Citrus Sinensis ID: 012783

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MSMAQAVSLPRILVSTDASKALSKQAASTRKPRTSISTKKRAKVSPSRRTQNLNLEVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHcccccEEccccccEEEEcccccccccccccccccEEEEccHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHccccccEEEEccccccccccccccccEEEEccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHc
ccHHHHHccccEEccccccccccccccEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHccHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccEEEcccccccEEEEEcccccHHccccHcccEEEEEcHHHHHHHHHcccccccEEEEEccccccHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHccEEEEEcccccHHHEEcccccHHcccccccccEcccHHHHHHHHHHHHHHc
msmaqavslprilVSTDASKALSKQaastrkprtsistkkrakvspsrrtqnlnlevspHRAVSAVRLMRIQFGGAFADLLnkkgkgsgdnemgYVERTlgfrtkdlddrdlrLVTDIVGGTIRWRRYLDHLICLLchdektfssmEPLLLQILRIGFYEivkldmppyavvdENVRLAKVAlrpgagnlvnGILRKLVLlkdnnslplpklegnDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVwnnsdpsfslransrkgvtRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVvdpqpgqsivdccaapggktLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLrtfadnstvkcdkvlldapcsglgvlsktcvgigdwriWKSLRYCKTSFLMQHLCETKYLLL
msmaqavslprilvstdaskalskqaastrkprtsistkkrakvspsrrtqnlnlevsphRAVSAVRLMRIQFGGAFADLLnkkgkgsgdnemgYVERTLgfrtkdlddrdlrlvtdivggtirwRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKValrpgagnlvNGILRKLVLLKDNNSLPLPKLEGNDRAQARALAtiyshpvwmvRRWTKYLGQEEAIKLMVwnnsdpsfslRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLldapcsglgvLSKTCVGIGDWRIWKSLRYCKTSFLMQHLcetkylll
MSMAQAVSLPRILVSTDASKALSKQAASTRKPRTSISTKKRAKVSPSRRTQNLNLEVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKdlddrdlrlVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL
*************************************************************AVSAVRLMRIQFGGAFADLLNK********EMGYVERTLGFRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKL****RAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLL*
***************************************************************SAVRLMRIQFGGAFADLLNKKGKGSGDNEMGY***********LDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL
********LPRILVSTDA**********************************LNLEVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL
*******************************************************EVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMAQAVSLPRILVSTDASKALSKQAASTRKPRTSISTKKRAKVSPSRRTQNLNLEVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query456 2.2.26 [Sep-21-2011]
P94464447 Ribosomal RNA small subun yes no 0.673 0.686 0.278 7e-33
P72943446 Ribosomal RNA small subun N/A no 0.664 0.679 0.325 9e-32
A9R925429 Ribosomal RNA small subun yes no 0.642 0.682 0.295 8e-24
A8GKG7429 Ribosomal RNA small subun yes no 0.653 0.694 0.296 1e-23
A1JRZ3429 Ribosomal RNA small subun yes no 0.651 0.692 0.280 2e-23
B1JJH6429 Ribosomal RNA small subun yes no 0.642 0.682 0.295 3e-23
Q664V2429 Ribosomal RNA small subun yes no 0.642 0.682 0.295 3e-23
A4TH21429 Ribosomal RNA small subun yes no 0.642 0.682 0.295 3e-23
Q1CCX4429 Ribosomal RNA small subun yes no 0.642 0.682 0.295 3e-23
Q8ZJ81429 Ribosomal RNA small subun yes no 0.642 0.682 0.295 3e-23
>sp|P94464|RSMB_BACSU Ribosomal RNA small subunit methyltransferase B OS=Bacillus subtilis (strain 168) GN=rsmB PE=3 SV=2 Back     alignment and function desciption
 Score =  142 bits (357), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 174/323 (53%), Gaps = 16/323 (4%)

Query: 102 FRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEI 161
            ++ +L D++  L+T++V GT++ +  LD+++    +  +    ++P ++Q+LR+  Y++
Sbjct: 32  IKSNELSDQNRGLLTELVYGTLQNKIALDYMLKPFINKPQ---KVKPWVIQLLRLSLYQM 88

Query: 162 VKLD-MPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQA 220
             L+ +P  A + E V +AK+    G  + VNG+LR +          +P  +  +    
Sbjct: 89  EYLEKIPDRAAIHEAVEIAKIRGHKGIASFVNGVLRSI------QREGVPSFDAIEDP-V 141

Query: 221 RALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNL 280
           R LAT  SHP W+V+ W    G E A K+   +   P  +LR N  K   RA+L+ Q+  
Sbjct: 142 RRLATETSHPEWLVKEWADAYGFEAAEKICRIHLIPPKQTLRVNQMKA-DRAELLDQMAA 200

Query: 281 LKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDC 340
             +  E     ++ +++  G   +      + G  ++QDES+ LV   +DP+  ++++D 
Sbjct: 201 EGIEVEKGDLAEDAVKLLKG--TIAGTHFFQNGEVSIQDESSMLVARALDPKSDETVLDA 258

Query: 341 CAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADN 400
           CAAPGGK+ ++A  +  +G V ++D++K +++++ E A    + ++I     D R   + 
Sbjct: 259 CAAPGGKSAHIAELMKNKGSVTSLDLHKHKVKLIKEAADRLGL-TIIHAETMDARKAGET 317

Query: 401 -STVKCDKVLLDAPCSGLGVLSK 422
               + D++L+DAPCSG GV+ +
Sbjct: 318 FENEQFDRILVDAPCSGFGVIRR 340

Bacillus subtilis (strain 168) (taxid: 224308)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|P72943|RSMB_SYNY3 Ribosomal RNA small subunit methyltransferase B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A9R925|RSMB_YERPG Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rsmB PE=3 SV=2 Back     alignment and function description
>sp|A8GKG7|RSMB_SERP5 Ribosomal RNA small subunit methyltransferase B OS=Serratia proteamaculans (strain 568) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A1JRZ3|RSMB_YERE8 Ribosomal RNA small subunit methyltransferase B OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|B1JJH6|RSMB_YERPY Ribosomal RNA small subunit methyltransferase B OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q664V2|RSMB_YERPS Ribosomal RNA small subunit methyltransferase B OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A4TH21|RSMB_YERPP Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis (strain Pestoides F) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q1CCX4|RSMB_YERPN Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q8ZJ81|RSMB_YERPE Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis GN=rsmB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
224061230527 predicted protein [Populus trichocarpa] 0.918 0.795 0.801 0.0
255563540527 ribosomal RNA small subunit methyltransf 0.918 0.795 0.766 0.0
225461943525 PREDICTED: ribosomal RNA small subunit m 0.918 0.798 0.786 0.0
356501644528 PREDICTED: ribosomal RNA small subunit m 0.903 0.780 0.752 0.0
22331043523 ribosomal RNA small subunit methyltransf 0.918 0.801 0.740 0.0
357495101 654 Ribosomal RNA small subunit methyltransf 0.846 0.590 0.762 1e-180
10172606531 unnamed protein product [Arabidopsis tha 0.918 0.789 0.726 1e-178
297834138525 NOL1/NOP2/sun family protein [Arabidopsi 0.918 0.798 0.732 1e-177
115479747 570 Os09g0477900 [Oryza sativa Japonica Grou 0.875 0.7 0.673 1e-157
218202330 570 hypothetical protein OsI_31764 [Oryza sa 0.875 0.7 0.673 1e-157
>gi|224061230|ref|XP_002300381.1| predicted protein [Populus trichocarpa] gi|222847639|gb|EEE85186.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/424 (80%), Positives = 377/424 (88%), Gaps = 5/424 (1%)

Query: 3   MAQAVSLPRILVSTDASK-ALSKQAASTRKPRTSISTKKRAKVSPS---RRTQNLNLEVS 58
           MAQ +SL  +  S +  K   SK      KP+TS+ST+++A  SP    R+TQ LNL+VS
Sbjct: 1   MAQVLSL-HVFFSAEIHKVGPSKPLKRIHKPKTSLSTRRKATQSPQSPLRKTQKLNLQVS 59

Query: 59  PHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDI 118
           PHRAVSAVRLMRI+ GGAFADLLN KGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDI
Sbjct: 60  PHRAVSAVRLMRIEMGGAFADLLNDKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDI 119

Query: 119 VGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRL 178
           VGGTIRWRRYLD+LI  LCHDEK F SMEPLLLQILRIGFYEIVKLDMP YAVVDENVRL
Sbjct: 120 VGGTIRWRRYLDYLIGSLCHDEKAFRSMEPLLLQILRIGFYEIVKLDMPSYAVVDENVRL 179

Query: 179 AKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWT 238
           AKV+LRPGAGN+VNGILRKLVLLK++NSLPLPKLEG+DRAQARALAT+YSHPVWMVRRWT
Sbjct: 180 AKVSLRPGAGNMVNGILRKLVLLKESNSLPLPKLEGDDRAQARALATLYSHPVWMVRRWT 239

Query: 239 KYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVK 298
           K LGQE+AIKLM+WNN +PSFSLRANS KGVTRADLVMQ N+LKVPHELSLHLD F+RVK
Sbjct: 240 KLLGQEKAIKLMMWNNDNPSFSLRANSGKGVTRADLVMQFNMLKVPHELSLHLDHFVRVK 299

Query: 299 TGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQ 358
           TGLQ VIQAGLLK+GLCAVQDESAGL+V+VV+PQPG SI+DCCAAPGGKTLYMAS + GQ
Sbjct: 300 TGLQIVIQAGLLKQGLCAVQDESAGLIVSVVNPQPGDSIIDCCAAPGGKTLYMASQMHGQ 359

Query: 359 GLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLG 418
           G++YAIDINKGRLRI+ ETAKLHQV+ VI TI +DLRTFA++  +K DKVLLDAPCSGLG
Sbjct: 360 GMLYAIDINKGRLRIVKETAKLHQVDGVITTIPSDLRTFAESYQLKSDKVLLDAPCSGLG 419

Query: 419 VLSK 422
           VLSK
Sbjct: 420 VLSK 423

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563540|ref|XP_002522772.1| ribosomal RNA small subunit methyltransferase B, putative [Ricinus communis] gi|223538010|gb|EEF39623.1| ribosomal RNA small subunit methyltransferase B, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225461943|ref|XP_002266112.1| PREDICTED: ribosomal RNA small subunit methyltransferase B [Vitis vinifera] gi|296089930|emb|CBI39749.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356501644|ref|XP_003519634.1| PREDICTED: ribosomal RNA small subunit methyltransferase B-like [Glycine max] Back     alignment and taxonomy information
>gi|22331043|ref|NP_187924.2| ribosomal RNA small subunit methyltransferase B [Arabidopsis thaliana] gi|18176252|gb|AAL60011.1| putative sun protein fmu [Arabidopsis thaliana] gi|21436219|gb|AAM51397.1| putative sun protein fmu [Arabidopsis thaliana] gi|110740623|dbj|BAE98415.1| putative sun (fmu) protein [Arabidopsis thaliana] gi|332641785|gb|AEE75306.1| ribosomal RNA small subunit methyltransferase B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357495101|ref|XP_003617839.1| Ribosomal RNA small subunit methyltransferase [Medicago truncatula] gi|355519174|gb|AET00798.1| Ribosomal RNA small subunit methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|10172606|dbj|BAB01410.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834138|ref|XP_002884951.1| NOL1/NOP2/sun family protein [Arabidopsis lyrata subsp. lyrata] gi|297330791|gb|EFH61210.1| NOL1/NOP2/sun family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|115479747|ref|NP_001063467.1| Os09g0477900 [Oryza sativa Japonica Group] gi|52077347|dbj|BAD46388.1| sunL protein-like [Oryza sativa Japonica Group] gi|113631700|dbj|BAF25381.1| Os09g0477900 [Oryza sativa Japonica Group] gi|222641777|gb|EEE69909.1| hypothetical protein OsJ_29754 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218202330|gb|EEC84757.1| hypothetical protein OsI_31764 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
TAIR|locus:2090054523 AT3G13180 [Arabidopsis thalian 0.918 0.801 0.719 1.2e-163
TIGR_CMR|CHY_1481440 CHY_1481 "sun protein" [Carbox 0.638 0.661 0.306 8.9e-38
TIGR_CMR|GSU_3373448 GSU_3373 "Sun protein" [Geobac 0.668 0.680 0.341 3.1e-35
UNIPROTKB|Q81WH3444 sun "Sun protein" [Bacillus an 0.640 0.657 0.322 9.5e-34
TIGR_CMR|BA_4003444 BA_4003 "sun protein" [Bacillu 0.640 0.657 0.322 9.5e-34
TIGR_CMR|CBU_1915430 CBU_1915 "Sun protein" [Coxiel 0.633 0.672 0.267 2e-20
TIGR_CMR|CPS_0018440 CPS_0018 "sun protein" [Colwel 0.635 0.659 0.277 1.2e-19
UNIPROTKB|Q9KVU5434 rsmB "Ribosomal RNA small subu 0.546 0.573 0.307 5.5e-19
TIGR_CMR|VC_0044434 VC_0044 "sun protein" [Vibrio 0.546 0.573 0.307 5.5e-19
UNIPROTKB|P36929429 rsmB "16S rRNA m5C967 methyltr 0.611 0.650 0.286 5.9e-18
TAIR|locus:2090054 AT3G13180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1593 (565.8 bits), Expect = 1.2e-163, P = 1.2e-163
 Identities = 302/420 (71%), Positives = 358/420 (85%)

Query:     3 MAQAVSLPRILVSTDASKALSKQAASTRKPRTSISTKKRAKVSPSRRTQNLNLEVSPHRA 62
             MAQ +S  R+ +S +  KA       T+K R   S  +R  V+PSR++QNLNLEVSPHRA
Sbjct:     1 MAQLLSF-RVYLSAETQKASPGSFKRTQKTRKPFSPDRRGPVAPSRKSQNLNLEVSPHRA 59

Query:    63 VSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKXXXXXXXXXVTDIVGGT 122
             VSAVRLMRI++GGAFADLLN+KGKGSG NEM YVERT+GFRT+         VTD+VGGT
Sbjct:    60 VSAVRLMRIEYGGAFADLLNEKGKGSGSNEMSYVERTIGFRTRDLDDRDLRLVTDVVGGT 119

Query:   123 IRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVDENVRLAKVA 182
             IRWRRYLDHLI  LCH+E+TF +MEPLLLQILRIG YEI+K DMPPYAVVDENVRLAKVA
Sbjct:   120 IRWRRYLDHLIGSLCHNERTFRNMEPLLLQILRIGVYEIIKRDMPPYAVVDENVRLAKVA 179

Query:   183 LRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWTKYLG 242
             LRPGAG+ VNGILRKLV LK+ ++LPLPK+EG+DRAQARALAT++SHPVWMVRRW KYLG
Sbjct:   180 LRPGAGDFVNGILRKLVSLKEKDALPLPKVEGDDRAQARALATLHSHPVWMVRRWVKYLG 239

Query:   243 QEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVKTGLQ 302
              +EA KLM+WNN+DP FSLRAN+ + +TRADLV +LN LKVPHELSLHL+EF+R+KTGLQ
Sbjct:   240 LDEATKLMIWNNNDPGFSLRANTGRDITRADLVERLNSLKVPHELSLHLEEFVRIKTGLQ 299

Query:   303 NVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVY 362
              V+QAGLLKEG+C+VQDESAGL+V+VV PQPG+ I+D CAAPGGKTL+MASCL GQG++Y
Sbjct:   300 TVVQAGLLKEGICSVQDESAGLIVSVVKPQPGERIMDACAAPGGKTLFMASCLKGQGMIY 359

Query:   363 AIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSK 422
             A+D+N+GRLRIL ETAK HQV+ +I TIH+DLR FA+ + V+ DKVLLDAPCSGLGVLSK
Sbjct:   360 AMDVNEGRLRILGETAKSHQVDGLITTIHSDLRVFAETNEVQYDKVLLDAPCSGLGVLSK 419
GO:0003723 "RNA binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
GO:0045036 "protein targeting to chloroplast" evidence=RCA
TIGR_CMR|CHY_1481 CHY_1481 "sun protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3373 GSU_3373 "Sun protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q81WH3 sun "Sun protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4003 BA_4003 "sun protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1915 CBU_1915 "Sun protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0018 CPS_0018 "sun protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVU5 rsmB "Ribosomal RNA small subunit methyltransferase B" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0044 VC_0044 "sun protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P36929 rsmB "16S rRNA m5C967 methyltransferase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 6e-83
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 3e-64
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; 9e-59
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 3e-51
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 5e-46
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 2e-41
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; 2e-37
pfam01029126 pfam01029, NusB, NusB family 2e-21
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 1e-20
cd00620126 cd00620, Methyltransferase_Sun, N-terminal RNA bin 8e-18
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 2e-17
cd00447129 cd00447, NusB_Sun, RNA binding domain of NusB (N p 7e-13
TIGR01951129 TIGR01951, nusB, transcription antitermination fac 3e-11
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 1e-08
PRK00202137 PRK00202, nusB, transcription antitermination prot 3e-08
COG0781151 COG0781, NusB, Transcription termination factor [T 9e-08
cd00619130 cd00619, Terminator_NusB, Transcription terminatio 5e-07
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 3e-06
pfam02475199 pfam02475, Met_10, Met-10+ like-protein 7e-05
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 4e-04
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 8e-04
pfam01728177 pfam01728, FtsJ, FtsJ-like methyltransferase 0.003
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 0.004
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information 
 Score =  262 bits (671), Expect = 6e-83
 Identities = 119/364 (32%), Positives = 196/364 (53%), Gaps = 33/364 (9%)

Query: 61  RAVSAVRLMRIQFGGAFADL-LNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDIV 119
           R ++   L++++  GA++++ LNK                   +  +L D+D  L+T++V
Sbjct: 6   RELALEVLIKVENNGAYSNIALNKV-----------------LKKSELSDKDKALLTELV 48

Query: 120 GGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLD-MPPYAVVDENVRL 178
            GTI+ +  LD+    L    K    ++P +  +LR+  Y+++ LD +P +A V+E V +
Sbjct: 49  YGTIQRKLTLDYY---LAPFIKKRKKLDPWVRNLLRMSLYQLLYLDKVPDHAAVNEAVEI 105

Query: 179 AKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSHPVWMVRRWT 238
           AK     G    VNG+LR +        LP      +     + L+  YSHPVW+V+RW 
Sbjct: 106 AKKRGHKGIAKFVNGVLRNI----LREGLPDIDEIKDP---VKRLSIKYSHPVWLVKRWI 158

Query: 239 KYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVK 298
              G+E+A K++   N  P  S+R N+ K ++  +L+ +L       E SL   E + ++
Sbjct: 159 DQYGEEKAEKILESLNEPPKASIRVNTLK-ISVEELIEKLEEEGYEVEESLLSPEALVIE 217

Query: 299 TGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQ 358
            G  N+    L K+GL  +QDES+ LV   +DP+ G +++D CAAPGGKT ++A  L   
Sbjct: 218 KG--NIAGTDLFKDGLITIQDESSMLVAPALDPKGGDTVLDACAAPGGKTTHIAELLKNT 275

Query: 359 GLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLG 418
           G V A+DI++ +L+++ E AK   + + I T   D R   +    K DK+L+DAPCSGLG
Sbjct: 276 GKVVALDIHEHKLKLIEENAKRLGLTN-IETKALDARKVHEKFAEKFDKILVDAPCSGLG 334

Query: 419 VLSK 422
           V+ +
Sbjct: 335 VIRR 338

Length = 444
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|216253 pfam01029, NusB, NusB family Back     alignment and domain information
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|238343 cd00620, Methyltransferase_Sun, N-terminal RNA binding domain of the methyltransferase Sun Back     alignment and domain information
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|238253 cd00447, NusB_Sun, RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>gnl|CDD|233652 TIGR01951, nusB, transcription antitermination factor NusB Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|234686 PRK00202, nusB, transcription antitermination protein NusB; Reviewed Back     alignment and domain information
>gnl|CDD|223852 COG0781, NusB, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|238342 cd00619, Terminator_NusB, Transcription termination factor NusB (N protein-Utilization Substance B) Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|202251 pfam02475, Met_10, Met-10+ like-protein Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216666 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 456
PRK14901434 16S rRNA methyltransferase B; Provisional 100.0
PRK14903431 16S rRNA methyltransferase B; Provisional 100.0
PRK10901427 16S rRNA methyltransferase B; Provisional 100.0
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 100.0
PRK14902444 16S rRNA methyltransferase B; Provisional 100.0
PRK14904445 16S rRNA methyltransferase B; Provisional 100.0
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 100.0
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 100.0
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 100.0
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 100.0
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 100.0
PRK00202137 nusB transcription antitermination protein NusB; R 99.94
PF01029134 NusB: NusB family; InterPro: IPR006027 This domain 99.94
cd00619130 Terminator_NusB Transcription termination factor N 99.94
TIGR01951129 nusB transcription antitermination factor NusB. A 99.94
cd00620126 Methyltransferase_Sun N-terminal RNA binding domai 99.94
COG0781151 NusB Transcription termination factor [Transcripti 99.92
KOG2198375 consensus tRNA cytosine-5-methylases and related e 99.91
cd00447129 NusB_Sun RNA binding domain of NusB (N protein-Uti 99.9
PRK09634207 nusB transcription antitermination protein NusB; P 99.87
KOG2360413 consensus Proliferation-associated nucleolar prote 99.85
COG4123248 Predicted O-methyltransferase [General function pr 99.45
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.3
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.28
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.28
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.27
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.26
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.24
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.23
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 99.22
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.22
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.21
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.21
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.21
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.2
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.2
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.2
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.17
PRK14967223 putative methyltransferase; Provisional 99.17
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.17
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.17
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.16
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.15
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.15
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.14
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.12
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.11
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.11
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.1
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.1
PLN02476278 O-methyltransferase 99.09
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.09
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.09
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 99.09
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.08
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.08
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.07
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.06
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.06
PRK07402196 precorrin-6B methylase; Provisional 99.04
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.04
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.04
COG4122219 Predicted O-methyltransferase [General function pr 99.03
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.02
PRK04266226 fibrillarin; Provisional 99.02
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.02
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.0
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.99
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.99
PTZ00146293 fibrillarin; Provisional 98.99
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.98
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.98
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.98
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.97
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.97
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.96
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.96
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.95
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.95
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.95
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.94
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.93
COG2890280 HemK Methylase of polypeptide chain release factor 98.93
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.93
PRK14968188 putative methyltransferase; Provisional 98.9
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.88
PLN02233261 ubiquinone biosynthesis methyltransferase 98.86
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.85
PLN02589247 caffeoyl-CoA O-methyltransferase 98.84
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.83
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.82
PHA03412241 putative methyltransferase; Provisional 98.81
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.8
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.8
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.78
PLN02244 340 tocopherol O-methyltransferase 98.77
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.77
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.77
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.76
KOG2904328 consensus Predicted methyltransferase [General fun 98.76
PRK11207197 tellurite resistance protein TehB; Provisional 98.76
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.76
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.75
TIGR00438188 rrmJ cell division protein FtsJ. 98.75
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.71
COG2520341 Predicted methyltransferase [General function pred 98.7
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.69
PRK10742250 putative methyltransferase; Provisional 98.68
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.67
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.67
PLN03075296 nicotianamine synthase; Provisional 98.66
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.65
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.63
KOG2730263 consensus Methylase [General function prediction o 98.63
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.63
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.62
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.61
PRK04457262 spermidine synthase; Provisional 98.61
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.6
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.58
PLN02672 1082 methionine S-methyltransferase 98.58
PHA03411 279 putative methyltransferase; Provisional 98.58
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.57
COG1041347 Predicted DNA modification methylase [DNA replicat 98.57
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.56
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.55
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.54
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.54
PRK08317 241 hypothetical protein; Provisional 98.54
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.54
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.53
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.52
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.51
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.5
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.49
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.46
PRK12335287 tellurite resistance protein TehB; Provisional 98.45
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.43
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.42
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.42
PRK06202232 hypothetical protein; Provisional 98.41
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.41
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.41
PRK00811283 spermidine synthase; Provisional 98.4
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.4
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.39
PLN02336475 phosphoethanolamine N-methyltransferase 98.38
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.38
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.37
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 98.37
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 98.36
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.36
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 98.35
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.35
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 98.34
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.33
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 98.3
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.3
PRK06922 677 hypothetical protein; Provisional 98.29
PRK05785226 hypothetical protein; Provisional 98.27
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.26
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.22
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.21
KOG1271227 consensus Methyltransferases [General function pre 98.2
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 98.2
TIGR00452314 methyltransferase, putative. Known examples to dat 98.19
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 98.19
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.18
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.18
PLN02366308 spermidine synthase 98.17
PRK01581374 speE spermidine synthase; Validated 98.16
COG2521287 Predicted archaeal methyltransferase [General func 98.15
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.15
TIGR03438 301 probable methyltransferase. This model represents 98.14
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.13
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.12
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.09
PRK03612521 spermidine synthase; Provisional 98.08
PLN02336 475 phosphoethanolamine N-methyltransferase 98.07
PLN02490 340 MPBQ/MSBQ methyltransferase 98.07
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.03
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.02
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.01
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.0
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.99
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 97.97
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.97
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.96
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 97.91
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.91
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.9
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.9
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 97.89
COG4076 252 Predicted RNA methylase [General function predicti 97.84
COG0286 489 HsdM Type I restriction-modification system methyl 97.83
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.83
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.82
PLN02823 336 spermine synthase 97.79
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 97.79
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 97.78
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.77
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.76
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.72
KOG2671421 consensus Putative RNA methylase [Replication, rec 97.69
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.68
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.65
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.63
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.6
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.6
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.59
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.53
PRK04148134 hypothetical protein; Provisional 97.51
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 97.5
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.47
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.44
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.44
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 97.44
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.43
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.42
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 97.35
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.35
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.33
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.32
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.32
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.28
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.16
PF13679141 Methyltransf_32: Methyltransferase domain 97.15
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.12
COG3897218 Predicted methyltransferase [General function pred 97.12
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.08
KOG4300252 consensus Predicted methyltransferase [General fun 97.03
KOG1099 294 consensus SAM-dependent methyltransferase/cell div 97.02
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 96.98
KOG3010261 consensus Methyltransferase [General function pred 96.89
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 96.89
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 96.87
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.84
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 96.73
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 96.66
PHA01634156 hypothetical protein 96.64
KOG1227351 consensus Putative methyltransferase [General func 96.55
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 96.52
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 96.52
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 96.37
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 96.35
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.33
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.15
KOG2078 495 consensus tRNA modification enzyme [RNA processing 96.06
KOG2899 288 consensus Predicted methyltransferase [General fun 96.02
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 95.95
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 95.92
KOG2782 303 consensus Putative SAM dependent methyltransferase 95.9
COG4262508 Predicted spermidine synthase with an N-terminal m 95.86
KOG1098 780 consensus Putative SAM-dependent rRNA methyltransf 95.78
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 95.7
COG1568354 Predicted methyltransferases [General function pre 95.62
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 95.57
PRK10458 467 DNA cytosine methylase; Provisional 95.37
TIGR00497 501 hsdM type I restriction system adenine methylase ( 95.36
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 95.31
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 95.29
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 95.28
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 94.94
COG2384226 Predicted SAM-dependent methyltransferase [General 94.83
PRK00536262 speE spermidine synthase; Provisional 94.65
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 94.16
PRK11524284 putative methyltransferase; Provisional 93.99
KOG1501 636 consensus Arginine N-methyltransferase [General fu 93.95
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 93.73
KOG2361264 consensus Predicted methyltransferase [General fun 93.71
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 93.19
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 93.12
COG2933358 Predicted SAM-dependent methyltransferase [General 93.0
PLN02232160 ubiquinone biosynthesis methyltransferase 93.0
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 92.94
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 92.73
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 92.05
PRK13699227 putative methylase; Provisional 92.02
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 92.01
PRK10611287 chemotaxis methyltransferase CheR; Provisional 91.03
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 89.62
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 89.59
COG3129292 Predicted SAM-dependent methyltransferase [General 88.53
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 87.96
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 87.75
KOG3115249 consensus Methyltransferase-like protein [General 87.07
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 85.91
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 85.18
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 83.07
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 83.0
KOG0821 326 consensus Predicted ribosomal RNA adenine dimethyl 82.08
COG2961279 ComJ Protein involved in catabolism of external DN 80.26
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.4e-69  Score=561.86  Aligned_cols=368  Identities=35%  Similarity=0.516  Sum_probs=321.3

Q ss_pred             HHHHHHHHHHHHHHcCCCchHHHhhcCCCCCCCcchhhhhhhccCCCCCCHHHHHHHHHHHHHHHHhHHHHHHHHHHhcc
Q 012783           59 PHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDDRDLRLVTDIVGGTIRWRRYLDHLICLLCH  138 (456)
Q Consensus        59 ~aR~~A~~~L~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~~~~lv~gv~r~~~~lD~~i~~~~~  138 (456)
                      ++|+.|+++||+++. +.+++.+++..                +....++++|++|+++|||||+|++..||++|+++++
T Consensus         2 ~~R~~A~~~L~~i~~-~~~~~~~l~~~----------------~~~~~l~~~dr~~~~~lv~gvlr~~~~lD~~i~~~~~   64 (434)
T PRK14901          2 NARQLAWEILQAVAR-GAYADVALERV----------------LRKYPLSGADRALVTELVYGCIRRRRTLDAWIDQLGK   64 (434)
T ss_pred             CHHHHHHHHHHHHHc-CCchHHHHHHH----------------HHhcCCChhHHHHHHHHHHHHHHhHHHHHHHHHHhcC
Confidence            479999999999988 47777766542                1234588999999999999999999999999999987


Q ss_pred             CCCCCCcccHHHHHHHHHHHHHHHhcC-CCChhHHHHHHHHHHhhcCCCchhhHHHHHHHHHhhhcCC-CCCCCcccCCc
Q 012783          139 DEKTFSSMEPLLLQILRIGFYEIVKLD-MPPYAVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNN-SLPLPKLEGND  216 (456)
Q Consensus       139 ~~~~~~~l~~~~~~iLrlg~yell~~~-~p~~a~inE~V~lak~~~~~~~~~fVNaVLr~i~r~~~~~-~~~~~~~~~~~  216 (456)
                        |++.++++++++|||||+|||+|++ +|++++|||+|++||.++.+..++|||||||++.+..+.. ..+.+      
T Consensus        65 --~~~~~l~~~~r~iLrla~yel~~~~~~p~~aavneaVelak~~~~~~~~~fVNgVLr~~~r~~~~~~~~~~~------  136 (434)
T PRK14901         65 --KPAHKQPPDLRWLLHLGLYQLRYMDRIPASAAVNTTVELAKQNGLGGLAGVVNGILRQYLRAREAGDPLPLP------  136 (434)
T ss_pred             --CChhhcCHHHHHHHHHHHHHHHhCccCCcHHHHHHHHHHHHHcCchhhhhhcCHHHHHHHHhhhccccccCC------
Confidence              6678899999999999999999997 8999999999999999998889999999999999964321 11111      


Q ss_pred             hHHHHHHHHHhCChHHHHHHHHHhcCHHHHHHHHHhcCCCCCeEEEEcCCCCCCHHHHHHHHhcCCCCceeccCCCceEE
Q 012783          217 RAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIR  296 (456)
Q Consensus       217 ~~~~~~la~~~s~P~wlv~~~~~~~g~~~~~~~l~~~~~~~p~~lRvN~~k~~s~~~~~~~L~~~gi~~~~~~~~~~~~~  296 (456)
                      ....+.+++.||+|.||+++|.+.||.+++++++++++.++|+++|||+++ ++++++.+.|++.|+.++..+++++.++
T Consensus       137 ~~~~~~l~~~~s~P~wl~~~~~~~~g~~~~~~~~~~~~~~~~~~~Rvn~~k-~~~~~~~~~l~~~g~~~~~~~~~~~~~~  215 (434)
T PRK14901        137 EDPIERLAILHSFPDWLVKLWLEWLGLEEAEQLCKWFNQPPSLDLRINPLR-TSLEEVQAALAEAGITATPIPGLPQGLR  215 (434)
T ss_pred             cChHHHHHHHhCCcHHHHHHHHHHhCHHHHHHHHHHhCCCCCeEEEECCCC-CCHHHHHHHHHHCCCceEECCCCCCeEE
Confidence            123567999999999999999999999999999999999999999999999 7999999999999999999999999998


Q ss_pred             EeCCCcchhcccccccccccccchHHHHHHHhcCCCCCCeEEEEcCCCchHHHHHHHHcCCCceEEEEeCCHHHHHHHHH
Q 012783          297 VKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNE  376 (456)
Q Consensus       297 i~~~~~~~~~~~~~~~G~~~vQd~ss~lv~~~l~~~~g~~VLDlcAGpGgkt~~la~~~~~~g~V~AvDis~~rl~~l~~  376 (456)
                      +......+...+.|++|.+++||.+|++++..+++++|++|||+|||||+||+++++.+++.|+|+|+|++++|++.+++
T Consensus       216 ~~~~~~~~~~~~~f~~g~~~~qd~~s~l~~~~l~~~~g~~VLDl~ag~G~kt~~la~~~~~~g~v~a~D~~~~rl~~~~~  295 (434)
T PRK14901        216 LTGNPGSIRQLPGYEEGWWTVQDRSAQLVAPLLDPQPGEVILDACAAPGGKTTHIAELMGDQGEIWAVDRSASRLKKLQE  295 (434)
T ss_pred             ecCCCCccccChHHhCCeEEEECHHHHHHHHHhCCCCcCEEEEeCCCCchhHHHHHHHhCCCceEEEEcCCHHHHHHHHH
Confidence            87532246677899999999999999999999999999999999999999999999999888999999999999999999


Q ss_pred             HHHHcCCCceEEEEecccccccc---cCCCCccEEEEcCCCCCCcccccCCCccccccccchhhhhhchHhHHHHHHHhh
Q 012783          377 TAKLHQVNSVIRTIHADLRTFAD---NSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKY  453 (456)
Q Consensus       377 n~~r~g~~~~V~~~~~Da~~~~~---~~~~~fD~VllDaPCSg~G~irr~p~~~~~wr~~~~~~~~~~~~~~~~l~~~~~  453 (456)
                      |++++|+.+ |+++++|+..++.   ...++||.|++||||||+|+++|+||+  +|+. +...+.....+|..|...++
T Consensus       296 n~~r~g~~~-v~~~~~D~~~~~~~~~~~~~~fD~Vl~DaPCSg~G~~~r~p~~--~~~~-~~~~~~~l~~~Q~~iL~~a~  371 (434)
T PRK14901        296 NAQRLGLKS-IKILAADSRNLLELKPQWRGYFDRILLDAPCSGLGTLHRHPDA--RWRQ-TPEKIQELAPLQAELLESLA  371 (434)
T ss_pred             HHHHcCCCe-EEEEeCChhhcccccccccccCCEEEEeCCCCcccccccCcch--hhhC-CHHHHHHHHHHHHHHHHHHH
Confidence            999999987 8999999987652   123689999999999999999999998  6764 34455666677888888877


Q ss_pred             hcC
Q 012783          454 LLL  456 (456)
Q Consensus       454 ~ll  456 (456)
                      .+|
T Consensus       372 ~~l  374 (434)
T PRK14901        372 PLL  374 (434)
T ss_pred             Hhc
Confidence            664

>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK00202 nusB transcription antitermination protein NusB; Reviewed Back     alignment and domain information
>PF01029 NusB: NusB family; InterPro: IPR006027 This domain is found in a number of functionally different proteins: NusB a prokaryotic transcription factor involved in antitermination TIM44, the mitochondrial inner membrane translocase subunit RsmB, the 16S rRNA m5C967 methyltransferase NusB is a prokaryotic transcription factor involved in antitermination processes, during which it interacts with the boxA portion of the mRNA nut site Back     alignment and domain information
>cd00619 Terminator_NusB Transcription termination factor NusB (N protein-Utilization Substance B) Back     alignment and domain information
>TIGR01951 nusB transcription antitermination factor NusB Back     alignment and domain information
>cd00620 Methyltransferase_Sun N-terminal RNA binding domain of the methyltransferase Sun Back     alignment and domain information
>COG0781 NusB Transcription termination factor [Transcription] Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00447 NusB_Sun RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>PRK09634 nusB transcription antitermination protein NusB; Provisional Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>KOG2782 consensus Putative SAM dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG0821 consensus Predicted ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
2yxl_A450 Crystal Structure Of Ph0851 Length = 450 3e-20
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 5e-19
3m6u_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 1e-15
3m6w_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 1e-15
3m6x_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 6e-15
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 1e-14
3m4x_A 456 Structure Of A Ribosomal Methyltransferase Length = 3e-14
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 5e-13
2frx_A 479 Crystal Structure Of Yebu, A M5c Rna Methyltransfer 1e-10
2b9e_A309 Human Nsun5 Protein Length = 309 6e-10
4fp9_A360 Human Mterf4-Nsun4 Protein Complex Length = 360 3e-04
4fzv_A359 Crystal Structure Of The Human Mterf4:nsun4:sam Ter 4e-04
>pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450 Back     alignment and structure 
Iteration: 1

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (49%), Gaps = 4/210 (1%)
Query: 215 NDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADL 274
           N + +   L   Y  P W++ R    LG E        N      S+R N+ K     ++
Sbjct: 143 NPKNELEELEWKYLAPSWLIERVKGILGDETEDFFRSVNKRHEWISIRVNTLKANVE-EV 201
Query: 275 VMQLNLLKVPHELSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPG 334
           + +L    V    S  +   +++K G  N   +    EG   VQ+E++ +   V+DP+PG
Sbjct: 202 IGELEEDGVEVVRSERVPTILKIK-GPYNFDTSSAFNEGKIIVQEEASAVASIVLDPKPG 260
Query: 335 QSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADL 394
           +++VD  AAPGGKT ++A  +  +G +YA D++K R++ L +  K   +  +++ +  D 
Sbjct: 261 ETVVDLAAAPGGKTTHLAELMKNKGKIYAFDVDKMRMKRLKDFVKRMGIK-IVKPLVKDA 319
Query: 395 RTFADNSTVK-CDKVLLDAPCSGLGVLSKT 423
           R   +    +  DKVLLDAPC+  G + K 
Sbjct: 320 RKAPEIIGEEVADKVLLDAPCTSSGTIGKN 349
>pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 Back     alignment and structure
>pdb|3M6U|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group 43 Length = 464 Back     alignment and structure
>pdb|3M6W|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 In Complex With S-Adenosyl-L- Methionine Length = 464 Back     alignment and structure
>pdb|3M6X|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 Length = 464 Back     alignment and structure
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure
>pdb|3M4X|A Chain A, Structure Of A Ribosomal Methyltransferase Length = 456 Back     alignment and structure
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure
>pdb|2FRX|A Chain A, Crystal Structure Of Yebu, A M5c Rna Methyltransferase From E.Coli Length = 479 Back     alignment and structure
>pdb|2B9E|A Chain A, Human Nsun5 Protein Length = 309 Back     alignment and structure
>pdb|4FP9|A Chain A, Human Mterf4-Nsun4 Protein Complex Length = 360 Back     alignment and structure
>pdb|4FZV|A Chain A, Crystal Structure Of The Human Mterf4:nsun4:sam Ternary Complex Length = 359 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 5e-98
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 4e-88
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 3e-54
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 1e-48
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 5e-48
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 1e-47
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 3e-43
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 6e-38
3d3b_A141 Protein NUSB, N utilization substance protein B; N 1e-13
3r2d_A149 Protein NUSB, N utilization substance protein B; c 3e-11
1eyv_A156 NUSB protein, N-utilizing substance protein B homo 7e-11
1tzv_A142 NUSB protein, N utilization substance protein B ho 3e-10
1yb2_A275 Hypothetical protein TA0852; structural genomics, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3dh0_A219 SAM dependent methyltransferase; cystal structure, 2e-06
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 4e-06
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 8e-06
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 1e-05
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 1e-05
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 1e-05
3f4k_A257 Putative methyltransferase; structural genomics, P 2e-05
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 3e-05
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 4e-05
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 9e-05
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 2e-04
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 2e-04
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 3e-04
2frn_A278 Hypothetical protein PH0793; structural genomics, 3e-04
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 3e-04
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 4e-04
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 5e-04
3i9f_A170 Putative type 11 methyltransferase; structural gen 5e-04
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 7e-04
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 9e-04
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
 Score =  300 bits (771), Expect = 5e-98
 Identities = 81/374 (21%), Positives = 147/374 (39%), Gaps = 29/374 (7%)

Query: 50  TQNLNLEVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDD 109
            +   L + P    + +  +R+      +                        +    + 
Sbjct: 3   AEKKKLSIPPKGIRAIIEAIRLGEIIKPSQYA--------------KREAFK-KHDVEEA 47

Query: 110 RDLRLVTDIVGGTIRWRRYLDHLICLLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPY 169
              R++T I    ++ +  +D +I  +     T   ++P L   LR+     +  D P  
Sbjct: 48  WLNRVLTMIFYDIMKKQGLIDKVIKEIVG--VTPLILDPWLRAALRVAVDIALFHD-PSS 104

Query: 170 AVVDENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLPKLEGNDRAQARALATIYSH 229
             +      A   +       V       +L K     P PK       +   L   Y  
Sbjct: 105 QTIKNLRWKASDFISSRTHPYVGMYFWD-LLDKIFEYKPNPK------NELEELEWKYLA 157

Query: 230 PVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSL 289
           P W++ R    LG E        N      S+R N+ K     +++ +L    V    S 
Sbjct: 158 PSWLIERVKGILGDETEDFFRSVNKRHEWISIRVNTLK-ANVEEVIGELEEDGVEVVRSE 216

Query: 290 HLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTL 349
            +   +++K    N   +    EG   VQ+E++ +   V+DP+PG+++VD  AAPGGKT 
Sbjct: 217 RVPTILKIKGP-YNFDTSSAFNEGKIIVQEEASAVASIVLDPKPGETVVDLAAAPGGKTT 275

Query: 350 YMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKC-DKV 408
           ++A  +  +G +YA D++K R++ L +  K   +  +++ +  D R   +    +  DKV
Sbjct: 276 HLAELMKNKGKIYAFDVDKMRMKRLKDFVKRMGI-KIVKPLVKDARKAPEIIGEEVADKV 334

Query: 409 LLDAPCSGLGVLSK 422
           LLDAPC+  G + K
Sbjct: 335 LLDAPCTSSGTIGK 348
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>3d3b_A Protein NUSB, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermina antitermination; HET: NHE; 1.30A {Escherichia coli} PDB: 3d3c_A 3imq_A 1ey1_A Length = 141 Back     alignment and structure
>3r2d_A Protein NUSB, N utilization substance protein B; cross species NUSB-NUSE-RNA interaction; 2.20A {Aquifex aeolicus} PDB: 2jr0_A 3r2c_A* Length = 149 Back     alignment and structure
>1eyv_A NUSB protein, N-utilizing substance protein B homolog; helical bundle, structural genomics, PSI, protein structure initiative; 1.60A {Mycobacterium tuberculosis} SCOP: a.79.1.1 Length = 156 Back     alignment and structure
>1tzv_A NUSB protein, N utilization substance protein B homolog; RNA-protein interaction, transcriptional antitermination, transcription regulation; 1.35A {Thermotoga maritima} SCOP: a.79.1.1 PDB: 1tzu_A 1tzt_A 1tzw_A 1tzx_A* Length = 142 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Length = 233 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Length = 230 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A* Length = 278 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Length = 396 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Length = 227 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 100.0
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 100.0
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 100.0
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 100.0
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 100.0
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 100.0
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 100.0
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.97
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 99.97
1tzv_A142 NUSB protein, N utilization substance protein B ho 99.96
3r2d_A149 Protein NUSB, N utilization substance protein B; c 99.96
3d3b_A141 Protein NUSB, N utilization substance protein B; N 99.96
1eyv_A156 NUSB protein, N-utilizing substance protein B homo 99.95
3lpm_A259 Putative methyltransferase; structural genomics, p 99.53
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.45
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.42
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.41
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.39
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.38
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.36
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.36
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.36
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.35
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.35
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.34
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.33
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.33
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.32
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.32
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.3
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.3
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.3
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.3
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.3
3k6r_A278 Putative transferase PH0793; structural genomics, 99.3
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.29
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.29
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.28
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.27
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.26
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.26
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.26
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.25
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.25
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.25
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.24
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.23
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.23
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.23
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.22
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.21
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.2
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.19
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.18
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.17
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.17
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.17
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.16
2h00_A254 Methyltransferase 10 domain containing protein; st 99.15
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.15
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.14
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.14
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.14
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.12
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.12
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.12
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.11
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.1
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.1
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.09
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.08
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.08
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.08
2b25_A336 Hypothetical protein; structural genomics, methyl 99.06
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.06
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.05
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.05
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.05
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.04
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.04
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.04
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.04
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.03
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 99.03
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.03
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.03
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.02
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.0
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.0
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.99
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 98.99
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.99
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.99
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.99
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.98
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.98
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.98
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.97
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.97
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.97
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.96
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 98.96
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.96
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.95
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.95
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.95
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.94
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.94
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.94
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.94
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.93
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.93
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.93
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.92
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 98.92
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.92
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.91
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.9
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.9
3f4k_A257 Putative methyltransferase; structural genomics, P 98.89
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.88
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.87
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.86
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.86
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.85
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.85
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.84
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.84
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.84
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.83
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.83
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.83
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.83
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.8
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.8
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.8
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 98.8
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.79
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.78
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.78
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.78
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.77
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.76
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.75
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.75
3ocj_A305 Putative exported protein; structural genomics, PS 98.75
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 98.74
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.74
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.74
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.74
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.73
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.72
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.72
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.71
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.71
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.71
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.71
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.7
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.69
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.69
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.69
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.68
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.68
3lkd_A 542 Type I restriction-modification system methyltrans 98.67
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.67
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.67
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.67
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.66
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.66
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.66
2o07_A304 Spermidine synthase; structural genomics, structur 98.65
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 98.65
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.65
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.65
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.64
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.64
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.64
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.63
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.63
3khk_A 544 Type I restriction-modification system methylation 98.63
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.62
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.61
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 98.61
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.61
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.6
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.59
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.59
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.59
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 98.59
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.58
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.58
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.58
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 98.58
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.58
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.57
2pt6_A321 Spermidine synthase; transferase, structural genom 98.57
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.57
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 98.57
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.57
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.55
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.55
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.54
2i7c_A283 Spermidine synthase; transferase, structural genom 98.54
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.53
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.53
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.53
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.52
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.52
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.52
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.51
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.51
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.51
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.5
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.5
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.5
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.5
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.49
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 98.48
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.48
3lcc_A235 Putative methyl chloride transferase; halide methy 98.47
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.47
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.45
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.45
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.45
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.44
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.43
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 98.42
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.42
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 98.41
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 98.41
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.41
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.39
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.39
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.38
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.38
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.37
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.36
3ufb_A 530 Type I restriction-modification system methyltran 98.36
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.35
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.35
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.34
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.34
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.33
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.3
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.3
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.3
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.29
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.28
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.28
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.28
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 98.25
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.24
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.24
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.23
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.23
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.22
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.22
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.21
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.19
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.19
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.18
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.14
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.13
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.13
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.12
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.12
2px2_A269 Genome polyprotein [contains: capsid protein C (co 98.11
3cc8_A230 Putative methyltransferase; structural genomics, j 98.08
2oo3_A283 Protein involved in catabolism of external DNA; st 98.07
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 97.97
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.97
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.97
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.94
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 97.91
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 97.91
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.9
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.89
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.84
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 97.82
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.78
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.74
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.74
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.71
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.7
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.61
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 97.58
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.55
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.48
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.41
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 97.4
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 97.32
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.23
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.22
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 97.14
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.13
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 97.12
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 97.12
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.09
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.07
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.07
2zig_A297 TTHA0409, putative modification methylase; methylt 97.06
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 97.04
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.0
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 96.98
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 96.81
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 96.78
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.75
3me5_A 482 Cytosine-specific methyltransferase; structural ge 96.67
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 96.65
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 96.6
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 96.55
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 96.55
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 95.28
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 94.94
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 94.55
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 93.28
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 93.06
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 92.6
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 92.59
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 91.66
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.56
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 91.34
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 91.3
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 91.24
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 91.17
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 90.53
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 90.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 89.68
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 88.09
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 88.08
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 87.64
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 85.24
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 85.2
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 84.45
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 83.87
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 82.98
3gms_A340 Putative NADPH:quinone reductase; structural genom 82.85
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 82.22
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 81.9
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 81.82
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 81.74
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 81.1
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 80.58
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
Probab=100.00  E-value=1.3e-63  Score=523.30  Aligned_cols=364  Identities=24%  Similarity=0.347  Sum_probs=314.7

Q ss_pred             CCcHHHHHHHHHHHHHHcCCCchHHHhhcCCCCCCCcchhhhhhhccCCCCCCH-HHHHHHHHHHHHHHHhHHHHHHHHH
Q 012783           56 EVSPHRAVSAVRLMRIQFGGAFADLLNKKGKGSGDNEMGYVERTLGFRTKDLDD-RDLRLVTDIVGGTIRWRRYLDHLIC  134 (456)
Q Consensus        56 ~~~~aR~~A~~~L~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~-~d~~~~~~lv~gv~r~~~~lD~~i~  134 (456)
                      +..++|+.|+++||+++.++.+++.++...          +      +...+++ +|++|+++|||||+||+..||++|+
T Consensus         9 ~~~~~R~~A~~~L~~v~~~~~~~~~~l~~~----------~------~~~~l~~~~dr~~~~~lv~gvlr~~~~ld~~i~   72 (450)
T 2yxl_A            9 SIPPKGIRAIIEAIRLGEIIKPSQYAKREA----------F------KKHDVEEAWLNRVLTMIFYDIMKKQGLIDKVIK   72 (450)
T ss_dssp             CCCHHHHHHHHHHHHHTTTSSSTHHHHHHH----------H------HHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcchHHHHHHHHHHHHHhcCCcHHHHHHHH----------H------HhccCCcHHHHHHHHHHHHHHHHhHHHHHHHHH
Confidence            345899999999999998888888765432          1      1234777 9999999999999999999999999


Q ss_pred             HhccCCCCCCcccHHHHHHHHHHHHHHHhcCCCChhHHH----HHHHHHHhhcCCCchhhHHHHHHHHHhhhcCCCCCCC
Q 012783          135 LLCHDEKTFSSMEPLLLQILRIGFYEIVKLDMPPYAVVD----ENVRLAKVALRPGAGNLVNGILRKLVLLKDNNSLPLP  210 (456)
Q Consensus       135 ~~~~~~~~~~~l~~~~~~iLrlg~yell~~~~p~~a~in----E~V~lak~~~~~~~~~fVNaVLr~i~r~~~~~~~~~~  210 (456)
                      ++++  .++++++++++++||+|+|||+| ++|++++||    |+|++||.++++.+++|||||||++.+.+.    .. 
T Consensus        73 ~~~~--~~~~~~~~~~~~iLrla~yell~-~ip~~~ain~~~~eaVelak~~~~~~~~~fvNgvL~~~~r~~~----~~-  144 (450)
T 2yxl_A           73 EIVG--VTPLILDPWLRAALRVAVDIALF-HDPSSQTIKNLRWKASDFISSRTHPYVGMYFWDLLDKIFEYKP----NP-  144 (450)
T ss_dssp             HHHS--SCGGGSCHHHHHHHHHHHHHHHH-SCBCHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHTCCC----CC-
T ss_pred             Hhcc--CChhhcCHHHHHHHHHHHHHHhc-CCCchHHhccccHHHHHHHHhccccccccchHHHHHHHhhccc----cc-
Confidence            9998  47889999999999999999999 999999999    999999999888889999999999998531    01 


Q ss_pred             cccCCchHHHHHHHHHhCChHHHHHHHHHhcCHHHHHHHHHhcC-CCCCeEEEEcCCCCCCHHHHHHHHhcCCCCceecc
Q 012783          211 KLEGNDRAQARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNN-SDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSL  289 (456)
Q Consensus       211 ~~~~~~~~~~~~la~~~s~P~wlv~~~~~~~g~~~~~~~l~~~~-~~~p~~lRvN~~k~~s~~~~~~~L~~~gi~~~~~~  289 (456)
                      .      +..+.+++.||||.|++++|.+.|| +++++++++++ .++|+++|||+++ ++++++.+.|++.|+..++.+
T Consensus       145 ~------~~~~~~~~~~~~P~w~~~~~~~~~g-~~~~~~~~a~~~~~~~~~~Rvn~~k-~~~~~~~~~L~~~g~~~~~~~  216 (450)
T 2yxl_A          145 K------NELEELEWKYLAPSWLIERVKGILG-DETEDFFRSVNKRHEWISIRVNTLK-ANVEEVIGELEEDGVEVVRSE  216 (450)
T ss_dssp             C------SHHHHHHHHHTSCHHHHHHHHHHHG-GGHHHHHHHHHCCCCEEEEEECTTT-CCHHHHHHHHHHTTCCEEECS
T ss_pred             c------chhhhhhhHhcCcHHHHHHHHHHhh-HHHHHHHHhcCCCCCCEEEEEcCCC-CCHHHHHHHHHhCCccceecC
Confidence            0      1246789999999999999999999 88999999999 9999999999999 799999999999999999999


Q ss_pred             CCCceEEEeCCCcchhcccccccccccccchHHHHHHHhcCCCCCCeEEEEcCCCchHHHHHHHHcCCCceEEEEeCCHH
Q 012783          290 HLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKG  369 (456)
Q Consensus       290 ~~~~~~~i~~~~~~~~~~~~~~~G~~~vQd~ss~lv~~~l~~~~g~~VLDlcAGpGgkt~~la~~~~~~g~V~AvDis~~  369 (456)
                      ++++.+.+..+. .+...+.|.+|.+++||.+|++++..+++++|++|||+|||||++|+++++.+++.++|+|+|+++.
T Consensus       217 ~~~~~~~~~~~~-~~~~~~~~~~G~~~~qd~~s~l~~~~l~~~~g~~VLDlgaG~G~~t~~la~~~~~~~~v~a~D~s~~  295 (450)
T 2yxl_A          217 RVPTILKIKGPY-NFDTSSAFNEGKIIVQEEASAVASIVLDPKPGETVVDLAAAPGGKTTHLAELMKNKGKIYAFDVDKM  295 (450)
T ss_dssp             SCTTEEEEESCC-CTTSCHHHHTTSEEECCHHHHHHHHHHCCCTTCEEEESSCTTCHHHHHHHHHTTTCSEEEEECSCHH
T ss_pred             ccCceEEeCCCC-CcccCchhhCceEEecCchhHHHHHhcCCCCcCEEEEeCCCccHHHHHHHHHcCCCCEEEEEcCCHH
Confidence            999999886432 4677889999999999999999999999999999999999999999999999877799999999999


Q ss_pred             HHHHHHHHHHHcCCCceEEEEecccccccccCC-CCccEEEEcCCCCCCcccccCCCccccccccchhhhhhchHhHHHH
Q 012783          370 RLRILNETAKLHQVNSVIRTIHADLRTFADNST-VKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHL  448 (456)
Q Consensus       370 rl~~l~~n~~r~g~~~~V~~~~~Da~~~~~~~~-~~fD~VllDaPCSg~G~irr~p~~~~~wr~~~~~~~~~~~~~~~~l  448 (456)
                      +++.+++|++++|+.+ +.++++|+..++.... +.||+|++||||||+|+++++||.  +|+. +..........|..+
T Consensus       296 ~l~~~~~~~~~~g~~~-v~~~~~D~~~~~~~~~~~~fD~Vl~D~Pcsg~g~~~~~pd~--~~~~-~~~~~~~l~~~q~~i  371 (450)
T 2yxl_A          296 RMKRLKDFVKRMGIKI-VKPLVKDARKAPEIIGEEVADKVLLDAPCTSSGTIGKNPEL--RWRL-REDKINEMSQLQREL  371 (450)
T ss_dssp             HHHHHHHHHHHTTCCS-EEEECSCTTCCSSSSCSSCEEEEEEECCCCCGGGTTTSTTH--HHHC-CTTSHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCCCc-EEEEEcChhhcchhhccCCCCEEEEcCCCCCCeeeccChhh--hhhC-CHHHHHHHHHHHHHH
Confidence            9999999999999986 8999999987653222 679999999999999999999998  4432 223334444556666


Q ss_pred             HHHhhhcC
Q 012783          449 CETKYLLL  456 (456)
Q Consensus       449 ~~~~~~ll  456 (456)
                      ...+..+|
T Consensus       372 L~~a~~~L  379 (450)
T 2yxl_A          372 LESAARLV  379 (450)
T ss_dssp             HHHHHTTE
T ss_pred             HHHHHHhc
Confidence            66665543
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1tzv_A NUSB protein, N utilization substance protein B homolog; RNA-protein interaction, transcriptional antitermination, transcription regulation; 1.35A {Thermotoga maritima} SCOP: a.79.1.1 PDB: 1tzu_A 1tzt_A 1tzw_A 1tzx_A* Back     alignment and structure
>3r2d_A Protein NUSB, N utilization substance protein B; cross species NUSB-NUSE-RNA interaction; 2.20A {Aquifex aeolicus} PDB: 2jr0_A 3r2c_A* 4eya_A Back     alignment and structure
>3d3b_A Protein NUSB, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermina antitermination; HET: NHE; 1.30A {Escherichia coli} PDB: 3d3c_A 3imq_A 1ey1_A Back     alignment and structure
>1eyv_A NUSB protein, N-utilizing substance protein B homolog; helical bundle, structural genomics, PSI, protein structure initiative; 1.60A {Mycobacterium tuberculosis} SCOP: a.79.1.1 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 456
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 2e-22
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 3e-21
d1sqga1140 a.79.1.3 (A:5-144) Ribosomal RNA small subunit met 2e-17
d1eyva_131 a.79.1.1 (A:) Antitermination factor NusB {Mycobac 3e-15
d1tzva_141 a.79.1.1 (A:) Antitermination factor NusB {Thermot 1e-12
d1ey1a_139 a.79.1.1 (A:) Antitermination factor NusB {Escheri 1e-11
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 1e-10
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 1e-07
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 1e-06
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 2e-06
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 7e-06
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 9e-06
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 2e-05
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 2e-04
d1m6ya2192 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransf 3e-04
d2oyra1250 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shi 9e-04
d1wg8a2182 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransf 0.002
d1ej0a_180 c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric 0.003
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 95.1 bits (235), Expect = 2e-22
 Identities = 59/230 (25%), Positives = 93/230 (40%), Gaps = 7/230 (3%)

Query: 227 YSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHE 286
             +      R+ +  G E AI++            R N+ K ++  DLV +LN      +
Sbjct: 12  LGYSKLFADRYFQLWG-ERAIRIAEAMEKPLPRCFRVNTLK-ISVQDLVKRLNKKGFQFK 69

Query: 287 LSLHLDEFIRVKTGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGG 346
                 E   +     ++        GL  +Q+ S+      +DP+PG+ + D  AAPGG
Sbjct: 70  RVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGG 129

Query: 347 KTLYMASCLSGQGLVYAIDINKGRLRILNETAKLHQVNSVIRTIHADLRTFADNSTVKCD 406
           KT Y+A  +   G++YA D+++ RLR          V +VI    + L     N   + D
Sbjct: 130 KTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNV--EFD 187

Query: 407 KVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL 456
           K+LLDAPC+G G + K                     L   L E    +L
Sbjct: 188 KILLDAPCTGSGTIHKNPE---RKWNRTMDDIKFCQGLQMRLLEKGLEVL 234
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1sqga1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d1eyva_ a.79.1.1 (A:) Antitermination factor NusB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 131 Back     information, alignment and structure
>d1tzva_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]} Length = 141 Back     information, alignment and structure
>d1ey1a_ a.79.1.1 (A:) Antitermination factor NusB {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Length = 192 Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Length = 250 Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Length = 182 Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 100.0
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 100.0
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ey1a_139 Antitermination factor NusB {Escherichia coli [Tax 99.94
d1tzva_141 Antitermination factor NusB {Thermotoga maritima [ 99.94
d1sqga1140 Ribosomal RNA small subunit methyltransferase B, R 99.93
d1eyva_131 Antitermination factor NusB {Mycobacterium tubercu 99.92
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.54
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.53
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.42
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.41
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.4
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.4
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.39
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.38
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.37
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.36
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.36
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.34
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.33
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.29
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.27
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.26
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.26
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.24
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.21
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.21
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.2
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.18
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.17
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.17
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.16
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.15
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.12
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.09
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.08
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.05
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.02
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.02
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.99
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.92
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.9
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.9
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.89
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.87
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.87
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.85
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.85
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.85
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.85
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.85
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.85
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.85
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.83
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.81
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.8
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.77
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.77
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.77
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.66
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.65
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.57
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.57
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.56
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.54
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.54
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.52
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.51
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.51
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.5
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.5
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.48
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.41
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.38
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.38
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.37
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.35
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.33
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.23
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.21
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 98.18
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.13
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.04
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.01
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.96
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.92
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.9
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.75
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 97.74
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.71
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 97.69
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.68
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.6
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.59
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.57
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.49
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.4
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 97.36
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 97.23
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.01
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 96.93
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.92
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 96.87
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 96.69
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.49
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 96.19
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.04
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 95.89
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.86
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.79
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.64
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.49
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.37
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 95.29
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.12
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.97
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.89
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 94.82
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.57
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.53
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.02
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 93.81
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.71
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 93.46
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.09
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.4
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 92.31
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.28
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.25
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 91.48
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 90.34
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.68
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 88.39
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.16
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 87.88
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 86.16
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 84.34
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 81.53
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=2.8e-46  Score=371.50  Aligned_cols=230  Identities=26%  Similarity=0.338  Sum_probs=198.0

Q ss_pred             HHHHHHHHhCChHHHHHHHHHhcCHHHHHHHHHhcCCCCCeEEEEcCCCCCCHHHHHHHHhcCCCCceeccCCCceEEEe
Q 012783          219 QARALATIYSHPVWMVRRWTKYLGQEEAIKLMVWNNSDPSFSLRANSRKGVTRADLVMQLNLLKVPHELSLHLDEFIRVK  298 (456)
Q Consensus       219 ~~~~la~~~s~P~wlv~~~~~~~g~~~~~~~l~~~~~~~p~~lRvN~~k~~s~~~~~~~L~~~gi~~~~~~~~~~~~~i~  298 (456)
                      .++.+ ++|+||+||+++|.+.|| ++++++++++++++|+++|||++| ++++++++.|++.|+.++.++++++++.+.
T Consensus         5 ~~~~~-~~~~~p~wl~~~~~~~~G-ee~~~l~~a~~~~~p~~iRvN~~k-~~~e~~~~~L~~~g~~~~~~~~~~~~~~~~   81 (313)
T d1ixka_           5 MLDKL-LRLGYSKLFADRYFQLWG-ERAIRIAEAMEKPLPRCFRVNTLK-ISVQDLVKRLNKKGFQFKRVPWAKEGFCLT   81 (313)
T ss_dssp             HHHHH-HHTTCCHHHHHHHHHHHT-THHHHHHHHTTSCCCCEEEECTTT-SCHHHHHHHHHHTTCEEEEETTEEEEEEEE
T ss_pred             hhhHH-HHcCCCHHHHHHHHHHhh-HHHHHHHHHcCCCCCeEEEEcCCc-CCHHHHHHHHHhCCCceEECCCCcchhhhc
Confidence            45555 789999999999999999 578999999999999999999999 699999999999999999999999888886


Q ss_pred             CCCcchhcccccccccccccchHHHHHHHhcCCCCCCeEEEEcCCCchHHHHHHHHcCCCceEEEEeCCHHHHHHHHHHH
Q 012783          299 TGLQNVIQAGLLKEGLCAVQDESAGLVVAVVDPQPGQSIVDCCAAPGGKTLYMASCLSGQGLVYAIDINKGRLRILNETA  378 (456)
Q Consensus       299 ~~~~~~~~~~~~~~G~~~vQd~ss~lv~~~l~~~~g~~VLDlcAGpGgkt~~la~~~~~~g~V~AvDis~~rl~~l~~n~  378 (456)
                      .+...+..++.|++|.+++||.+|++++.+|++++|++|||+||||||||+++++.+.+.|.|+|+|+++.|++.+++|+
T Consensus        82 ~~~~~l~~~~~~~~G~~~vQD~aS~l~~~~l~~~~g~~vlD~CAapGgKt~~l~~~~~~~~~i~a~d~~~~r~~~l~~~~  161 (313)
T d1ixka_          82 REPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNL  161 (313)
T ss_dssp             ECSSCGGGSHHHHTTSEEECCHHHHHHHHHHCCCTTCEEEECCSSCSHHHHHHHHHTTTCSEEEEECSCHHHHHHHHHHH
T ss_pred             cCCCccccCHhhhhceEEEecccccchhhcccCCccceeeecccchhhhhHhhhhhcccccceeeeccCHHHHHHHHHHH
Confidence            55445778899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHcCCCceEEEEecccccccccCCCCccEEEEcCCCCCCcccccCCCccccccccchhhhhhchHhHHHHHHHhhhcC
Q 012783          379 KLHQVNSVIRTIHADLRTFADNSTVKCDKVLLDAPCSGLGVLSKTCVGIGDWRIWKSLRYCKTSFLMQHLCETKYLLL  456 (456)
Q Consensus       379 ~r~g~~~~V~~~~~Da~~~~~~~~~~fD~VllDaPCSg~G~irr~p~~~~~wr~~~~~~~~~~~~~~~~l~~~~~~ll  456 (456)
                      +++|+.| +.++..|...+... ...||+||+||||||+|+++|+|++  +|+. ......+....|..|...|..+|
T Consensus       162 ~r~~~~~-i~~~~~d~~~~~~~-~~~fD~ILvDaPCSg~G~~~r~p~~--~~~~-~~~~~~~l~~~Q~~iL~~a~~~l  234 (313)
T d1ixka_         162 SRLGVLN-VILFHSSSLHIGEL-NVEFDKILLDAPCTGSGTIHKNPER--KWNR-TMDDIKFCQGLQMRLLEKGLEVL  234 (313)
T ss_dssp             HHHTCCS-EEEESSCGGGGGGG-CCCEEEEEEECCTTSTTTCC----------C-CHHHHHHHHHHHHHHHHHHHHHE
T ss_pred             HHHHhhc-cccccccccccccc-cccccEEEEccccccCCceeeccch--hhhh-hhhHHHHHHHHHHHHHHhhhhee
Confidence            9999988 67888898776543 4689999999999999999999998  4443 23445556677778887777653
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ey1a_ a.79.1.1 (A:) Antitermination factor NusB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tzva_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sqga1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eyva_ a.79.1.1 (A:) Antitermination factor NusB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure