Consensus       417 ~~~g~~~~A~~~~~~~~~~~~~  438 (462)
                      .+.|++++|.++++++.+.++.
T Consensus       561 ~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          561 LHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHhCCHHHHHHHHHHHHhcCCC
Confidence            9999999999999999886654



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query462
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.68
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.65
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.33
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.21
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.18
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.15
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.14
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.14
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.13
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.11
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.08
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.99
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.75
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.6
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.51
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.41
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.41
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.31
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.22
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.18
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.18
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.17
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.15
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.11
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.09
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.07
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.03
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.94
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.7
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.7
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.65
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.53
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.43
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.43
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.27
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.15
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.49
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.03
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.78
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.41
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.22
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.75
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.32
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.06
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.39
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.77
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=2e-22  Score=184.10  Aligned_cols=367  Identities=11%  Similarity=-0.009  Sum_probs=253.2

Q ss_pred             cCCHHHHHHHhccCC--CCCCcccHHHHHHHHHhCCCchhHHHHHHHHHHCCCCCCcchHHHHHHHhhhhcCchhHHHHH
Q 012504           47 SISLHFTRSLFNNLP--VTPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNFTYPFVVKACGRCLLIGIGGSVH  124 (462)
Q Consensus        47 ~~~~~~A~~~~~~~~--~~~~~~~y~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~  124 (462)
                      .|++++|.+.++++-  .+.+..++..+...+.+.|++++|++.|+.+.+..+. +..++..+..++.+.|++++|...+
T Consensus        12 ~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g~~~~A~~~~   90 (388)
T d1w3ba_          12 AGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQLQEAIEHY   90 (388)
T ss_dssp             HTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhcccccccccc
Confidence            357777777776652  1124566777777777777777777777777765322 4556667777777777777777777


Q ss_pred             HHHHHhCCCCccchHhHHHHHHHhcCChhHHHHHHhcCC---CCChhhHHHHHHHHHcCCChhHHHHHHHHhHHCCCCCC
Q 012504          125 SLIFKVGLDSDKYIGNTLLRMYAACKEIDVAKAVFEEMP---VRDVVSWSSMIAGFVACDSPSDALKVFHRMKLANESPN  201 (462)
Q Consensus       125 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~  201 (462)
                      ....+.... +..............+....+........   .................+....+...+....... +.+
T Consensus        91 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  168 (388)
T d1w3ba_          91 RHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNF  168 (388)
T ss_dssp             HHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTC
T ss_pred             ccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC-cch
Confidence            777766432 22333333334444444444443333322   2344445555556666777777777777766542 334


Q ss_pred             HHHHHHHHHHHhcccchHhHHHHHHHHHHhCCCchHhHHHHHHHHHHhcCChHHHHHHHhhccC---CChhhHHHHHHHH
Q 012504          202 SVTLVSLVSACTSLINVRAGESIHSYAVVNGLELDVALGTALVEMYSKCGHVEKAFKVFNLMRE---KNLQSWTIMISGL  278 (462)
Q Consensus       202 ~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~---~~~~~~~~l~~~~  278 (462)
                      ...+..+...+...|+++.|...+....+.. +.+...+..+...+...|++++|...+++...   .....+..+...+
T Consensus       169 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~  247 (388)
T d1w3ba_         169 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVY  247 (388)
T ss_dssp             HHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHH
T ss_pred             hHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHH
Confidence            5666677777778888888888888877765 44566777788888888888888888877653   3456677777888


Q ss_pred             HHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHhhccCcHHHHHHHHHHHHHhcCCCCchhHHHHHHHHHHhcCCHHHH
Q 012504          279 ADNGRGNYAISLFAKMIQTGLKPDSISFSAILSACSHLGLVDEGKNYFDEMARVYNIKPTMEHYGCMVDMLGRAGLIEEA  358 (462)
Q Consensus       279 ~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A  358 (462)
                      ...|++++|...|++..+.. +-+..++..+...+...|++++|...++....  ..+.+...+..+...+.+.|++++|
T Consensus       248 ~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~~~~~A  324 (388)
T d1w3ba_         248 YEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALR--LCPTHADSLNNLANIKREQGNIEEA  324 (388)
T ss_dssp             HHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCHHHH
T ss_pred             HHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhc--cCCccchhhhHHHHHHHHCCCHHHH
Confidence            88888888888888887753 22456777777788888888888888888766  3345567777788888888888888


Q ss_pred             HHHHHhCCC-CC-CHHHHHHHHHHHHHcCChHHHHHHHHHHHHhcCCCCCchHHHHHHHHhhcCC
Q 012504          359 YHIIRNMPT-EP-NAVILRSFLGACRNHGQVLYLDDNLGKLLLKLEPELGANYVLAASVSSLSGN  421 (462)
Q Consensus       359 ~~~~~~~~~-~~-~~~~~~~l~~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  421 (462)
                      ++.|++... .| +..++..+..++...|++ ++|...++++.+++|+++.++..++.+|.+.|+
T Consensus       325 ~~~~~~al~~~p~~~~~~~~la~~~~~~g~~-~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         325 VRLYRKALEVFPEFAAAHSNLASVLQQQGKL-QEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHTTSCTTCHHHHHHHHHHHHTTTCC-HHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHhCCCCHHHHHHHHHHHHHcCCH-HHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            888877543 33 466777788888888888 888888888888888888888888888877775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure