Citrus Sinensis ID: 012813

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------

MAKTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA

ccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccc

ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHccccccHHHccccEEEEccccccHHHHHHHHHcccccccccccEccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHEEcccccHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccc

maktgifdsdptvmpKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKrslslklhetvscpeefkcplskelmrdpvilasgqtfdrPYIQRWLkagnrtcprtqqvlshtiltpNHLIREMISQWCRsqgielpnsvqyineegiteaDRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMpsfralfgeshdaipqllsplseskcenginpnlqEDVITTLLNLSihdnnkklvaetpMVIPLLMDALRSGTIETRSNAAAALFTLSAldsnkevigksgalkpLIDLLDEGHQSAMKDVASAIFNLCIthenkaravrdGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA

maktgifdsdptvmpkATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKelktkkrslslklhetvscpeefkcplskelMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCIThenkaravrdgGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIREStcdrnkenCIAILHticlsdrtkWKAMReeesthgtisklaqdgtaraKRKAtgilerlkrtvnlthta

MAKTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCAlkelktkkrslslklHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA

**********************ELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLK******************L******FRALFG********************GINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWK********************************************

***T*******************LQKLV********************************************PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCR************************************************L*TKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLK*********

*****IFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELK************TVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPN************ADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTV******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		456	2.2.26 [Sep-21-2011]
Q9SRT0		460	U-box domain-containing p	yes	no	0.984	0.976	0.644	1e-166
Q3E9F7		458	Putative U-box domain-con	no	no	0.929	0.925	0.435	1e-88
Q5VRH9		611	U-box domain-containing p	no	no	0.844	0.630	0.421	1e-77
Q8VZ40		632	U-box domain-containing p	no	no	0.831	0.599	0.415	8e-73
Q8GUG9		612	U-box domain-containing p	no	no	0.815	0.607	0.407	1e-71
Q3E9F5		456	U-box domain-containing p	no	no	0.916	0.916	0.393	3e-70
Q9SNC6		660	U-box domain-containing p	no	no	0.802	0.554	0.396	6e-70
Q3E9F6		445	Putative U-box domain-con	no	no	0.940	0.964	0.375	4e-69
Q9ZV31		654	U-box domain-containing p	no	no	0.798	0.556	0.402	2e-68
Q0IMG9		694	E3 ubiquitin-protein liga	no	no	0.811	0.533	0.402	2e-67

>sp\|Q9SRT0\|PUB9_ARATH U-box domain-containing protein 9 OS=Arabidopsis thaliana GN=PUB9 PE=1 SV=1	Back alignment and function desciption

 Score =  586 bits (1511), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 301/467 (64%), Positives = 377/467 (80%), Gaps = 18/467 (3%)

Query: 1   MAKTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKK- 59
           MAKTG+FDSDPT + KA ELK+E++KL+  I D+ D   +TIDQ +D L AL+E   +K 
Sbjct: 1   MAKTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKM 60

Query: 60  -RSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQ 118
            +S SL++ ETVSCPEEF+CPLS ELMRDPV+LASGQT+D+ +IQ+WL +GNRTCP+TQQ
Sbjct: 61  AKSSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQ 120

Query: 119 VLSHTILTPNHLIREMISQWCRSQGIELPNSVQY----INE-EGITEADRDHFLSLLKKM 173
           VL HT LTPN LIREMIS+WC+  G+E  +  QY    +NE E +T +DR+ F SLL K+
Sbjct: 121 VLPHTALTPNLLIREMISKWCKKNGLETKS--QYHPNLVNEDETVTRSDREIFNSLLCKV 178

Query: 174 SAT-LPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPN--LQE 230
           S++ L DQ  AAKELRLLT++   FRALFGES D I +L++PL      +G NP+  LQE
Sbjct: 179 SSSNLQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLL-----HGSNPDEKLQE 233

Query: 231 DVITTLLNLSIHDN-NKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKE 289
           DV+TTLLN+SIHD+ NKKLV E P VIPLL+DALR GT+ TRSNAAAA+FTLSALDSNK 
Sbjct: 234 DVVTTLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKV 293

Query: 290 VIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGV 349
           +IGKSG LKPLIDLL+EG+  A+KDVA+AIF LCI HEN++RAVRDG V V+ KKI +G+
Sbjct: 294 LIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGL 353

Query: 350 HVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRT 409
           +VDELLAILAML T+ +AVEE+G+LGGVS +L+I RES C RNKEN I ILHTIC SDRT
Sbjct: 354 YVDELLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRT 413

Query: 410 KWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA 456
           KWK ++EEE+ HGTI+KL+++GT+RA+RKA GIL+RL++ +NLTHTA
Sbjct: 414 KWKEIKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA 460

Functions as an E3 ubiquitin ligase (By similarity). May be involved in the abscisic acid-mediated signaling pathway, at least during germination.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q3E9F7\|PUB46_ARATH Putative U-box domain-containing protein 46 OS=Arabidopsis thaliana GN=PUB46 PE=3 SV=1	Back alignment and function description

>sp\|Q5VRH9\|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1	Back alignment and function description

>sp\|Q8VZ40\|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1	Back alignment and function description

>sp\|Q8GUG9\|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2	Back alignment and function description

>sp\|Q3E9F5\|PUB48_ARATH U-box domain-containing protein 48 OS=Arabidopsis thaliana GN=PUB48 PE=2 SV=1	Back alignment and function description

>sp\|Q9SNC6\|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1	Back alignment and function description

>sp\|Q3E9F6\|PUB47_ARATH Putative U-box domain-containing protein 47 OS=Arabidopsis thaliana GN=PUB47 PE=3 SV=1	Back alignment and function description

>sp\|Q9ZV31\|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1	Back alignment and function description

>sp\|Q0IMG9\|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		456
224065423		456	predicted protein [Populus trichocarpa]	1.0	1.0	0.809	0.0
255585624		456	Spotted leaf protein, putative [Ricinus	1.0	1.0	0.780	0.0
225469211		449	PREDICTED: U-box domain-containing prote	0.984	1.0	0.736	0.0
356527306		461	PREDICTED: U-box domain-containing prote	1.0	0.989	0.735	0.0
449453296		461	PREDICTED: U-box domain-containing prote	0.997	0.986	0.709	0.0
356567779		461	PREDICTED: U-box domain-containing prote	1.0	0.989	0.731	0.0
225430672		455	PREDICTED: U-box domain-containing prote	0.993	0.995	0.683	1e-179
388491812		453	unknown [Lotus japonicus]	0.991	0.997	0.667	1e-177
224118828		450	predicted protein [Populus trichocarpa]	0.986	1.0	0.671	1e-177
297789349		460	armadillo/beta-catenin repeat family pro	0.984	0.976	0.646	1e-166

>gi\|224065423\|ref\|XP_002301810.1\| predicted protein [Populus trichocarpa] gi\|222843536\|gb\|EEE81083.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/456 (80%), Positives = 412/456 (90%)

Query: 1   MAKTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKR 60
           MAKTG+F SDP VM KA ELKKELQKLVR IVDD DYRTE IDQAR+TL ALK LK K+R
Sbjct: 1   MAKTGVFKSDPMVMTKAMELKKELQKLVRNIVDDEDYRTELIDQARETLFALKGLKVKRR 60

Query: 61  SLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVL 120
           S SLKL ETV CPEEFKCPLSKELMRDPV+LA+GQT+DRP+IQ+WLKAGNRTCP TQQVL
Sbjct: 61  SSSLKLRETVLCPEEFKCPLSKELMRDPVVLATGQTYDRPFIQKWLKAGNRTCPLTQQVL 120

Query: 121 SHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQ 180
           SHTILTPN LIREMISQWC+SQG+ELP+  Q +NE+GITEADRDHFLSLL+KMS TLP+Q
Sbjct: 121 SHTILTPNLLIREMISQWCKSQGLELPDLSQNVNEDGITEADRDHFLSLLEKMSLTLPEQ 180

Query: 181 TEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLS 240
            +AA+ELRLLTKRMPSFRALF ES +AIPQLL PLSE K  + + P+LQED+ITTLLNLS
Sbjct: 181 KDAARELRLLTKRMPSFRALFSESLEAIPQLLRPLSEGKSGSSMYPDLQEDIITTLLNLS 240

Query: 241 IHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPL 300
           IHDNNKKLVAETPMVIPLLM+ALRSG+IETR+NAAAALFTLSALDSNK +IGKSGALKPL
Sbjct: 241 IHDNNKKLVAETPMVIPLLMEALRSGSIETRTNAAAALFTLSALDSNKTLIGKSGALKPL 300

Query: 301 IDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAM 360
           IDLL+EGH SAMKDVASAIFNLCI HENKARAVRDG + VIL KIM+G+HVDELLAILA+
Sbjct: 301 IDLLEEGHPSAMKDVASAIFNLCIIHENKARAVRDGALKVILTKIMNGMHVDELLAILAV 360

Query: 361 LSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEEST 420
           L+++ + VEE+GD G V C+LRIIRESTCDRNKENCIAILHTICL+DRTKWK MR+EES+
Sbjct: 361 LASHQKVVEELGDSGAVPCLLRIIRESTCDRNKENCIAILHTICLNDRTKWKVMRDEESS 420

Query: 421 HGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA 456
           +GTISKLA+ GT+RAKRKA GILERL R VNLTHTA
Sbjct: 421 YGTISKLARHGTSRAKRKANGILERLNRAVNLTHTA 456

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255585624\|ref\|XP_002533499.1\| Spotted leaf protein, putative [Ricinus communis] gi\|223526643\|gb\|EEF28886.1\| Spotted leaf protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225469211\|ref\|XP_002263607.1\| PREDICTED: U-box domain-containing protein 9 [Vitis vinifera] gi\|296083515\|emb\|CBI23501.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356527306\|ref\|XP_003532252.1\| PREDICTED: U-box domain-containing protein 9-like [Glycine max]	Back alignment and taxonomy information

>gi\|449453296\|ref\|XP_004144394.1\| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus] gi\|449506075\|ref\|XP_004162645.1\| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356567779\|ref\|XP_003552093.1\| PREDICTED: U-box domain-containing protein 9-like [Glycine max]	Back alignment and taxonomy information

>gi\|225430672\|ref\|XP_002270882.1\| PREDICTED: U-box domain-containing protein 9 [Vitis vinifera] gi\|296085175\|emb\|CBI28670.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|388491812\|gb\|AFK33972.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|224118828\|ref\|XP_002331359.1\| predicted protein [Populus trichocarpa] gi\|222874397\|gb\|EEF11528.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297789349\|ref\|XP_002862652.1\| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi\|297308299\|gb\|EFH38910.1\| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		456
TAIR\|locus:2079706		460	PUB9 "plant U-box 9" [Arabidop	0.989	0.980	0.630	1.5e-147
TAIR\|locus:2146183		458	AT5G18320 [Arabidopsis thalian	0.824	0.820	0.461	7.6e-80
UNIPROTKB\|Q5VRH9		611	PUB12 "U-box domain-containing	0.807	0.602	0.427	8.4e-74
TAIR\|locus:2082682		632	PUB14 "plant U-box 14" [Arabid	0.831	0.599	0.415	9.6e-73
TAIR\|locus:2017719		612	AT1G23030 [Arabidopsis thalian	0.809	0.602	0.410	5.6e-68
UNIPROTKB\|Q0IMG9		694	SPL11 "E3 ubiquitin-protein li	0.811	0.533	0.405	5.1e-67
TAIR\|locus:2075140		660	PUB13 "plant U-box 13" [Arabid	0.800	0.553	0.398	5.8e-66
TAIR\|locus:2146213		456	AT5G18340 [Arabidopsis thalian	0.925	0.925	0.383	9.4e-66
TAIR\|locus:2146198		445	AT5G18330 [Arabidopsis thalian	0.811	0.831	0.403	1.4e-64
TAIR\|locus:2013990		628	AT1G71020 [Arabidopsis thalian	0.817	0.593	0.387	3.7e-64

TAIR\|locus:2079706 PUB9 "plant U-box 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1441 (512.3 bits), Expect = 1.5e-147, P = 1.5e-147
 Identities = 293/465 (63%), Positives = 364/465 (78%)

Query:     1 MAKTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCAXXXXXXXXX 60
             MAKTG+FDSDPT + KA ELK+E++KL+  I D+ D   +TIDQ +D L A         
Sbjct:     1 MAKTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKM 60

Query:    61 XXXXXXH--ETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQ 118
                      ETVSCPEEF+CPLS ELMRDPV+LASGQT+D+ +IQ+WL +GNRTCP+TQQ
Sbjct:    61 AKSSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQ 120

Query:   119 VLSHTILTPNHLIREMISQWCRSQGIELPNSVQ--YINE-EGITEADRDHFLSLLKKMSA 175
             VL HT LTPN LIREMIS+WC+  G+E  +      +NE E +T +DR+ F SLL K+S+
Sbjct:   121 VLPHTALTPNLLIREMISKWCKKNGLETKSQYHPNLVNEDETVTRSDREIFNSLLCKVSS 180

Query:   176 T-LPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPN--LQEDV 232
             + L DQ  AAKELRLLT++   FRALFGES D I +L++PL      +G NP+  LQEDV
Sbjct:   181 SNLQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLL-----HGSNPDEKLQEDV 235

Query:   233 ITTLLNLSIHDN-NKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVI 291
             +TTLLN+SIHD+ NKKLV E P VIPLL+DALR GT+ TRSNAAAA+FTLSALDSNK +I
Sbjct:   236 VTTLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLI 295

Query:   292 GKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHV 351
             GKSG LKPLIDLL+EG+  A+KDVA+AIF LCI HEN++RAVRDG V V+ KKI +G++V
Sbjct:   296 GKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYV 355

Query:   352 DELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKW 411
             DELLAILAML T+ +AVEE+G+LGGVS +L+I RES C RNKEN I ILHTIC SDRTKW
Sbjct:   356 DELLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKW 415

Query:   412 KAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA 456
             K ++EEE+ HGTI+KL+++GT+RA+RKA GIL+RL++ +NLTHTA
Sbjct:   416 KEIKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA 460

GO:0000151 "ubiquitin ligase complex" evidence=IEA

GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA;IDA

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0005737 "cytoplasm" evidence=ISM

GO:0016567 "protein ubiquitination" evidence=IEA;IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0070696 "transmembrane receptor protein serine/threonine kinase binding" evidence=IPI

GO:0071215 "cellular response to abscisic acid stimulus" evidence=IMP

GO:0046777 "protein autophosphorylation" evidence=RCA

TAIR\|locus:2146183 AT5G18320 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2146213 AT5G18340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2146198 AT5G18330 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9SRT0	PUB9_ARATH	6, ., 3, ., 2, ., -	0.6445	0.9846	0.9760	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_II2472	hypothetical protein (456 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		456
smart00504		63	smart00504, Ubox, Modified RING finger domain	3e-23
pfam04564		73	pfam04564, U-box, U-box domain	4e-21
cd00020		120	cd00020, ARM, Armadillo/beta-catenin-like repeats	6e-10
pfam13445		55	pfam13445, zf-RING_LisH, RING-type zinc-finger, Li	3e-06
cd00020		120	cd00020, ARM, Armadillo/beta-catenin-like repeats	9e-06
pfam00514		41	pfam00514, Arm, Armadillo/beta-catenin-like repeat	8e-04
PLN03200		2102	PLN03200, PLN03200, cellulose synthase-interactive	0.002
COG5113		929	COG5113, UFD2, Ubiquitin fusion degradation protei	0.002
pfam05804		708	pfam05804, KAP, Kinesin-associated protein (KAP)	0.003

>gnl\|CDD\|128780 smart00504, Ubox, Modified RING finger domain	Back alignment and domain information

 Score = 91.9 bits (229), Expect = 3e-23
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 75  EFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREM 134
           EF CP+S E+M+DPVIL SGQT++R  I++WL   + T P T Q L+H  L PN  ++  
Sbjct: 1   EFLCPISLEVMKDPVILPSGQTYERSAIEKWLL-SHGTDPVTGQPLTHEDLIPNLALKSA 59

Query: 135 ISQW 138
           I +W
Sbjct: 60  IQEW 63

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63

>gnl\|CDD\|203049 pfam04564, U-box, U-box domain	Back alignment and domain information

>gnl\|CDD\|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats	Back alignment and domain information

>gnl\|CDD\|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif	Back alignment and domain information

>gnl\|CDD\|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats	Back alignment and domain information

>gnl\|CDD\|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat	Back alignment and domain information

>gnl\|CDD\|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227444 COG5113, UFD2, Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|147776 pfam05804, KAP, Kinesin-associated protein (KAP)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		456
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.96
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	99.95
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.95
KOG4224		550	consensus Armadillo repeat protein VAC8 required f	99.95
KOG4224		550	consensus Armadillo repeat protein VAC8 required f	99.94
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	99.92
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	99.91
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.88
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	99.87
PF05804		708	KAP: Kinesin-associated protein (KAP)	99.84
PF05804		708	KAP: Kinesin-associated protein (KAP)	99.82
KOG2122		2195	consensus Beta-catenin-binding protein APC, contai	99.74
COG5113		929	UFD2 Ubiquitin fusion degradation protein 2 [Postt	99.72
KOG4199		461	consensus Uncharacterized conserved protein [Funct	99.7
KOG4199		461	consensus Uncharacterized conserved protein [Funct	99.7
KOG1048		717	consensus Neural adherens junction protein Plakoph	99.69
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.69
KOG2042		943	consensus Ubiquitin fusion degradation protein-2 [	99.68
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	99.55
KOG1048		717	consensus Neural adherens junction protein Plakoph	99.54
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	99.51
KOG2122		2195	consensus Beta-catenin-binding protein APC, contai	99.37
KOG1222		791	consensus Kinesin associated protein KAP [Intracel	99.34
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	99.31
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	99.27
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	99.23
KOG1222		791	consensus Kinesin associated protein KAP [Intracel	99.22
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	99.21
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	99.12
KOG4500		604	consensus Rho/Rac GTPase guanine nucleotide exchan	99.09
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	99.07
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.03
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.96
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.93
PRK09687		280	putative lyase; Provisional	98.93
KOG4500		604	consensus Rho/Rac GTPase guanine nucleotide exchan	98.93
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	98.8
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	98.78
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	98.68
PRK09687		280	putative lyase; Provisional	98.68
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	98.68
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	98.67
KOG0168		1051	consensus Putative ubiquitin fusion degradation pr	98.62
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.56
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	98.54
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.54
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	98.54
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	98.5
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	98.49
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	98.48
PHA02929		238	N1R/p28-like protein; Provisional	98.39
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.36
KOG0168		1051	consensus Putative ubiquitin fusion degradation pr	98.35
KOG4646		173	consensus Uncharacterized conserved protein, conta	98.32
KOG0289		506	consensus mRNA splicing factor [General function p	98.29
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.28
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	98.26
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.25
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.22
KOG1293		678	consensus Proteins containing armadillo/beta-caten	98.2
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	98.19
PF05536		543	Neurochondrin: Neurochondrin	98.19
KOG2171		1075	consensus Karyopherin (importin) beta 3 [Nuclear s	98.18
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	98.18
COG5222		427	Uncharacterized conserved protein, contains RING Z	98.16
KOG2759		442	consensus Vacuolar H+-ATPase V1 sector, subunit H	98.16
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	98.13
KOG2973		353	consensus Uncharacterized conserved protein [Funct	98.12
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.1
KOG4646		173	consensus Uncharacterized conserved protein, conta	98.09
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.06
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	98.04
PF05536		543	Neurochondrin: Neurochondrin	97.99
KOG2973		353	consensus Uncharacterized conserved protein [Funct	97.98
KOG2171		1075	consensus Karyopherin (importin) beta 3 [Nuclear s	97.98
KOG1293		678	consensus Proteins containing armadillo/beta-caten	97.98
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	97.96
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	97.94
PHA02926		242	zinc finger-like protein; Provisional	97.92
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	97.91
PF14664		371	RICTOR_N: Rapamycin-insensitive companion of mTOR,	97.85
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.8
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	97.8
TIGR02270		410	conserved hypothetical protein. Members are found	97.79
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	97.79
PTZ00429		746	beta-adaptin; Provisional	97.76
KOG3678		832	consensus SARM protein (with sterile alpha and arm	97.72
PTZ00429		746	beta-adaptin; Provisional	97.71
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.64
PF12348		228	CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi	97.57
KOG2023		885	consensus Nuclear transport receptor Karyopherin-b	97.56
PF14664		371	RICTOR_N: Rapamycin-insensitive companion of mTOR,	97.56
KOG2734		536	consensus Uncharacterized conserved protein [Funct	97.49
KOG2759		442	consensus Vacuolar H+-ATPase V1 sector, subunit H	97.48
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	97.47
KOG1789		2235	consensus Endocytosis protein RME-8, contains DnaJ	97.46
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	97.42
KOG2734		536	consensus Uncharacterized conserved protein [Funct	97.36
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	97.36
PF14634		44	zf-RING_5: zinc-RING finger domain	97.35
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	97.25
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	97.24
KOG0212		675	consensus Uncharacterized conserved protein [Funct	97.23
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.23
KOG3678		832	consensus SARM protein (with sterile alpha and arm	97.2
KOG1242		569	consensus Protein containing adaptin N-terminal re	97.2
KOG2660		331	consensus Locus-specific chromosome binding protei	97.2
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	97.19
COG5369		743	Uncharacterized conserved protein [Function unknow	97.16
KOG0297		391	consensus TNF receptor-associated factor [Signal t	97.13
PF10165		446	Ric8: Guanine nucleotide exchange factor synembryn	97.12
PF10165		446	Ric8: Guanine nucleotide exchange factor synembryn	97.06
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	97.05
KOG0212		675	consensus Uncharacterized conserved protein [Funct	97.04
TIGR02270		410	conserved hypothetical protein. Members are found	97.03
KOG4413		524	consensus 26S proteasome regulatory complex, subun	96.93
PF11841		160	DUF3361: Domain of unknown function (DUF3361)	96.93
KOG1789		2235	consensus Endocytosis protein RME-8, contains DnaJ	96.85
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	96.84
COG1413		335	FOG: HEAT repeat [Energy production and conversion	96.81
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	96.81
PF04063		192	DUF383: Domain of unknown function (DUF383); Inter	96.77
KOG4413		524	consensus 26S proteasome regulatory complex, subun	96.76
PF09759		102	Atx10homo_assoc: Spinocerebellar ataxia type 10 pr	96.65
PF12348		228	CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi	96.63
COG5240		898	SEC21 Vesicle coat complex COPI, gamma subunit [In	96.61
COG1413		335	FOG: HEAT repeat [Energy production and conversion	96.6
PF04641		260	Rtf2: Rtf2 RING-finger	96.59
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	96.51
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	96.49
KOG2023		885	consensus Nuclear transport receptor Karyopherin-b	96.42
KOG1059		877	consensus Vesicle coat complex AP-3, delta subunit	96.38
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	96.34
KOG1241		859	consensus Karyopherin (importin) beta 1 [Nuclear s	96.33
KOG3039		303	consensus Uncharacterized conserved protein [Funct	96.26
KOG1248		1176	consensus Uncharacterized conserved protein [Funct	96.25
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	96.24
KOG3036		293	consensus Protein involved in cell differentiation	96.15
PF11841		160	DUF3361: Domain of unknown function (DUF3361)	95.96
PF04063		192	DUF383: Domain of unknown function (DUF383); Inter	95.88
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	95.87
KOG2999		713	consensus Regulator of Rac1, required for phagocyt	95.86
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	95.85
KOG1242		569	consensus Protein containing adaptin N-terminal re	95.85
KOG2979		262	consensus Protein involved in DNA repair [General	95.84
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	95.73
PF14668		73	RICTOR_V: Rapamycin-insensitive companion of mTOR,	95.65
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	95.56
KOG3039		303	consensus Uncharacterized conserved protein [Funct	95.55
KOG1241		859	consensus Karyopherin (importin) beta 1 [Nuclear s	95.52
KOG4367		699	consensus Predicted Zn-finger protein [Function un	95.49
PF04078		262	Rcd1: Cell differentiation family, Rcd1-like ; Int	95.44
KOG2611		698	consensus Neurochondrin/leucine-rich protein (Neur	95.42
PF05004		309	IFRD: Interferon-related developmental regulator (	95.38
COG5369		743	Uncharacterized conserved protein [Function unknow	95.36
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	95.33
PF12755		97	Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	95.31
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	95.28
KOG2259		823	consensus Uncharacterized conserved protein [Funct	95.21
KOG2259		823	consensus Uncharacterized conserved protein [Funct	95.21
KOG1002		791	consensus Nucleotide excision repair protein RAD16	95.2
KOG1824		1233	consensus TATA-binding protein-interacting protein	95.16
COG5215		858	KAP95 Karyopherin (importin) beta [Intracellular t	95.11
KOG3036		293	consensus Protein involved in cell differentiation	95.04
KOG1077		938	consensus Vesicle coat complex AP-2, alpha subunit	94.99
PF08045		257	CDC14: Cell division control protein 14, SIN compo	94.83
COG5231		432	VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene	94.78
PF13764		802	E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4	94.69
COG5109		396	Uncharacterized conserved protein, contains RING Z	94.67
KOG1077		938	consensus Vesicle coat complex AP-2, alpha subunit	94.66
PF04078		262	Rcd1: Cell differentiation family, Rcd1-like ; Int	94.64
KOG3113		293	consensus Uncharacterized conserved protein [Funct	94.64
PF12755		97	Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	94.62
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	94.5
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	94.37
PF12717		178	Cnd1: non-SMC mitotic condensation complex subunit	94.34
COG5231		432	VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene	94.31
KOG1788		2799	consensus Uncharacterized conserved protein [Funct	94.28
COG5152		259	Uncharacterized conserved protein, contains RING a	94.28
COG5181		975	HSH155 U2 snRNP spliceosome subunit [RNA processin	94.28
KOG0213		1172	consensus Splicing factor 3b, subunit 1 [RNA proce	94.27
KOG0213		1172	consensus Splicing factor 3b, subunit 1 [RNA proce	94.26
KOG2274		1005	consensus Predicted importin 9 [Intracellular traf	94.24
KOG2274		1005	consensus Predicted importin 9 [Intracellular traf	94.02
KOG1061		734	consensus Vesicle coat complex AP-1/AP-2/AP-4, bet	93.99
COG5096		757	Vesicle coat complex, various subunits [Intracellu	93.88
COG5096		757	Vesicle coat complex, various subunits [Intracellu	93.87
KOG1062		866	consensus Vesicle coat complex AP-1, gamma subunit	93.85
PF09759		102	Atx10homo_assoc: Spinocerebellar ataxia type 10 pr	93.74
KOG2999		713	consensus Regulator of Rac1, required for phagocyt	93.73
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	93.71
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	93.64
KOG1059		877	consensus Vesicle coat complex AP-3, delta subunit	93.62
PF13764		802	E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4	93.57
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	93.51
PF08569		335	Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro	93.31
KOG4151		748	consensus Myosin assembly protein/sexual cycle pro	93.2
KOG0883		518	consensus Cyclophilin type, U box-containing pepti	93.15
PF11698		119	V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011	93.12
KOG1060		968	consensus Vesicle coat complex AP-3, beta subunit	93.07
PF14668		73	RICTOR_V: Rapamycin-insensitive companion of mTOR,	92.8
PF02985		31	HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re	92.7
PF12031		257	DUF3518: Domain of unknown function (DUF3518); Int	92.64
KOG1078		865	consensus Vesicle coat complex COPI, gamma subunit	92.62
PF07814		361	WAPL: Wings apart-like protein regulation of heter	92.51
KOG2611		698	consensus Neurochondrin/leucine-rich protein (Neur	92.44
PF06025		379	DUF913: Domain of Unknown Function (DUF913); Inter	92.44
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	92.38
PF08045		257	CDC14: Cell division control protein 14, SIN compo	92.24
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	92.21
KOG1062		866	consensus Vesicle coat complex AP-1, gamma subunit	92.19
KOG1943		1133	consensus Beta-tubulin folding cofactor D [Posttra	92.13
KOG1061		734	consensus Vesicle coat complex AP-1/AP-2/AP-4, bet	92.02
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	91.63
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	91.54
KOG4151		748	consensus Myosin assembly protein/sexual cycle pro	91.53
PF12719		298	Cnd3: Nuclear condensing complex subunits, C-term	91.38
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	91.29
PF06371		187	Drf_GBD: Diaphanous GTPase-binding Domain; InterPr	91.12
PF06416		113	DUF1076: Protein of unknown function (DUF1076); In	91.09
PF08324		268	PUL: PUL domain; InterPro: IPR013535 The PUL (afte	90.89
PF11698		119	V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011	90.88
PF08569		335	Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro	90.52
COG5181		975	HSH155 U2 snRNP spliceosome subunit [RNA processin	90.43
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	90.27
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	90.2
PF02985		31	HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re	90.12
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	90.03
COG5209		315	RCD1 Uncharacterized protein involved in cell diff	89.9
PF05004		309	IFRD: Interferon-related developmental regulator (	89.85
PF06371		187	Drf_GBD: Diaphanous GTPase-binding Domain; InterPr	89.84
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	89.4
PF12717		178	Cnd1: non-SMC mitotic condensation complex subunit	89.05
COG5627		275	MMS21 DNA repair protein MMS21 [DNA replication, r	88.54
KOG0567		289	consensus HEAT repeat-containing protein [General	88.5
KOG1824		1233	consensus TATA-binding protein-interacting protein	88.22
KOG2032		533	consensus Uncharacterized conserved protein [Funct	87.98
COG5209		315	RCD1 Uncharacterized protein involved in cell diff	87.9
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	87.82
PF12719		298	Cnd3: Nuclear condensing complex subunits, C-term	87.23
KOG2062		929	consensus 26S proteasome regulatory complex, subun	87.15
PF08324		268	PUL: PUL domain; InterPro: IPR013535 The PUL (afte	87.14
COG5175		480	MOT2 Transcriptional repressor [Transcription]	87.13
PF12460		415	MMS19_C: RNAPII transcription regulator C-terminal	87.07
PF12031		257	DUF3518: Domain of unknown function (DUF3518); Int	86.91
KOG1943		1133	consensus Beta-tubulin folding cofactor D [Posttra	86.61
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	86.61
KOG4535		728	consensus HEAT and armadillo repeat-containing pro	86.15
KOG1967		1030	consensus DNA repair/transcription protein Mms19 [	86.1
PF12460		415	MMS19_C: RNAPII transcription regulator C-terminal	85.99
KOG1058		948	consensus Vesicle coat complex COPI, beta subunit	85.63
PF06025		379	DUF913: Domain of Unknown Function (DUF913); Inter	85.55
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	85.5
KOG1248		1176	consensus Uncharacterized conserved protein [Funct	85.47
PF05918		556	API5: Apoptosis inhibitory protein 5 (API5); Inter	85.39
COG5215		858	KAP95 Karyopherin (importin) beta [Intracellular t	85.1
COG5240		898	SEC21 Vesicle coat complex COPI, gamma subunit [In	84.73
KOG0396		389	consensus Uncharacterized conserved protein [Funct	84.46
KOG4535		728	consensus HEAT and armadillo repeat-containing pro	84.3
KOG0301		745	consensus Phospholipase A2-activating protein (con	84.0
PF10408		629	Ufd2P_core: Ubiquitin elongating factor core; Inte	83.85
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	83.79
KOG1967		1030	consensus DNA repair/transcription protein Mms19 [	83.74
COG5219		1525	Uncharacterized conserved protein, contains RING Z	83.53
PF08167		165	RIX1: rRNA processing/ribosome biogenesis	83.49
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	83.14
cd03568		144	VHS_STAM VHS domain family, STAM subfamily; member	82.67
KOG4653		982	consensus Uncharacterized conserved protein [Funct	82.64
KOG0567		289	consensus HEAT repeat-containing protein [General	82.11
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	81.99
PF04641		260	Rtf2: Rtf2 RING-finger	81.26
KOG2025		892	consensus Chromosome condensation complex Condensi	80.73
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	80.47
KOG0915		1702	consensus Uncharacterized conserved protein [Funct	80.43
KOG1001		674	consensus Helicase-like transcription factor HLTF/	80.36

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

Probab=99.96  E-value=1.3e-27  Score=268.59  Aligned_cols=278  Identities=18%  Similarity=0.249  Sum_probs=241.4

Q ss_pred             hhhHHHHHHHhcC---CchhHHHHHHHHHHHhhcCchhhhhhhccCCchhhhhhccccccccCCCChhhHHHHHHHHHcc
Q 012813          163 RDHFLSLLKKMSA---TLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNL  239 (456)
Q Consensus       163 ~~~i~~Lv~~L~~---~~~~~~~a~~~L~~L~~~~~~~r~~i~~~~g~i~~Lv~lL~~~~~~~~~~~~~~~~a~~~L~~L  239 (456)
                      ...+..+++.|.+   +.+.++.|+..|+.+++.++++|..|.+..|+||.|+.+|+      +.+..++++|+.+|.++
T Consensus        12 ~~~v~~Lve~L~s~~ss~~~~~~Al~~Lr~Lak~~~enR~~Ia~~aGaIP~LV~lL~------sg~~~vk~nAaaaL~nL   85 (2102)
T PLN03200         12 LASVAQCIEQLRAKSSSPQEKELTTARLLELAKTREEARKAIGSHSQAMPLLVSLLR------SGTLGAKVNAAAVLGVL   85 (2102)
T ss_pred             HHHHHHHHHHHHcccCCHHHHHHHHHHHHHHHhcChHHHHHHHHccCcHHHHHHHHc------CCCHHHHHHHHHHHHHH
Confidence            4567889999953   46889999999999999999999999866899999999998      45789999999999999


Q ss_pred             ccCcchhHHHhcCCCCHHHHHHHHhcCCHHHHHHHHHHHHHhccCC---ccchh-hcccCccHHHHhccccCC---hhHH
Q 012813          240 SIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALD---SNKEV-IGKSGALKPLIDLLDEGH---QSAM  312 (456)
Q Consensus       240 s~~~~~~~~i~~~~~~i~~Lv~lL~~~~~~~~~~aa~aL~~Ls~~~---~~~~~-i~~~G~i~~Lv~lL~~~~---~~~~  312 (456)
                      +.+++++..++.. |++|.|+++|++|+.+.+++|+++|++|+...   .++.. ++..|+||.|+.+|++++   ..++
T Consensus        86 S~~e~nk~~Iv~~-GaIppLV~LL~sGs~eaKe~AA~AL~sLS~~~~~D~~~~~I~v~~GaVp~Lv~lL~~gsk~d~~L~  164 (2102)
T PLN03200         86 CKEEDLRVKVLLG-GCIPPLLSLLKSGSAEAQKAAAEAIYAVSSGGLSDHVGSKIFSTEGVVPSLWDQLQPGNKQDKVVE  164 (2102)
T ss_pred             hcCHHHHHHHHHc-CChHHHHHHHHCCCHHHHHHHHHHHHHHHcCcchhhhhhhhhhhcCChHHHHHHHhCCchhhHHHH
Confidence            9999999999974 69999999999999999999999999999863   44544 557999999999999874   3356


Q ss_pred             HHHHHHHHHhccCchhhHH-HHhcCcHHHHHHHHcCC--chHHHHHHHHHHhhCC-HHHHHHHHhhCcHHHHHHHhhhcC
Q 012813          313 KDVASAIFNLCITHENKAR-AVRDGGVSVILKKIMDG--VHVDELLAILAMLSTN-HRAVEEIGDLGGVSCMLRIIREST  388 (456)
Q Consensus       313 ~~a~~aL~~L~~~~~~~~~-~v~~g~v~~Lv~lL~~~--~~~~~a~~~L~~L~~~-~~~~~~i~~~g~i~~Lv~ll~~~~  388 (456)
                      +.++.+|+|||.+.+++.. +++.|+||.|+++|.++  ..++.|+.+|.+++.+ ++++..+++.|+|+.|+++|+++.
T Consensus       165 ~~Av~AL~nLs~~~en~~~~IIeaGaVp~LV~LLsS~d~~lQ~eAa~aLa~Lass~ee~~~aVIeaGaVP~LV~LL~sg~  244 (2102)
T PLN03200        165 GLLTGALRNLCGSTDGFWSATLEAGGVDILVKLLSSGNSDAQANAASLLARLMMAFESSISKVLDAGAVKQLLKLLGQGN  244 (2102)
T ss_pred             HHHHHHHHHHhcCccchHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHcCChHHHHHHHHCCCHHHHHHHHccCC
Confidence            7788999999999998865 47999999999999976  6789999999999876 789999999999999999998765


Q ss_pred             ChhHHHHHHHHHHHHhccChhhHHHHHHhhccHHHHHHHhhcCC---------HHHHHHHHHHHHHHhc
Q 012813          389 CDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGT---------ARAKRKATGILERLKR  448 (456)
Q Consensus       389 ~~~~~~~A~~~L~~l~~~~~~~~~~~~~~~g~~~~L~~Ll~~~~---------~~~k~~A~~~L~~l~~  448 (456)
                      ++.+|++|+++|++|+.++.+..+.++ +.|+++.|+.++...+         ...++.|.|+|.|+++
T Consensus       245 ~~~VRE~AA~AL~nLAs~s~e~r~~Iv-~aGgIp~LI~lL~sp~~e~~~~~~~~~Lqe~AvwALsNIcg  312 (2102)
T PLN03200        245 EVSVRAEAAGALEALSSQSKEAKQAIA-DAGGIPALINATVAPSKEFMQGEFAQALQENAMGALANICG  312 (2102)
T ss_pred             ChHHHHHHHHHHHHHhcCCHHHHHHHH-HCCCHHHHHHHHhCcchhhhccccchHHHHHHHHHHHHHhC
Confidence            578999999999999998876544455 5799999999987543         3469999999999987

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4199 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4199 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2973 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>KOG2973 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only]	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02270 conserved hypothetical protein	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PTZ00429 beta-adaptin; Provisional	Back alignment and domain information

>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures]	Back alignment and domain information

>PTZ00429 beta-adaptin; Provisional	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]	Back alignment and domain information

>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term	Back alignment and domain information

>KOG2734 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2734 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>KOG0212 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures]	Back alignment and domain information

>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>COG5369 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway []	Back alignment and domain information

>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway []	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG0212 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02270 conserved hypothetical protein	Back alignment and domain information

>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11841 DUF3361: Domain of unknown function (DUF3361)	Back alignment and domain information

>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1413 FOG: HEAT repeat [Energy production and conversion]	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function	Back alignment and domain information

>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10	Back alignment and domain information

>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]	Back alignment and domain information

>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion]	Back alignment and domain information

>COG1413 FOG: HEAT repeat [Energy production and conversion]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1248 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only]	Back alignment and domain information

>PF11841 DUF3361: Domain of unknown function (DUF3361)	Back alignment and domain information

>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2979 consensus Protein involved in DNA repair [General function prediction only]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms []	Back alignment and domain information

>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown]	Back alignment and domain information

>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 []	Back alignment and domain information

>COG5369 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2259 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2259 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]	Back alignment and domain information

>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only]	Back alignment and domain information

>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1	Back alignment and domain information

>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]	Back alignment and domain information

>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms []	Back alignment and domain information

>KOG3113 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1	Back alignment and domain information

>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]	Back alignment and domain information

>KOG1788 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure]	Back alignment and domain information

>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure]	Back alignment and domain information

>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion]	Back alignment and domain information

>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10	Back alignment and domain information

>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis	Back alignment and domain information

>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5	Back alignment and domain information

>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []	Back alignment and domain information

>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised	Back alignment and domain information

>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D	Back alignment and domain information

>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown]	Back alignment and domain information

>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division []	Back alignment and domain information

>PF06416 DUF1076: Protein of unknown function (DUF1076); InterPro: IPR010489 This entry is represented by Bacteriophage 2851, Orf74 (EP2851_74)	Back alignment and domain information

>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes	Back alignment and domain information

>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis	Back alignment and domain information

>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only]	Back alignment and domain information

>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 []	Back alignment and domain information

>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division []	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1	Back alignment and domain information

>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0567 consensus HEAT repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]	Back alignment and domain information

>KOG2032 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain	Back alignment and domain information

>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins	Back alignment and domain information

>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised	Back alignment and domain information

>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins	Back alignment and domain information

>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1248 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms	Back alignment and domain information

>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion]	Back alignment and domain information

>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0396 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>PF10408 Ufd2P_core: Ubiquitin elongating factor core; InterPro: IPR019474 This entry represents the most conserved part of the core region of ubiquitin conjugation factor E4 (or Ub elongating factor, or Ufd2P), running from helix alpha-11 to alpha-38	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF08167 RIX1: rRNA processing/ribosome biogenesis	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein)	Back alignment and domain information

>KOG4653 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0567 consensus HEAT repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0915 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		456
1t1h_A		78	Nmr Solution Structure Of The U Box Domain From Atp		7e-23
2kre_A		100	Solution Structure Of E4bUFD2A U-Box Domain Length		4e-06
2kr4_A		85	U-Box Domain Of The E3 Ubiquitin Ligase E4b Length		4e-06
2c2v_S		78	Crystal Structure Of The Chip-Ubc13-Uev1a Complex L		7e-04

>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78

Back alignment and structure

Iteration: 1

Score = 105 bits (261), Expect = 7e-23, Method: Composition-based stats. Identities = 40/73 (54%), Positives = 60/73 (82%) Query: 73 PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIR 132 PE F+CP+S ELM+DPVI+++GQT++R IQ+WL AG++TCP++Q+ L H LTPN++++ Sbjct: 6 PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLK 65 Query: 133 EMISQWCRSQGIE 145 +I+ WC S GIE Sbjct: 66 SLIALWCESNGIE 78

PyMOL of 1t1h

>pdb|2KRE|A Chain A, Solution Structure Of E4bUFD2A U-Box Domain Length = 100

Back alignment and structure

>pdb|2KR4|A Chain A, U-Box Domain Of The E3 Ubiquitin Ligase E4b Length = 85

Back alignment and structure

>pdb|2C2V|S Chain S, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 78

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		456
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	3e-39
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	3e-34
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	7e-32
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	8e-13
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	3e-05
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	1e-04
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	1e-29
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	3e-29
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	6e-28
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	2e-23
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	2e-14
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	1e-27
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	2e-15
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	2e-06
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	7e-27
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	1e-22
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	4e-15
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	3e-13
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	1e-11
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	6e-07
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	6e-26
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	5e-23
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	4e-14
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	1e-11
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	5e-25
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	3e-24
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	9e-22
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	3e-19
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	1e-13
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	7e-11
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	3e-21
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	7e-12
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	6e-20
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	6e-19
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	2e-17
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	1e-06
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	6e-18
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	5e-16
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	5e-08
3nmz_A		458	APC variant protein; protein-protein complex, arma	9e-18
3nmz_A		458	APC variant protein; protein-protein complex, arma	3e-17
3nmz_A		458	APC variant protein; protein-protein complex, arma	2e-16
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	2e-17
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	1e-11
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	2e-10
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	6e-09
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	3e-17
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	1e-08
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	3e-08
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	6e-16
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	9e-15
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	5e-10
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	4e-08
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	2e-04
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	2e-14
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	5e-14
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	2e-08
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	5e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-12
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	5e-10
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	5e-10
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	2e-08
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	4e-09
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	2e-08
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	2e-08
1z6u_A		150	NP95-like ring finger protein isoform B; structura	9e-08
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	1e-07
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	2e-07
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	3e-07
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	4e-07
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	4e-07
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	7e-07
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	1e-06
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	7e-06
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	1e-05
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	2e-05
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	2e-05
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	4e-05
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	7e-05
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	8e-05
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	1e-04
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	1e-04
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	2e-04
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	4e-04
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	4e-04
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	5e-04
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	6e-04
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	7e-04

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78	Back alignment and structure

 Score =  135 bits (342), Expect = 3e-39
 Identities = 40/73 (54%), Positives = 60/73 (82%)

Query: 73  PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIR 132
           PE F+CP+S ELM+DPVI+++GQT++R  IQ+WL AG++TCP++Q+ L H  LTPN++++
Sbjct: 6   PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLK 65

Query: 133 EMISQWCRSQGIE 145
            +I+ WC S GIE
Sbjct: 66  SLIALWCESNGIE 78

PyMOL of 1t1h

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		456
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	100.0
3nmz_A		458	APC variant protein; protein-protein complex, arma	99.97
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	99.97
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	99.97
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	99.96
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	99.96
3nmz_A		458	APC variant protein; protein-protein complex, arma	99.96
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	99.96
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.95
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	99.95
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.95
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.94
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	99.94
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.94
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.94
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.94
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.93
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.93
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.93
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.93
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.92
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.92
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.91
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.91
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.91
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.91
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	99.9
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.9
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.89
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	99.89
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	99.89
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	99.89
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	99.89
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	99.88
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	99.88
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	99.87
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.85
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.85
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.85
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	99.85
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.84
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	99.81
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	99.8
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.74
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.72
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.72
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	99.62
3grl_A		651	General vesicular transport factor P115; vesicle t	99.59
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.55
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.41
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	99.38
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.37
3grl_A		651	General vesicular transport factor P115; vesicle t	99.34
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.3
3ltm_A		211	Alpha-REP4; protein engineering, heat-like repeat,	99.29
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.24
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	99.22
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.21
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.21
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.2
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.2
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.19
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.18
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.18
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.18
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	99.18
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	99.17
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	99.17
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.17
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	99.16
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.15
3ltm_A		211	Alpha-REP4; protein engineering, heat-like repeat,	99.14
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.13
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.07
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.06
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	99.06
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	99.05
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	99.03
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	99.02
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	99.0
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	98.99
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	98.99
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.98
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.97
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	98.93
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.92
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.91
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.88
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	98.87
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.86
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.82
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.82
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.77
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	98.76
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	98.7
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	98.7
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.64
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.63
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	98.63
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	98.62
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.6
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.6
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.59
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.59
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.59
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.56
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	98.54
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.51
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.48
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.48
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.44
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.44
2bpt_A		861	Importin beta-1 subunit; nuclear transport, nucleo	98.4
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	98.34
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.3
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.28
2qk2_A		242	LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2	98.28
1qgr_A		876	Protein (importin beta subunit); transport recepto	98.28
1qgr_A		876	Protein (importin beta subunit); transport recepto	98.27
1u6g_C		1230	TIP120 protein, CAND1; cullin repeat, heat repeat,	98.25
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	98.24
2bpt_A		861	Importin beta-1 subunit; nuclear transport, nucleo	98.19
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.17
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.12
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.11
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.1
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	97.95
2qk1_A		249	Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h	97.94
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	97.93
1u6g_C		1230	TIP120 protein, CAND1; cullin repeat, heat repeat,	97.92
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	97.9
3b2a_A		265	TON_1937, putative uncharacterized protein; heat-r	97.88
2vgl_A		621	Adaptor protein complex AP-2, alpha 2 subunit; cyt	97.87
1te4_A		131	Conserved protein MTH187; methanobacterium thermoa	97.87
3b2a_A		265	TON_1937, putative uncharacterized protein; heat-r	97.87
2qk2_A		242	LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2	97.83
2ea5_A		68	Cell growth regulator with ring finger domain prot	97.76
2vgl_A		621	Adaptor protein complex AP-2, alpha 2 subunit; cyt	97.72
3dad_A		339	FH1/FH2 domain-containing protein 1; formin, FHOD1	97.69
1ho8_A		480	Vacuolar ATP synthase subunit H; heat repeat, hydr	97.56
1te4_A		131	Conserved protein MTH187; methanobacterium thermoa	97.55
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	97.55
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	97.53
2qk1_A		249	Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h	97.47
3dad_A		339	FH1/FH2 domain-containing protein 1; formin, FHOD1	97.47
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	97.45
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	97.41
2db0_A		253	253AA long hypothetical protein; heat repeats, hel	97.37
1ho8_A		480	Vacuolar ATP synthase subunit H; heat repeat, hydr	97.22
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	96.81
3tjz_B		355	Coatomer subunit gamma; protein trafficking, golgi	96.79
3tjz_B		355	Coatomer subunit gamma; protein trafficking, golgi	96.43
2db0_A		253	253AA long hypothetical protein; heat repeats, hel	96.16
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	96.08
1wa5_C		960	Importin alpha RE-exporter; nuclear transport/comp	96.06
3oc3_A		800	Helicase MOT1, MOT1; regulation of transcription,	95.83
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	95.74
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	95.55
2fv2_A		268	RCD1 required for cell differentiation1 homolog; a	95.54
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	95.5
2fv2_A		268	RCD1 required for cell differentiation1 homolog; a	95.37
4ffb_C		278	Protein STU2; tubulin fold, heat repeats, cytoskel	95.34
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	94.85
2x19_B		963	Importin-13; nuclear transport, protein transport;	94.3
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	93.87
3ebb_A		304	Phospholipase A2-activating protein; armadillo rep	93.67
4ffb_C		278	Protein STU2; tubulin fold, heat repeats, cytoskel	93.14
2x1g_F		971	Cadmus; transport protein, developmental protein,	92.94
3ebb_A		304	Phospholipase A2-activating protein; armadillo rep	92.68
2kkx_A		102	Uncharacterized protein ECS2156; methods developme	92.45
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	92.2
1wa5_C		960	Importin alpha RE-exporter; nuclear transport/comp	92.02
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	91.99
1upk_A		341	MO25 protein; transferase, armadillo; HET: MSE; 1.	91.46
2of3_A		266	ZYG-9; multifunctional macromolecule, kinetochore,	90.97
3eg5_B		383	Protein diaphanous homolog 1; protein-protein comp	90.09
3oc3_A		800	Helicase MOT1, MOT1; regulation of transcription,	89.48
1upk_A		341	MO25 protein; transferase, armadillo; HET: MSE; 1.	89.45
2f31_A		233	Diaphanous protein homolog 1; formin,MDIA1, protei	89.3
2x19_B		963	Importin-13; nuclear transport, protein transport;	89.11
2x1g_F		971	Cadmus; transport protein, developmental protein,	89.01
3u0r_A		507	Apoptosis inhibitor 5; heat repeat, armadillo repe	88.38
2f31_A		233	Diaphanous protein homolog 1; formin,MDIA1, protei	87.96
2of3_A		266	ZYG-9; multifunctional macromolecule, kinetochore,	87.59
2bnx_A		386	Diaphanous protein homolog 1; autoinhibition, acti	86.57
3c2g_A		619	SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev	86.05
3eg5_B		383	Protein diaphanous homolog 1; protein-protein comp	85.12
1lrv_A		244	LRV, leucine-rich repeat variant; leucine-rich rep	85.09
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	84.88
4hat_C		1023	Exportin-1; heat repeat, nuclear export, RAN-ranbp	82.96
2bnx_A		386	Diaphanous protein homolog 1; autoinhibition, acti	82.28
3ibv_A		980	Exportin-T; karyopherin, heat repeat, cytoplasm, n	81.88
3u0r_A		507	Apoptosis inhibitor 5; heat repeat, armadillo repe	80.33

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

Probab=100.00  E-value=2.3e-32  Score=269.34  Aligned_cols=271  Identities=18%  Similarity=0.184  Sum_probs=235.0

Q ss_pred             hhHHHHHHHHHHHhhcCchhhhhhhccCCchhhhhhcccccc-----ccCCCChhhHHHHHHHHHccccCcc-hhHHHhc
Q 012813          178 PDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESK-----CENGINPNLQEDVITTLLNLSIHDN-NKKLVAE  251 (456)
Q Consensus       178 ~~~~~a~~~L~~L~~~~~~~r~~i~~~~g~i~~Lv~lL~~~~-----~~~~~~~~~~~~a~~~L~~Ls~~~~-~~~~i~~  251 (456)
                      ..+..|++.|.+++. ++++|..|.+ .|+++.|+.+|....     ..+..+++++.+|+++|.||+.+++ ++..+..
T Consensus        47 ~~~~~A~~aL~nls~-d~e~R~~i~~-~G~l~~Lv~LL~~~~~~~~~~~~~~~~~~q~~Aa~aL~nLa~~~~~~k~~i~~  124 (354)
T 3nmw_A           47 HQICPAVCVLMKLSF-DEEHRHAMNE-LGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCS  124 (354)
T ss_dssp             GTHHHHHHHHHHHHT-SHHHHHHHHH-TTHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcC-CHHHHHHHHH-cCCHHHHHHHHhcccccccccCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            456689999999999 5899999999 999999999995210     0001246799999999999998876 6777766


Q ss_pred             CCCCHHHHHHHHhcCCHHHHHHHHHHHHHhccC--CccchhhcccCccHHHHhcc-ccCChhHHHHHHHHHHHhcc-Cch
Q 012813          252 TPMVIPLLMDALRSGTIETRSNAAAALFTLSAL--DSNKEVIGKSGALKPLIDLL-DEGHQSAMKDVASAIFNLCI-THE  327 (456)
Q Consensus       252 ~~~~i~~Lv~lL~~~~~~~~~~aa~aL~~Ls~~--~~~~~~i~~~G~i~~Lv~lL-~~~~~~~~~~a~~aL~~L~~-~~~  327 (456)
                      .+|++|.|+.+|++++.++++.|+++|+||+..  +++|..|++.|+|+.|+++| ++++..+++.|+.+|+||+. +++
T Consensus       125 ~~GaIp~LV~LL~s~~~~v~~~A~~aL~nLs~~~~~~~k~~i~~~G~Ip~Lv~lL~~~~~~~~~~~A~~aL~nLs~~~~~  204 (354)
T 3nmw_A          125 MKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTE  204 (354)
T ss_dssp             CHHHHHHHHHGGGCSCHHHHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTTCHH
T ss_pred             cCCcHHHHHHHHCCCCHHHHHHHHHHHHHHhccCCHHHHHHHHHCCCHHHHHHHHhcCCCHHHHHHHHHHHHHHHccChh
Confidence            667899999999999999999999999999975  46899999999999999975 56788999999999999999 668


Q ss_pred             hhHHHH-hcCcHHHHHHHHcCC------chHHHHHHHHHHhhC----CHHHHHHHHhhCcHHHHHHHhhhcCChhHHHHH
Q 012813          328 NKARAV-RDGGVSVILKKIMDG------VHVDELLAILAMLST----NHRAVEEIGDLGGVSCMLRIIRESTCDRNKENC  396 (456)
Q Consensus       328 ~~~~~v-~~g~v~~Lv~lL~~~------~~~~~a~~~L~~L~~----~~~~~~~i~~~g~i~~Lv~ll~~~~~~~~~~~A  396 (456)
                      ++..++ ..|++|.|+++|.++      .+++.|+++|++|+.    +++++..+.++|+++.|+.+|++++ ..++++|
T Consensus       205 nk~~i~~~~Gai~~Lv~lL~~~~~~~~~~v~~~A~~aL~nLs~~~a~~~~~~~~i~~~g~i~~Lv~lL~~~~-~~v~~~A  283 (354)
T 3nmw_A          205 NKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHS-LTIVSNA  283 (354)
T ss_dssp             HHHHHHHSTTHHHHHHHHTTCCCSSSCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHTTTHHHHHHHHTTCSC-HHHHHHH
T ss_pred             hhHHHHHhcCcHHHHHHHhccCCCcccHHHHHHHHHHHHHHHhhccCCHHHHHHHHHcCCHHHHHHHHcCCC-hHHHHHH
Confidence            899998 789999999999864      278999999999995    7899999999999999999999764 8999999


Q ss_pred             HHHHHHHhccChhhHHHHHHhhccHHHHHHHhhcCCHHHHHHHHHHHHHHhcchhc
Q 012813          397 IAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNL  452 (456)
Q Consensus       397 ~~~L~~l~~~~~~~~~~~~~~~g~~~~L~~Ll~~~~~~~k~~A~~~L~~l~~~~~~  452 (456)
                      +++|+||+..+++..+.++ +.|+++.|+.|++++++++++.|+++|+||....+.
T Consensus       284 ~~aL~nLa~~~~~~~~~i~-~~G~i~~Lv~LL~s~~~~i~~~A~~aL~nL~~~~~~  338 (354)
T 3nmw_A          284 CGTLWNLSARNPKDQEALW-DMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPA  338 (354)
T ss_dssp             HHHHHHHTSSCHHHHHHHH-HTTHHHHHHTTTTCSSHHHHHHHHHHHHHHHTTCCG
T ss_pred             HHHHHHHhCCCHHHHHHHH-HCCCHHHHHHHHhCCCHHHHHHHHHHHHHHHcCCHH
Confidence            9999999987776555555 579999999999999999999999999999876443

PyMOL of 3nmw

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster}	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus}	Back alignment and structure

>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A	Back alignment and structure

>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16	Back alignment and structure

>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus}	Back alignment and structure

>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster}	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A	Back alignment and structure

>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens}	Back alignment and structure

>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9	Back alignment and structure

>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus}	Back alignment and structure

>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus}	Back alignment and structure

>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A	Back alignment and structure

>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens}	Back alignment and structure

>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens}	Back alignment and structure

>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae}	Back alignment and structure

>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster}	Back alignment and structure

>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens}	Back alignment and structure

>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A*	Back alignment and structure

>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans}	Back alignment and structure

>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B*	Back alignment and structure

>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi}	Back alignment and structure

>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A*	Back alignment and structure

>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus}	Back alignment and structure

>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B	Back alignment and structure

>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster}	Back alignment and structure

>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A	Back alignment and structure

>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus}	Back alignment and structure

>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans}	Back alignment and structure

>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B	Back alignment and structure

>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A*	Back alignment and structure

>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B*	Back alignment and structure

>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B	Back alignment and structure

>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B	Back alignment and structure

>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T*	Back alignment and structure

>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		456
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	7e-22
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	6e-15
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	2e-11
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	1e-10
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	1e-08
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	2e-07
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	7e-07
d2c2la2		80	g.44.1.2 (A:225-304) STIP1 homology and U box-cont	2e-14
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	2e-12
d1xm9a1		457	a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo	2e-10
d1xm9a1		457	a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo	2e-09
d1xm9a1		457	a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo	4e-07
d1xm9a1		457	a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo	2e-04
d1wgma_		98	g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu	8e-10
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	2e-08
d1q1sc_		434	a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus	2e-07
d1q1sc_		434	a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus	6e-06
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	4e-07
d1xqra1		264	a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp	5e-06
d1wa5b_		503	a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S	7e-05
d2vgla_		584	a.118.1.10 (A:) Adaptin alpha C subunit N-terminal	7e-04
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	0.002

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 87.1 bits (215), Expect = 7e-22
 Identities = 40/73 (54%), Positives = 60/73 (82%)

Query: 73  PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIR 132
           PE F+CP+S ELM+DPVI+++GQT++R  IQ+WL AG++TCP++Q+ L H  LTPN++++
Sbjct: 6   PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLK 65

Query: 133 EMISQWCRSQGIE 145
            +I+ WC S GIE
Sbjct: 66  SLIALWCESNGIE 78

PyMOL of d1t1ha_

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		456
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	99.9
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	99.88
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.87
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	99.87
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	99.87
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.87
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.86
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.86
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.84
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.84
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	99.75
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	99.73
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.68
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.51
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.41
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.37
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.31
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.16
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.89
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.84
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.7
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.54
d1b3ua_		588	Constant regulatory domain of protein phosphatase	98.4
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.39
d1oyza_		276	Hypothetical protein YibA {Escherichia coli [TaxId	98.33
d1b3ua_		588	Constant regulatory domain of protein phosphatase	98.31
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	98.26
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	98.21
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.2
d1ibrb_		458	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	98.0
d1qbkb_		888	Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96	97.97
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.94
d1oyza_		276	Hypothetical protein YibA {Escherichia coli [TaxId	97.92
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	97.88
d2vgla_		584	Adaptin alpha C subunit N-terminal fragment {Mouse	97.79
d1u6gc_		1207	Cullin-associated NEDD8-dissociated protein 1 (Tip	97.62
d1te4a_		111	MTH187 {Archaeon Methanobacterium thermoautotrophi	97.56
d1ho8a_		477	Regulatory subunit H of the V-type ATPase {Baker's	97.53
d1te4a_		111	MTH187 {Archaeon Methanobacterium thermoautotrophi	97.52
d2vgla_		584	Adaptin alpha C subunit N-terminal fragment {Mouse	97.51
d1qbkb_		888	Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96	97.33
d2bpta1		861	Importin beta {Baker's yeast (Saccharomyces cerevi	97.32
d1ho8a_		477	Regulatory subunit H of the V-type ATPase {Baker's	97.14
d1qgra_		876	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	96.98
d1ibrb_		458	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	96.61
d1u6gc_		1207	Cullin-associated NEDD8-dissociated protein 1 (Tip	96.6
d2bpta1		861	Importin beta {Baker's yeast (Saccharomyces cerevi	96.53
d1qgra_		876	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	96.45
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	95.55
d1lrva_		233	Leucine-rich repeat variant {Azotobacter vinelandi	94.11
d1upka_		330	Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}	93.66
d1upka_		330	Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}	92.5
d1lsha1		336	Lipovitellin-phosvitin complex, superhelical domai	86.05
d2bnxa1		343	Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {	84.97
d1wa5c_		959	Exportin Cse1p {Baker's yeast (Saccharomyces cerev	83.27
d1lrva_		233	Leucine-rich repeat variant {Azotobacter vinelandi	81.08
d2bnxa1		343	Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {	80.57

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=2.9e-23  Score=213.23  Aligned_cols=275  Identities=19%  Similarity=0.185  Sum_probs=238.1

Q ss_pred             hhhHHHHHHHhcC-CchhHHHHHHHHHHHhhcCchhhhhhhccCCchhhhhhccccccccCCCChhhHHHHHHHHHcccc
Q 012813          163 RDHFLSLLKKMSA-TLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSI  241 (456)
Q Consensus       163 ~~~i~~Lv~~L~~-~~~~~~~a~~~L~~L~~~~~~~r~~i~~~~g~i~~Lv~lL~~~~~~~~~~~~~~~~a~~~L~~Ls~  241 (456)
                      ..++|.|++.|.+ +...+..|+..|.+++. ++..+..+....|+++.|+.+|+.     ..++++++.|+.+|.+++.
T Consensus        16 ~~aip~L~~lL~~~~~~v~~~A~~~l~~l~~-~~~~~~~~~~~~~~v~~l~~~L~~-----~~~~~~~~~a~~~L~~l~~   89 (529)
T d1jdha_          16 TRAIPELTKLLNDEDQVVVNKAAVMVHQLSK-KEASRHAIMRSPQMVSAIVRTMQN-----TNDVETARCTAGTLHNLSH   89 (529)
T ss_dssp             -CHHHHHHHHHTCSCHHHHHHHHHHHHHHHT-SHHHHHHHHTCHHHHHHHHHHHHH-----CCCHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHHHHHHHHh-ccHHHHHHHHhhhHHHHHHHHHcC-----CCCHHHHHHHHHHHHHHhC
Confidence            5679999999964 46789999999999998 466666666546899999999975     3478999999999999999


Q ss_pred             CcchhHHHhcCCCCHHHHHHHHhcCCHHHHHHHHHHHHHhccCCc-cchhhcccCccHHHHhccccCChhHHHHHHHHHH
Q 012813          242 HDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDS-NKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIF  320 (456)
Q Consensus       242 ~~~~~~~i~~~~~~i~~Lv~lL~~~~~~~~~~aa~aL~~Ls~~~~-~~~~i~~~G~i~~Lv~lL~~~~~~~~~~a~~aL~  320 (456)
                      +++++..+++. |++|.|+.+|++++++++..|+++|.+|+...+ .+..+.+.|+++.|+.+|+++++.++..++.+|.
T Consensus        90 ~~~~~~~i~~~-g~i~~Li~lL~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~~~~~~a~~~L~  168 (529)
T d1jdha_          90 HREGLLAIFKS-GGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQ  168 (529)
T ss_dssp             SHHHHHHHHHT-THHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCTTHHHHHHHHTHHHHHHHGGGCCCHHHHHHHHHHHH
T ss_pred             CchhHHHHHHC-CCHHHHHHHhCCCCHHHHHHHHHHHHHhhcccchhhhHHHhcCCchHHHHHHHccChHHHHHHHHHHH
Confidence            99999999987 479999999999999999999999999998655 5666778999999999999999999999999999


Q ss_pred             HhccCc-hhhHHHHhcCcHHHHHHHHcCC---chHHHHHHHHHHhhCCHHHHHHHHhhCcHHHHHHHhhhcCChhHHHHH
Q 012813          321 NLCITH-ENKARAVRDGGVSVILKKIMDG---VHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENC  396 (456)
Q Consensus       321 ~L~~~~-~~~~~~v~~g~v~~Lv~lL~~~---~~~~~a~~~L~~L~~~~~~~~~i~~~g~i~~Lv~ll~~~~~~~~~~~A  396 (456)
                      +|+... +.+..+.+.|+++.|+.++...   .....++.+|.+++.+++++..+.+.|+++.|+.++.++ ++..+.+|
T Consensus       169 ~l~~~~~~~~~~~~~~~~~~~L~~ll~~~~~~~~~~~~~~~l~~ls~~~~~~~~~~~~g~~~~L~~ll~~~-~~~~~~~a  247 (529)
T d1jdha_         169 ILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-SQRLVQNC  247 (529)
T ss_dssp             HHHTTCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTTSS-CHHHHHHH
T ss_pred             HHhhhhhHHHHHHHhcccchHHHHHHHhhhhHHHHHHHHHHHhhhhccccccchhhhhhhhhhHHHHhccc-chhhhhhh
Confidence            999754 5667778899999999999754   577889999999999999999999999999999999876 48899999


Q ss_pred             HHHHHHHhccChhhHHHHHHhhccHHHHHHHhhcCCHHHHHHHHHHHHHHhcc
Q 012813          397 IAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRT  449 (456)
Q Consensus       397 ~~~L~~l~~~~~~~~~~~~~~~g~~~~L~~Ll~~~~~~~k~~A~~~L~~l~~~  449 (456)
                      +++|.+++......    ....|+++.|+.++.++++.++..|.++|.+++..
T Consensus       248 ~~~l~~ls~~~~~~----~~~~~~i~~Lv~ll~~~~~~~~~~a~~~L~~l~~~  296 (529)
T d1jdha_         248 LWTLRNLSDAATKQ----EGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCN  296 (529)
T ss_dssp             HHHHHHHHTTCTTC----SCCHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTTT
T ss_pred             hhHHHhccccccch----hhhhhcchhhhhhcccccHHHHHHHHHHHHhhccc
Confidence            99999998765432    12248899999999999999999999999999743

PyMOL of d1jdha_

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]}	Back information, alignment and structure

>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure