Citrus Sinensis ID: 012694


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLLGTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL
cccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHcccccEEcccccccccccHHHHHccccccEEEccccccccccHHHHcccccccccccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHccHHHHHHHHHccccccHHHHHHccccHHcccccccccccccccccccccccHHHHccccccccccccccccccccc
cccccccccccHcccccccccccccccHHHcHHHHHHccccccccccccHHHHcHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccHHHHcccccEEEEcccccccccHHHHHHccccEEEccccccccccHHHHHHccccEEEccccccccccHHHHHcccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccHHHHcccEEEccccccccccHHHHccccccEEEccccccccccccHHHHcHccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHccccccEEEcccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHcc
mnpnpenyPLLVFVLSqlnpndhpplppqvynnlitkyphltnstvissltqgvpvqitqtrlllgtrpdpdtVSAARSKLAQFQetatsspevdLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNvsgnklntlpeSIARCSSLVELDASFnnlvclptnigygllnLERLSIKLnklrtfppsicemrSLKYLDAHFNElhglpraigKLTRLEVLNLssnfndltelpeTIGDLINlreldlsnnqiralPDTFFRLENltklnldqnplvippmeiVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGvsqsvggylgggktsadpyldqql
MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTrlllgtrpdPDTVSAARSKLAqfqetatsspevdLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQeaesgvvvetvDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTklnldqnplvipPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGylgggktsadpyldqql
MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLLGTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL
*******YPLLVFVLSQLN******LPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLLG****************************DLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSIL********QSGWLAWGSSMLTNFVSGVSQSVGGYLG**************
***NPENYPLLVFVLSQL******************KY*HLTNSTVISSLTQGVPVQITQTRLLLGTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQ*SILEANKQQQAQSGWLAWGSSMLTN****************************
MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLLGTRPDP********************PEVDLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL
****PENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLLGTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAVVKLEEMHEDCERQFKEAEEMLDRVYDSVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGVSQSV*GYLGGGKTSAD*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLLGTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSAELVDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query458 2.2.26 [Sep-21-2011]
O61967 699 Protein lap1 OS=Caenorhab yes no 0.491 0.321 0.416 2e-32
Q6GPJ5 605 Leucine-rich repeat-conta N/A no 0.521 0.395 0.389 1e-30
Q5M8G4 605 Leucine-rich repeat-conta yes no 0.521 0.395 0.385 1e-29
Q9Y4C4 1052 Malignant fibrous histioc yes no 0.532 0.231 0.337 2e-28
P70587 1490 Leucine-rich repeat-conta yes no 0.410 0.126 0.429 6e-28
Q9BTT6 524 Leucine-rich repeat-conta no no 0.489 0.427 0.385 6e-28
Q80TE7 1490 Leucine-rich repeat-conta yes no 0.410 0.126 0.429 7e-28
Q96NW7 1537 Leucine-rich repeat-conta no no 0.410 0.122 0.424 8e-28
Q80VQ1 524 Leucine-rich repeat-conta no no 0.528 0.461 0.382 3e-27
Q8BGI7337 Leucine-rich repeat-conta no no 0.606 0.824 0.324 4e-27
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function desciption
 Score =  140 bits (353), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/228 (41%), Positives = 129/228 (56%), Gaps = 3/228 (1%)

Query: 152 VETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSL 211
           +  + L +  L LLP   G L  L  L    NLL  +P SI  L+KLEELD+  N L++L
Sbjct: 130 ITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEAL 189

Query: 212 PDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERL 271
           P  IG L +L+   V  N L +LP+SI+ C  L +LD S N ++ LP N+G  + NL  L
Sbjct: 190 PAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGR-MPNLTDL 248

Query: 272 SIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPE 331
           +I +N++   P S  E++ L+ L A  N LH L   IGK   L  L L  NF  LT+LP+
Sbjct: 249 NISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNF--LTDLPD 306

Query: 332 TIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIPPMEI 379
           TIGDL  L  L++  N +  +PDT    ++LT L+L QN L   PM I
Sbjct: 307 TIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTI 354




Critical role in assembling adherens junctions; adapter protein involved in polarizing protein trafficking in epithelial cells. Necessary to maintain, not establish, the entire terminal web (organelle-depleted, intermediate filament-rich layer of cytoplasm that underlies the apical microvilli of polarized epithelial cells) or brush border assembly at the apical surface gut cells. Required for correct localization of ifb-2 intermediate filaments in the terminal web.
Caenorhabditis elegans (taxid: 6239)
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function description
>sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query458
255578319456 leucine-rich repeat-containing protein, 0.980 0.984 0.709 1e-180
297844192463 leucine-rich repeat family protein [Arab 0.986 0.976 0.592 1e-151
18391461464 ras group-related protein LRR 3 [Arabido 0.989 0.976 0.584 1e-149
8698744492 Contains similarity to CYR1 from Candida 0.989 0.920 0.551 1e-144
356497728461 PREDICTED: leucine-rich repeat-containin 0.991 0.984 0.593 1e-141
224110878447 predicted protein [Populus trichocarpa] 0.888 0.910 0.630 1e-141
449434977501 PREDICTED: protein scribble homolog [Cuc 0.982 0.898 0.547 1e-141
357485651456 Leucine-rich-repeat protein-like protein 0.962 0.967 0.571 1e-140
30688342471 plant intracellular ras group-related LR 0.997 0.970 0.542 1e-138
297818186471 leucine-rich repeat family protein [Arab 0.997 0.970 0.552 1e-136
>gi|255578319|ref|XP_002530026.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223530442|gb|EEF32326.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 325/458 (70%), Positives = 372/458 (81%), Gaps = 9/458 (1%)

Query: 6   ENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLL 65
           + +P+L ++LSQL+PN HPPLP  +Y NLIT++P L N  VISSLTQ +P  I Q+  LL
Sbjct: 3   QEFPILSYLLSQLDPNSHPPLPQVIYQNLITQFPQLNNPKVISSLTQSIPSTIIQSLFLL 62

Query: 66  ---GTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAVVKLEEMHEDCERQFKEAEEMLD 122
              G RPDPD VS AR K+ +  ET     EV++Y+AVV++EEMH + ERQ +E EE L 
Sbjct: 63  KALGPRPDPDAVSTARIKIQELGETGK---EVEIYKAVVRMEEMHNEYERQLREVEERLS 119

Query: 123 RVYDSVSAEL--VDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNL 180
            VY +V  E   V VNE+VV IL++ ESG VVE VDL+ RQLKLLPEAFG+L GLV LNL
Sbjct: 120 GVYKNVVGEFEDVKVNEEVVSILKQVESGSVVERVDLSGRQLKLLPEAFGKLHGLVLLNL 179

Query: 181 SRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIAR 240
           SRN LE +PDSIAGLQKLEELDVSSNLL SLPDSIGLL  LKVLNVSGNKLN LPESIA 
Sbjct: 180 SRNQLEVLPDSIAGLQKLEELDVSSNLLLSLPDSIGLLRTLKVLNVSGNKLNYLPESIAL 239

Query: 241 CSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNE 300
           CSSLVELDASFNNLV LPTNIGYGL NLERLSI+LNK+   PPSICEM+SL+YLD HFNE
Sbjct: 240 CSSLVELDASFNNLVSLPTNIGYGLTNLERLSIQLNKIHILPPSICEMKSLRYLDVHFNE 299

Query: 301 LHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLE 360
           LHGLP AIG+LT LEVL+LSSNF+DLTELPET+GDL NLREL+LSNNQIRALPDTF RLE
Sbjct: 300 LHGLPYAIGRLTNLEVLDLSSNFSDLTELPETVGDLANLRELNLSNNQIRALPDTFGRLE 359

Query: 361 NLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGW 420
           NL  L LD+NPLVIPP EIVNKGV+AV+EFM KRW  +IAE QQ+ +LE N QQQ+Q+GW
Sbjct: 360 NLANLILDENPLVIPPKEIVNKGVQAVREFMQKRWLDMIAEEQQRRMLEVN-QQQSQTGW 418

Query: 421 LAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL 458
           LAWG+S+L NFVSGVSQSV GY+GG K   DPYLDQQL
Sbjct: 419 LAWGNSLLNNFVSGVSQSVSGYIGGTKPPQDPYLDQQL 456




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297844192|ref|XP_002889977.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335819|gb|EFH66236.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18391461|ref|NP_563921.1| ras group-related protein LRR 3 [Arabidopsis thaliana] gi|17063165|gb|AAL32979.1| At1g12970/F13K23_18 [Arabidopsis thaliana] gi|21700931|gb|AAM70589.1| At1g12970/F13K23_18 [Arabidopsis thaliana] gi|57868148|gb|AAW57412.1| plant intracellular Ras-group-related LRR protein 3 [Arabidopsis thaliana] gi|332190834|gb|AEE28955.1| ras group-related protein LRR 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8698744|gb|AAF78502.1|AC012187_22 Contains similarity to CYR1 from Candida albicans gb|AB034965 and contains multiple Leucine Rich PF|00560 repeats [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356497728|ref|XP_003517711.1| PREDICTED: leucine-rich repeat-containing protein 7-like [Glycine max] Back     alignment and taxonomy information
>gi|224110878|ref|XP_002315667.1| predicted protein [Populus trichocarpa] gi|222864707|gb|EEF01838.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449434977|ref|XP_004135272.1| PREDICTED: protein scribble homolog [Cucumis sativus] gi|449478610|ref|XP_004155368.1| PREDICTED: protein scribble homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|357485651|ref|XP_003613113.1| Leucine-rich-repeat protein-like protein [Medicago truncatula] gi|355514448|gb|AES96071.1| Leucine-rich-repeat protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|30688342|ref|NP_189281.2| plant intracellular ras group-related LRR 2 [Arabidopsis thaliana] gi|9293927|dbj|BAB01830.1| leucine-rich-repeat protein-like [Arabidopsis thaliana] gi|26453000|dbj|BAC43576.1| unknown protein [Arabidopsis thaliana] gi|29824149|gb|AAP04035.1| unknown protein [Arabidopsis thaliana] gi|57868146|gb|AAW57411.1| plant intracellular Ras-group-related LRR protein 2 [Arabidopsis thaliana] gi|332643646|gb|AEE77167.1| plant intracellular ras group-related LRR 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297818186|ref|XP_002876976.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297322814|gb|EFH53235.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query458
TAIR|locus:2010326464 PIRL3 "AT1G12970" [Arabidopsis 0.989 0.976 0.586 2.2e-137
TAIR|locus:2088807471 PIRL2 "AT3G26500" [Arabidopsis 0.997 0.970 0.544 2e-127
TAIR|locus:2166429506 PIRL1 "plant intracellular ras 0.825 0.747 0.542 4.2e-102
TAIR|locus:2074728499 PIRL9 "plant intracellular ras 0.768 0.705 0.571 1.9e-99
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.641 0.535 0.401 4.6e-50
TAIR|locus:2120825383 PIRL8 "AT4G26050" [Arabidopsis 0.604 0.723 0.408 6.7e-49
TAIR|locus:2827587526 PIRL5 "AT2G17440" [Arabidopsis 0.641 0.558 0.406 6.7e-49
TAIR|locus:2123899373 PIRL7 "plant intracellular ras 0.554 0.680 0.431 1.1e-48
TAIR|locus:2047595380 PIRL6 "AT2G19330" [Arabidopsis 0.537 0.647 0.449 2.9e-48
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.491 0.321 0.416 6.2e-35
TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1345 (478.5 bits), Expect = 2.2e-137, P = 2.2e-137
 Identities = 275/469 (58%), Positives = 347/469 (73%)

Query:     1 MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQ 60
             M+ + E +PLL +VL   +P  H P    +  +L  +YP LTN  VISSL + +P  ITQ
Sbjct:     1 MDHDLEIFPLLSYVLHHSDPASHAPPSLAIQQSLANRYPLLTNPYVISSLIESIPSTITQ 60

Query:    61 TRLL---LGTRPDPDTVSAARSKLAQFQETATSSPE-----VDLYRAVVKLEEMHEDCER 112
             T  +   LG RPDP  VS+ARSK+ + +E  + SPE       +Y AVV LEE+HE  E+
Sbjct:    61 TLFVFGSLGPRPDPLAVSSARSKIREIKENDSLSPEDAAKEEQVYAAVVSLEEVHEGYEK 120

Query:   113 QFKEAEEMLDRVYDSVSAELV---DVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAF 169
             Q ++ EE + RVY S    L    +VNE+V+ ++++AE G VVE +DL+D +LKLLP+A 
Sbjct:   121 QLRDLEEEIGRVYASAVESLSGGDEVNEEVLAVIKDAEDGGVVERIDLSDHELKLLPDAL 180

Query:   170 GRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGN 229
             G++ GLVSLN+SRN L  +PD+I+GL+KLEELD+SSN L  LPDSIGLLLNL++LNV+GN
Sbjct:   181 GKIVGLVSLNVSRNNLRFLPDTISGLEKLEELDLSSNRLVFLPDSIGLLLNLRILNVTGN 240

Query:   230 KLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMR 289
             KL  LPESIA+C SLVELDASFNNL  LP N GYGLLNLERLSI+LNK+R FP SICEMR
Sbjct:   241 KLTLLPESIAQCRSLVELDASFNNLTSLPANFGYGLLNLERLSIQLNKIRFFPNSICEMR 300

Query:   290 SLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQI 349
             SL+YLDAH NE+HGLP AIG+LT LEV+NLSSNF+DL ELP+TI DL NLRELDLSNNQI
Sbjct:   301 SLRYLDAHMNEIHGLPIAIGRLTNLEVMNLSSNFSDLIELPDTISDLANLRELDLSNNQI 360

Query:   350 RALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILE 409
             R LPD+FFRLE L KLNLDQNPL  PP E+VN+  EAV+EFM KRW+ ++ E Q +S++E
Sbjct:   361 RVLPDSFFRLEKLEKLNLDQNPLEYPPQEMVNQSAEAVREFMRKRWEEMVEEEQLRSVIE 420

Query:   410 ANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL 458
             A KQQ   +GWL+WGSS++T+  SG     G + G  K   + +LD+QL
Sbjct:   421 AEKQQGGATGWLSWGSSIVTSLFSG-----GTHGGAAKKPKNSFLDEQL 464




GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166429 PIRL1 "plant intracellular ras group-related LRR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074728 PIRL9 "plant intracellular ras group-related LRR 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123899 PIRL7 "plant intracellular ras group-related LRR 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047595 PIRL6 "AT2G19330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-10
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
smart0037024 smart00370, LRR, Leucine-rich repeats, outliers 7e-04
smart0036924 smart00369, LRR_TYP, Leucine-rich repeats, typical 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 86.6 bits (214), Expect = 2e-18
 Identities = 67/223 (30%), Positives = 104/223 (46%), Gaps = 5/223 (2%)

Query: 152 VETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSL 211
           ++ +DL+D +++ LP     L  L +L+LS N L  +P  ++ L  L  LD+S N +  L
Sbjct: 142 LKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDL 201

Query: 212 PDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERL 271
           P  I LL  L+ L++S N +  L  S++   +L  L+ S N L  LP +IG  L NLE L
Sbjct: 202 PPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIG-NLSNLETL 260

Query: 272 SIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPE 331
            +  N   +   S+  + +L+ LD   N L      I  L  L  L L+     LT    
Sbjct: 261 DL-SNNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLN---LLLTLKAL 316

Query: 332 TIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVI 374
            +     L   ++ +N   + P+    LE+L  L    N L  
Sbjct: 317 ELKLNSILLNNNILSNGETSSPEALSILESLNNLWTLDNALDE 359


Length = 394

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|197688 smart00370, LRR, Leucine-rich repeats, outliers Back     alignment and domain information
>gnl|CDD|197687 smart00369, LRR_TYP, Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 458
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG4237498 consensus Extracellular matrix protein slit, conta 99.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.54
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.52
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.49
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.46
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.45
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.36
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.36
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.34
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.33
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.25
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.91
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.87
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.66
PLN03150623 hypothetical protein; Provisional 98.65
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.63
PLN03150623 hypothetical protein; Provisional 98.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.51
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.42
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.4
PRK15386 426 type III secretion protein GogB; Provisional 98.38
PRK15386426 type III secretion protein GogB; Provisional 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.01
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.93
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.34
KOG4308478 consensus LRR-containing protein [Function unknown 97.28
KOG4341483 consensus F-box protein containing LRR [General fu 97.2
KOG4308478 consensus LRR-containing protein [Function unknown 96.86
KOG4341483 consensus F-box protein containing LRR [General fu 96.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.48
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.21
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.97
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.66
smart0037026 LRR Leucine-rich repeats, outliers. 90.66
smart0037026 LRR Leucine-rich repeats, outliers. 89.54
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.27
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.96
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.5
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
Probab=99.93  E-value=9.8e-28  Score=235.55  Aligned_cols=229  Identities=34%  Similarity=0.459  Sum_probs=158.1

Q ss_pred             CCCceeEEEecCCCCCccchhhCCCCCCcEEEcccCCCCccchh-hcCCcccceeeeecCCCCCCchhhcCCCCccEEEe
Q 012694          148 SGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDS-IAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNV  226 (458)
Q Consensus       148 ~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~i~~l~~~-l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l  226 (458)
                      .++.|+.|||++|.++++|..+..-+++-+|+|++|+|..||.. +.++..|-.||||+|++..+|+.+..+..|++|.|
T Consensus       101 ~l~dLt~lDLShNqL~EvP~~LE~AKn~iVLNLS~N~IetIPn~lfinLtDLLfLDLS~NrLe~LPPQ~RRL~~LqtL~L  180 (1255)
T KOG0444|consen  101 RLKDLTILDLSHNQLREVPTNLEYAKNSIVLNLSYNNIETIPNSLFINLTDLLFLDLSNNRLEMLPPQIRRLSMLQTLKL  180 (1255)
T ss_pred             ccccceeeecchhhhhhcchhhhhhcCcEEEEcccCccccCCchHHHhhHhHhhhccccchhhhcCHHHHHHhhhhhhhc
Confidence            34778888888888888888777777888888888888877754 56777777778888777777777777777777777


Q ss_pred             eCCCCC--------------------------CCchhhcCCCCCcEEEcCCCCCCcCCchhhccCCCCCEEeccCCcCcc
Q 012694          227 SGNKLN--------------------------TLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRT  280 (458)
Q Consensus       227 ~~n~l~--------------------------~l~~~l~~l~~L~~L~l~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~  280 (458)
                      ++|.+.                          .+|.++..+.+|..+|++.|++..+|..++ .+++|+.|+|++|.|+.
T Consensus       181 s~NPL~hfQLrQLPsmtsL~vLhms~TqRTl~N~Ptsld~l~NL~dvDlS~N~Lp~vPecly-~l~~LrrLNLS~N~ite  259 (1255)
T KOG0444|consen  181 SNNPLNHFQLRQLPSMTSLSVLHMSNTQRTLDNIPTSLDDLHNLRDVDLSENNLPIVPECLY-KLRNLRRLNLSGNKITE  259 (1255)
T ss_pred             CCChhhHHHHhcCccchhhhhhhcccccchhhcCCCchhhhhhhhhccccccCCCcchHHHh-hhhhhheeccCcCceee
Confidence            776542                          344455566667777777777777766555 67777777777777776


Q ss_pred             CCccccCCCCCcEEEcccCCCCCccccccCCCcccEEEccCCCCCCCccchhhcCCCCCCEEeccCCCCCCCchhhhCCC
Q 012694          281 FPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLE  360 (458)
Q Consensus       281 l~~~l~~l~~L~~L~l~~n~l~~l~~~l~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~  360 (458)
                      +....+.-.+|++|+++.|+++.+|.++.++++|+.|.+.+|......+|..++.+.+|+.+..++|.+.-+|+.+..|.
T Consensus       260 L~~~~~~W~~lEtLNlSrNQLt~LP~avcKL~kL~kLy~n~NkL~FeGiPSGIGKL~~Levf~aanN~LElVPEglcRC~  339 (1255)
T KOG0444|consen  260 LNMTEGEWENLETLNLSRNQLTVLPDAVCKLTKLTKLYANNNKLTFEGIPSGIGKLIQLEVFHAANNKLELVPEGLCRCV  339 (1255)
T ss_pred             eeccHHHHhhhhhhccccchhccchHHHhhhHHHHHHHhccCcccccCCccchhhhhhhHHHHhhccccccCchhhhhhH
Confidence            65555555666777777777777777777777777777766655556666666666666666666666666666666666


Q ss_pred             CCcEEECcCCCCCCCcH
Q 012694          361 NLTKLNLDQNPLVIPPM  377 (458)
Q Consensus       361 ~L~~L~L~~n~i~~~~~  377 (458)
                      +|+.|.|+.|.+...|.
T Consensus       340 kL~kL~L~~NrLiTLPe  356 (1255)
T KOG0444|consen  340 KLQKLKLDHNRLITLPE  356 (1255)
T ss_pred             HHHHhcccccceeechh
Confidence            66666666666555443



>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-17
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-13
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-12
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-10
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-10
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-10
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-10
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 2e-08
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 4e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 4e-08
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-08
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 9e-08
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 1e-07
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 1e-07
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 1e-07
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-07
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-07
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 4e-07
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-07
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 5e-07
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 5e-07
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 5e-07
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-06
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 6e-06
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 8e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-05
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 8e-05
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 8e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 1e-04
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 2e-04
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 3e-04
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 4e-04
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 4e-04
4eco_A 636 Crystal Structure Of A Hypothetical Protein (Bacegg 4e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 4e-04
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 5e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 6e-04
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 6e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 6e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 6e-04
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 6e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 7e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 8e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Iteration: 1

Score = 87.0 bits (214), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 82/253 (32%), Positives = 129/253 (50%), Gaps = 22/253 (8%) Query: 177 SLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPD-SIGLLLNLKVLNVSGNKLNTLP 235 S++ S L A+P +I K +LD+ SN L SLP + L L++L ++ NKL TLP Sbjct: 20 SVDCSSKKLTAIPSNIPADTK--KLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLP 77 Query: 236 ESIAR-CSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICE-MRSLKY 293 I + +L L + N L LP + L+NL L + N+L++ PP + + + L Y Sbjct: 78 AGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLTY 137 Query: 294 LDAHFNELHGLPRAI-GKLTRLEVLNLSSNFNDLTELPETIGD-LINLRELDLSNNQIRA 351 L +NEL LP+ + KLT L+ L L + N L +PE D L L+ L L NNQ++ Sbjct: 138 LSLGYNELQSLPKGVFDKLTSLKELRLYN--NQLKRVPEGAFDKLTELKTLKLDNNQLKR 195 Query: 352 LPDTFF-RLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGII-------AEAQ 403 +P+ F LE L L L +N P + G+ + +++ K+ D + E Sbjct: 196 VPEGAFDSLEKLKMLQLQEN-----PWDCTCNGIIYMAKWLKKKADEGLGGVDTAGCEKG 250 Query: 404 QKSILEANKQQQA 416 K++LE ++ A Sbjct: 251 GKAVLEITEKDAA 263
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-67
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-53
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-50
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-56
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-49
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-41
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-32
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-43
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-45
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-39
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-44
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-34
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-41
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-39
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-34
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-40
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-40
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-35
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-38
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-30
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-38
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-26
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-38
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-35
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-34
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-32
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-29
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-36
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-34
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-34
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-28
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-34
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-29
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-28
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-32
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-32
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-31
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-29
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-23
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-28
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-26
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-25
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-26
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-26
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-22
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-25
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-25
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-25
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-24
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-20
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-14
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-12
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 1e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-05
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  217 bits (554), Expect = 3e-67
 Identities = 69/239 (28%), Positives = 99/239 (41%), Gaps = 14/239 (5%)

Query: 156 DLADRQLKLLPEAFGRLR--GLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPD 213
               R LK   +        G V+L L    L   PD    L  L+ + + +  L  LPD
Sbjct: 62  TRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPD 121

Query: 214 SIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNN-LVCLPTNIG--------YG 264
           ++     L+ L ++ N L  LP SIA  + L EL       L  LP  +          G
Sbjct: 122 TMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG 181

Query: 265 LLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFN 324
           L+NL+ L ++   +R+ P SI  +++LK L    + L  L  AI  L +LE L+L     
Sbjct: 182 LVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGC-T 240

Query: 325 DLTELPETIGDLINLRELDLSN-NQIRALPDTFFRLENLTKLNLDQNP-LVIPPMEIVN 381
            L   P   G    L+ L L + + +  LP    RL  L KL+L     L   P  I  
Sbjct: 241 ALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ 299


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query458
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.93
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.9
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.21
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.97
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.85
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.75
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.96  E-value=1.2e-28  Score=240.26  Aligned_cols=227  Identities=26%  Similarity=0.332  Sum_probs=205.5

Q ss_pred             CCCceeEEEecCCCCCccchhhCCCCCCcEEEcccCCCCccchhhcCCcccceeeeecCCCCCCchhhcCCCCccEEEee
Q 012694          148 SGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVS  227 (458)
Q Consensus       148 ~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~i~~l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~  227 (458)
                      ....++.|++++|.++.+|..+..+++|++|++++|.++.+|..++++++|++|++++|.++.+|..+.++++|++|+++
T Consensus        79 ~~~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~  158 (328)
T 4fcg_A           79 TQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIR  158 (328)
T ss_dssp             TSTTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEE
T ss_pred             cccceeEEEccCCCchhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECC
Confidence            35779999999999999999899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCC-CCCCchhhcC---------CCCCcEEEcCCCCCCcCCchhhccCCCCCEEeccCCcCccCCccccCCCCCcEEEcc
Q 012694          228 GNK-LNTLPESIAR---------CSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAH  297 (458)
Q Consensus       228 ~n~-l~~l~~~l~~---------l~~L~~L~l~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~  297 (458)
                      +|+ +..+|..+..         +++|++|++++|.++.+|..+. .+++|++|++++|.++.+|..+..+++|++|+++
T Consensus       159 ~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~-~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls  237 (328)
T 4fcg_A          159 ACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIA-NLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLR  237 (328)
T ss_dssp             EETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGG-GCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECT
T ss_pred             CCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhc-CCCCCCEEEccCCCCCcCchhhccCCCCCEEECc
Confidence            974 4577776654         9999999999999999987754 8999999999999999999999999999999999


Q ss_pred             cCCCCC-ccccccCCCcccEEEccCCCCCCCccchhhcCCCCCCEEeccCCCCC-CCchhhhCCCCCcEEECcCCCCCCC
Q 012694          298 FNELHG-LPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIR-ALPDTFFRLENLTKLNLDQNPLVIP  375 (458)
Q Consensus       298 ~n~l~~-l~~~l~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~l~-~l~~~l~~l~~L~~L~L~~n~i~~~  375 (458)
                      +|.+.+ +|..++.+++|++|++++| ...+.+|..++.+++|+.|++++|++. .+|..++++++|+.+++..+.+...
T Consensus       238 ~n~~~~~~p~~~~~l~~L~~L~L~~n-~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~L~~L~~l~l~~~~~~~l  316 (328)
T 4fcg_A          238 GCTALRNYPPIFGGRAPLKRLILKDC-SNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQL  316 (328)
T ss_dssp             TCTTCCBCCCCTTCCCCCCEEECTTC-TTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGGSCTTCEEECCGGGSCC-
T ss_pred             CCcchhhhHHHhcCCCCCCEEECCCC-CchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhhccCceEEeCCHHHHHHH
Confidence            988776 7888999999999999998 456788989999999999999998655 7899999999999999998877654


Q ss_pred             c
Q 012694          376 P  376 (458)
Q Consensus       376 ~  376 (458)
                      .
T Consensus       317 ~  317 (328)
T 4fcg_A          317 D  317 (328)
T ss_dssp             -
T ss_pred             h
Confidence            3



>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 458
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-18
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-13
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-13
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-10
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-10
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-07
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 1e-06
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 6e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-05
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 93.9 bits (232), Expect = 1e-21
 Identities = 45/202 (22%), Positives = 89/202 (44%), Gaps = 11/202 (5%)

Query: 169 FGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSG 228
             +L  L SL  + N +  +      L  L+EL ++ N L+ +  ++  L NL  L+++ 
Sbjct: 193 LAKLTNLESLIATNNQISDITPLG-ILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLAN 250

Query: 229 NKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEM 288
           N+++ L   ++  + L EL    N +  +    G   L                  I  +
Sbjct: 251 NQISNLA-PLSGLTKLTELKLGANQISNISPLAG---LTALTNLELNENQLEDISPISNL 306

Query: 289 RSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQ 348
           ++L YL  +FN +  +   +  LT+L+ L  ++N   ++++   + +L N+  L   +NQ
Sbjct: 307 KNLTYLTLYFNNISDIS-PVSSLTKLQRLFFANNK--VSDVSS-LANLTNINWLSAGHNQ 362

Query: 349 IRALPDTFFRLENLTKLNLDQN 370
           I  L      L  +T+L L+  
Sbjct: 363 ISDLTP-LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query458
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.8
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=4.8e-23  Score=192.23  Aligned_cols=200  Identities=32%  Similarity=0.400  Sum_probs=141.2

Q ss_pred             CCCceeEEEecCCCCCccchhhCCCCCCcEEEcccCCCCccc-hhhcCCcccceeeeecCCCCCCchhhcCCCCccEEEe
Q 012694          148 SGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMP-DSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNV  226 (458)
Q Consensus       148 ~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~i~~l~-~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l  226 (458)
                      +...+.++++++++++.+|..+.  +++++|+|++|.|+.++ ..|.++++|++|++++|+|+.++. ++.+++|++|++
T Consensus         8 ~~~~~~~v~C~~~~L~~iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~L   84 (266)
T d1p9ag_           8 KVASHLEVNCDKRNLTALPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-DGTLPVLGTLDL   84 (266)
T ss_dssp             CSTTCCEEECTTSCCSSCCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-CSCCTTCCEEEC
T ss_pred             ccCCCeEEEccCCCCCeeCcCcC--cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-cccccccccccc
Confidence            34455667788888887776554  46778888888887776 457777788888888887777653 456777777777


Q ss_pred             eCCCCCCCchhhcCCCCCcEEEcCCCCCCcCCchhhccCCCCCEEeccCCcCccCCccccCCCCCcEEEcccCCCCCccc
Q 012694          227 SGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPR  306 (458)
Q Consensus       227 ~~n~l~~l~~~l~~l~~L~~L~l~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~~n~l~~l~~  306 (458)
                      ++|+++..+..+..+++|+.|++++|.+..++...+..                       +.++++|++++|.++.++.
T Consensus        85 s~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~-----------------------l~~l~~L~l~~n~l~~l~~  141 (266)
T d1p9ag_          85 SHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRG-----------------------LGELQELYLKGNELKTLPP  141 (266)
T ss_dssp             CSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTT-----------------------CTTCCEEECTTSCCCCCCT
T ss_pred             ccccccccccccccccccccccccccccceeecccccc-----------------------ccccccccccccccceecc
Confidence            77777766666666667777777666666555444434                       4455555555555555442


Q ss_pred             -cccCCCcccEEEccCCCCCCCccc-hhhcCCCCCCEEeccCCCCCCCchhhhCCCCCcEEECcCCCCCCC
Q 012694          307 -AIGKLTRLEVLNLSSNFNDLTELP-ETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIP  375 (458)
Q Consensus       307 -~l~~l~~L~~L~L~~n~~~~~~l~-~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~L~~n~i~~~  375 (458)
                       .+..+++|+.|++++|  .+..++ ..+..+++|++|+|++|+|+.+|..+..+++|+.|+|++|++.+.
T Consensus       142 ~~~~~l~~l~~l~l~~N--~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~L~~Np~~Cd  210 (266)
T d1p9ag_         142 GLLTPTPKLEKLSLANN--NLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCN  210 (266)
T ss_dssp             TTTTTCTTCCEEECTTS--CCSCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCCCSEEECCSCCBCCS
T ss_pred             ccccccccchhcccccc--cccccCccccccccccceeecccCCCcccChhHCCCCCCCEEEecCCCCCCC
Confidence             4455667777777776  444554 346778899999999999999988888899999999999999864



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure