Citrus Sinensis ID: 012925
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 453 | ||||||
| 296085315 | 498 | unnamed protein product [Vitis vinifera] | 0.988 | 0.899 | 0.606 | 1e-150 | |
| 225465672 | 482 | PREDICTED: uncharacterized protein LOC10 | 0.988 | 0.929 | 0.606 | 1e-150 | |
| 224096536 | 461 | predicted protein [Populus trichocarpa] | 0.964 | 0.947 | 0.612 | 1e-140 | |
| 356532237 | 464 | PREDICTED: uncharacterized protein LOC10 | 0.969 | 0.946 | 0.565 | 1e-137 | |
| 356576963 | 490 | PREDICTED: uncharacterized protein LOC10 | 0.977 | 0.904 | 0.568 | 1e-137 | |
| 356519596 | 488 | PREDICTED: uncharacterized protein LOC10 | 0.935 | 0.868 | 0.588 | 1e-137 | |
| 357438881 | 459 | Chaperone protein dnaJ [Medicago truncat | 0.991 | 0.978 | 0.557 | 1e-134 | |
| 449516463 | 460 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.956 | 0.557 | 1e-132 | |
| 449451737 | 460 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.956 | 0.557 | 1e-132 | |
| 147837842 | 434 | hypothetical protein VITISV_018825 [Viti | 0.865 | 0.903 | 0.604 | 1e-129 |
| >gi|296085315|emb|CBI29047.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 538 bits (1387), Expect = e-150, Method: Compositional matrix adjust.
Identities = 295/486 (60%), Positives = 350/486 (72%), Gaps = 38/486 (7%)
Query: 1 MPTAATAWLPLFTPSISTITKNNSIPK----------TSRKLSNSNSVTC--------CK 42
MP+ LPL+TP+ S IT+ S P+ T RKL +NS+TC
Sbjct: 1 MPSTC---LPLYTPTSSIITRI-STPRSAGLTFHHATTLRKLHGNNSITCKASSSSSSSS 56
Query: 43 ASLNMDFDLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAGSAGHDMAIILNEAYSVLSD 102
S +DFDLYDLLGI+SSSDQ QIK AYR LQKRCHPDIAG AGHDMAIILNE YSVLSD
Sbjct: 57 LSSLVDFDLYDLLGIESSSDQWQIKMAYRKLQKRCHPDIAGPAGHDMAIILNEVYSVLSD 116
Query: 103 PNSRLAYDKEQAKTAGLRGYTGKPIYSVWFGSESEQRAVFVDEVKCVGCLKCALFAGKTF 162
PN RLAYDKEQAK A LRGYTGKP+YSVW+GSESE+RAVFVDEVKCVGCLKCALFA KTF
Sbjct: 117 PNLRLAYDKEQAKIARLRGYTGKPLYSVWYGSESEERAVFVDEVKCVGCLKCALFAEKTF 176
Query: 163 AIESAYGRARVVAQWADPEHN-PGSYRNVPSRLI--VERSDLAALEYLMAKQPRGTVRVG 219
AIES YGRARVVAQWADPE+ + P I VERS+LAALE+LM+KQPRG+VR+
Sbjct: 177 AIESVYGRARVVAQWADPEYKIQQAIDACPVDCISMVERSNLAALEFLMSKQPRGSVRMS 236
Query: 220 AGNTAGARVSNIFVDVKKFQTQYEDAMKKAA---GKDTDTNWEARLSAIQAIRSISNWLY 276
AGN GA VSNIFVDVKKFQT++ DAM KA+ K+ D EAR+SAIQ IRSI+NWLY
Sbjct: 237 AGNAVGACVSNIFVDVKKFQTRFHDAMDKASTHGSKEKDDQREARISAIQTIRSITNWLY 296
Query: 277 WQLPN--AESYQNLTRSKQKLKEPNIKKLLDAAAARKQASQST----KSVPSNCMHHDEY 330
WQ P ++S Q+LTR +L PN KL DAAAARKQA +ST +++PS ++ EY
Sbjct: 297 WQAPTGGSDSGQSLTRVAGRLSGPNFNKLRDAAAARKQARESTEPRSRTMPSY-IYDAEY 355
Query: 331 WSPSTHALPDTTQSN---RSFKAASESPYNKEWKKANDRNYSVREENRRSPIALGIPIVT 387
W PST ALP T Q+N ++ SP +K+WK + +++ V + NRRS IP+ T
Sbjct: 356 WVPSTLALPATNQNNDLASKAASSESSPPSKQWKGKSKKDHGVSKNNRRSSTIWQIPLAT 415
Query: 388 AAIAAAMVRMQVDQGVSDGLKEHVGGSLALIIVNSSWLQVMLAGITWYFIGAAVVELIEV 447
A IAA +VR Q+ +G LKEH+GGSLAL IVNSSWLQV+LAG+TWY IG +VEL+EV
Sbjct: 416 ATIAAVVVRFQLGEGAVGELKEHIGGSLALYIVNSSWLQVVLAGVTWYLIGTYMVELLEV 475
Query: 448 IGNRQE 453
I NR +
Sbjct: 476 IRNRDK 481
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225465672|ref|XP_002272283.1| PREDICTED: uncharacterized protein LOC100247733 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224096536|ref|XP_002310648.1| predicted protein [Populus trichocarpa] gi|222853551|gb|EEE91098.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356532237|ref|XP_003534680.1| PREDICTED: uncharacterized protein LOC100783616 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356576963|ref|XP_003556599.1| PREDICTED: uncharacterized protein LOC100785995 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356519596|ref|XP_003528458.1| PREDICTED: uncharacterized protein LOC100812414 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357438881|ref|XP_003589717.1| Chaperone protein dnaJ [Medicago truncatula] gi|355478765|gb|AES59968.1| Chaperone protein dnaJ [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449516463|ref|XP_004165266.1| PREDICTED: uncharacterized protein LOC101229316 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449451737|ref|XP_004143617.1| PREDICTED: uncharacterized protein LOC101205271 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147837842|emb|CAN73797.1| hypothetical protein VITISV_018825 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 453 | ||||||
| TAIR|locus:2166968 | 465 | AT5G23240 [Arabidopsis thalian | 0.969 | 0.944 | 0.552 | 1.6e-118 | |
| TAIR|locus:2052426 | 344 | AT2G42750 [Arabidopsis thalian | 0.547 | 0.720 | 0.287 | 1.3e-16 | |
| TAIR|locus:2827820 | 160 | AT2G17880 "AT2G17880" [Arabido | 0.249 | 0.706 | 0.318 | 1.8e-08 | |
| TAIR|locus:2088100 | 157 | AT3G13310 [Arabidopsis thalian | 0.189 | 0.547 | 0.365 | 2.3e-08 | |
| TAIR|locus:2135159 | 161 | J11 "AT4G36040" [Arabidopsis t | 0.165 | 0.465 | 0.363 | 3.8e-08 | |
| TAIR|locus:2119465 | 197 | J20 "AT4G13830" [Arabidopsis t | 0.207 | 0.477 | 0.365 | 1e-07 | |
| UNIPROTKB|Q55980 | 133 | sll0662 "Ferredoxin (Bacterial | 0.108 | 0.368 | 0.489 | 2.8e-07 | |
| UNIPROTKB|Q74B05 | 313 | GSU2406 "DnaJ domain protein" | 0.163 | 0.236 | 0.412 | 4.8e-07 | |
| TIGR_CMR|GSU_2406 | 313 | GSU_2406 "dnaJ domain protein" | 0.163 | 0.236 | 0.412 | 4.8e-07 | |
| UNIPROTKB|A6QM13 | 250 | DNAJA1 "DnaJ homolog subfamily | 0.178 | 0.324 | 0.413 | 5.1e-07 |
| TAIR|locus:2166968 AT5G23240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1167 (415.9 bits), Expect = 1.6e-118, P = 1.6e-118
Identities = 257/465 (55%), Positives = 316/465 (67%)
Query: 1 MPTAATAWLPLFTPSISTITKNNSIPKTSRKLSNSNSVTCCKASLNMDFDLYDLLGIDSS 60
+P + W P T S IT + + R S+S+S+T DFDLYDLLGID S
Sbjct: 11 LPPSTATW-PCST-SQKLITVRSPLKFKCRATSSSSSIT--------DFDLYDLLGIDRS 60
Query: 61 SDQSQIKTAYRMLQKRCHPDIAGSAGHDMAIILNEAYSVLSDPNSRLAYDKEQAKTAGLR 120
SD+SQIK+AYR LQKRCHPDIAG GHDMAIILNEAY +LSDP SR AYDKEQAK LR
Sbjct: 61 SDKSQIKSAYRALQKRCHPDIAGDPGHDMAIILNEAYQLLSDPISRQAYDKEQAKLEELR 120
Query: 121 GYTGKPIYSVWFGSESEQRAVFVDEVKCVGCLKCALFAGKTFAIESAYGRARVVAQWADP 180
GYTGKPIYSVW G E+EQRA FVDEVKCVGCLKCAL A KTFAIE+AYGRARVVAQWADP
Sbjct: 121 GYTGKPIYSVWCGPETEQRAAFVDEVKCVGCLKCALCAEKTFAIETAYGRARVVAQWADP 180
Query: 181 EHN-PGSYRNVPSRLI--VERSDLAALEYLMAKQPRGTVRVGAGNTAGARVSNIFVDVKK 237
E + P I VERSDLA LE+LM+KQPRG VR+G GNT G RVSN+FVDVKK
Sbjct: 181 ESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQPRGNVRIGVGNTVGERVSNVFVDVKK 240
Query: 238 FQTQYEDAMKKAAGKDTDTNWEARLSAIQAIRSISNWLYWQL-P-----NAESYQNLTRS 291
FQ +Y AM + K+T E ++SA++AIRSISNWLYW+ P + ES +LT +
Sbjct: 241 FQERYAKAMSRTT-KETSQR-EVQISAVEAIRSISNWLYWRSSPYTKPLSPESNMSLTFT 298
Query: 292 KQKLK-EPNIKKLLDAAAARKQASQS--TKSVPSNCMHHDEYWSPSTHALPDTTQSNRSF 348
K+K +P+I+KL D AA KQA QS TK S + ++YWSPS ALP + +N S
Sbjct: 299 KRKKAVDPDIRKLQDVVAAMKQADQSGRTKEKGSAYLLGEDYWSPSNAALPSSGNNNGS- 357
Query: 349 KAASESPYNKEWKKANDRNYSVREENRRSPIALGIPIVTAAIAAAMVRMQVDQGVSDGLK 408
KA+S ++ + ++ S R ENRR PI TA +A +V+ Q + L
Sbjct: 358 KASSNPQVTRKTFPSEEKPTS-RRENRRQFRIKKFPIGTAIVAVFLVQYQASYRAASELN 416
Query: 409 EHVGGSLALIIVNSSWLQVMLAGITWYFIGAAVVELIEVIGNRQE 453
+H+GGSLAL IVNS W Q++LAG+TWYFIGA +++L+E + ++ E
Sbjct: 417 DHIGGSLALSIVNSPWQQILLAGVTWYFIGAMLLQLVEAVQHKLE 461
|
|
| TAIR|locus:2052426 AT2G42750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827820 AT2G17880 "AT2G17880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2088100 AT3G13310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135159 J11 "AT4G36040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119465 J20 "AT4G13830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q55980 sll0662 "Ferredoxin (Bacterial type ferredoxin family)" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74B05 GSU2406 "DnaJ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2406 GSU_2406 "dnaJ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QM13 DNAJA1 "DnaJ homolog subfamily A member 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 453 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 8e-18 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 3e-13 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 4e-13 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 7e-13 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 2e-12 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 3e-12 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-11 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 5e-11 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 5e-11 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 6e-11 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 1e-10 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 2e-10 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 2e-10 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 3e-10 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 2e-09 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 4e-09 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 5e-09 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 4e-08 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 4e-08 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 6e-08 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 9e-08 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-07 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 5e-07 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-07 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 8e-07 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 8e-07 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-06 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 1e-06 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 2e-06 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-06 | |
| pfam13370 | 58 | pfam13370, Fer4_13, 4Fe-4S single cluster domain | 2e-06 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 5e-06 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 1e-05 | |
| pfam13459 | 60 | pfam13459, Fer4_15, 4Fe-4S single cluster domain | 2e-05 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 2e-05 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 9e-05 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 9e-05 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 4e-04 | |
| PRK03578 | 176 | PRK03578, hscB, co-chaperone HscB; Provisional | 6e-04 | |
| TIGR00714 | 155 | TIGR00714, hscB, Fe-S protein assembly co-chaperon | 0.001 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 76.8 bits (190), Expect = 8e-18
Identities = 25/63 (39%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
Query: 50 DLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAGSAG--HDMAIILNEAYSVLSDPNSRL 107
D Y++LG+ + +IK AYR L + HPD + +NEAY VLSDP R
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60
Query: 108 AYD 110
YD
Sbjct: 61 IYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222081 pfam13370, Fer4_13, 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 453 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.92 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.88 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.86 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.83 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.82 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.79 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.75 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.74 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.73 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.72 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.72 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.72 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.7 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.68 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.68 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.67 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.66 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.64 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.64 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.63 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.63 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.63 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.63 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.61 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.61 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.61 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.56 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.54 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.53 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.51 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.48 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.48 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.47 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.38 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.35 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.34 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.3 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.29 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.26 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.24 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.18 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.17 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.16 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.05 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.02 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.93 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.91 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.78 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.69 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.53 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.08 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.99 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.63 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 96.71 | |
| COG1141 | 68 | Fer Ferredoxin [Energy production and conversion] | 96.67 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 96.64 | |
| PF13370 | 58 | Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A | 96.42 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.58 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 94.2 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 93.78 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 89.82 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.92 E-value=2.2e-26 Score=235.34 Aligned_cols=127 Identities=32% Similarity=0.519 Sum_probs=95.3
Q ss_pred CccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC--CchHHHHHHHHHHHhhcCCCCchhhhhHHHhhhcCCC----
Q 012925 47 MDFDLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAG--SAGHDMAIILNEAYSVLSDPNSRLAYDKEQAKTAGLR---- 120 (453)
Q Consensus 47 ~~~DyYevLGV~~~As~~eIKkAYRklalk~HPDk~~--~~a~~~f~~I~eAYevLsDp~kR~~YD~~g~~~~~~~---- 120 (453)
...|||+||||+++||.+||||||||||++||||+|+ +.++++|++|++||+|||||++|++||++|.......
T Consensus 2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg 81 (371)
T COG0484 2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGG 81 (371)
T ss_pred CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCC
Confidence 5689999999999999999999999999999999998 3489999999999999999999999999987664311
Q ss_pred ----CCC--CCCCcccccCCcch----h-h-----------------hhc-----ccceecccCcccccccCcee----e
Q 012925 121 ----GYT--GKPIYSVWFGSESE----Q-R-----------------AVF-----VDEVKCVGCLKCALFAGKTF----A 163 (453)
Q Consensus 121 ----g~~--g~~~fs~ffG~~~~----~-~-----------------~vF-----vDE~~CIGC~kCsl~a~~tF----a 163 (453)
+|. -.++|+.|||++.. . + +++ +.....+-|..|++...+.. .
T Consensus 82 ~g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~t 161 (371)
T COG0484 82 FGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKT 161 (371)
T ss_pred CCcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCc
Confidence 122 26688899954321 1 0 111 11135677888887754433 4
Q ss_pred eecccCccee
Q 012925 164 IESAYGRARV 173 (453)
Q Consensus 164 ie~~~GRARV 173 (453)
+.+|.|.+.+
T Consensus 162 C~tC~G~G~v 171 (371)
T COG0484 162 CPTCNGSGQV 171 (371)
T ss_pred CCCCCCcCeE
Confidence 5566676644
|
|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1141 Fer Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 453 | ||||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 2e-06 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 2e-05 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 2e-05 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 3e-05 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 4e-05 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 9e-05 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 1e-04 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 1e-04 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-04 | ||
| 3uo3_A | 181 | Jac1 Co-Chaperone From Saccharomyces Cerevisiae, 5- | 2e-04 | ||
| 3uo2_A | 175 | Jac1 Co-Chaperone From Saccharomyces Cerevisiae Len | 2e-04 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 3e-04 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 3e-04 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 3e-04 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 4e-04 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 6e-04 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 9e-04 |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
|
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|3UO3|A Chain A, Jac1 Co-Chaperone From Saccharomyces Cerevisiae, 5-182 Clone Length = 181 | Back alignment and structure |
| >pdb|3UO2|A Chain A, Jac1 Co-Chaperone From Saccharomyces Cerevisiae Length = 175 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 453 | |||
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 9e-16 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 5e-15 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 1e-14 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-14 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 8e-14 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 2e-13 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-13 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-13 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 2e-13 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-13 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 3e-13 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-13 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 6e-13 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-12 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-12 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 2e-12 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-12 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 3e-12 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 4e-12 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 5e-12 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 8e-12 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 1e-11 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 1e-11 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 3e-11 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 3e-11 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 4e-11 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 5e-11 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 9e-11 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 4e-10 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-09 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 6e-09 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 2e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-08 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 3e-06 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 3e-06 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 3e-04 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
Score = 72.2 bits (177), Expect = 9e-16
Identities = 18/89 (20%), Positives = 29/89 (32%), Gaps = 7/89 (7%)
Query: 50 DLYDLLGI--DSSSDQSQIKTAYRMLQKRCHPDIAGSAGHDMAIILNEAYSVLSDPNSRL 107
L DLLG+ + + ++ AY K HPD G + N Y + D
Sbjct: 9 QLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKM--NTLYKKMEDGVKYA 66
Query: 108 AYDK--EQAKTAGLRGYTGKPIYSVWFGS 134
+ Y G + W+ +
Sbjct: 67 HQPDFGGFWDATEIPTY-GTDEWEQWWNA 94
|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Length = 60 | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Length = 66 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 453 | |||
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.78 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.78 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.77 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.77 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.76 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.76 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.75 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.75 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.75 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.75 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.75 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.74 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.73 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.73 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.73 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.73 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.67 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.67 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.67 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.67 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.65 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.63 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.6 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.6 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.58 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.57 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.57 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.53 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.52 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.51 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.5 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.5 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.49 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.88 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.59 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 88.75 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 88.55 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 84.99 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 84.55 |
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.78 E-value=4.8e-20 Score=166.81 Aligned_cols=115 Identities=23% Similarity=0.352 Sum_probs=84.3
Q ss_pred CCccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc--------hHHHHHHHHHHHhhcCCCCchhhhhHHHhhhc
Q 012925 46 NMDFDLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAGSA--------GHDMAIILNEAYSVLSDPNSRLAYDKEQAKTA 117 (453)
Q Consensus 46 ~~~~DyYevLGV~~~As~~eIKkAYRklalk~HPDk~~~~--------a~~~f~~I~eAYevLsDp~kR~~YD~~g~~~~ 117 (453)
+...|||+||||+++++.++||+|||+|++++|||+++.. +.+.|+.|++||++|+||.+|+.||..+....
T Consensus 7 ~~~~~~y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd~~~~~~~ 86 (155)
T 2l6l_A 7 MPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDD 86 (155)
T ss_dssp CCCSHHHHHHTCCTTCCHHHHHHHHHHHHHHHSCCCCCCCCTTHHHHHHHHHHHHHHHHHHHSSSHHHHCHHHHHHHHHH
T ss_pred CCCCChhHhcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCCchhHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHcchhh
Confidence 4567999999999999999999999999999999998744 35899999999999999999999998764321
Q ss_pred --CCC---------CC-----CCCCCcccccCCcchhhhhcccce---ecccCcccccccCceee
Q 012925 118 --GLR---------GY-----TGKPIYSVWFGSESEQRAVFVDEV---KCVGCLKCALFAGKTFA 163 (453)
Q Consensus 118 --~~~---------g~-----~g~~~fs~ffG~~~~~~~vFvDE~---~CIGC~kCsl~a~~tFa 163 (453)
... .+ .....+.+.||+.+. +..++. ..++|..|+++..+.|+
T Consensus 87 ~~~~~~~~~~~~~~~m~~~e~~~~f~~~CrCG~~f~---i~~~~l~~~~~v~C~sCSl~~~v~~~ 148 (155)
T 2l6l_A 87 LRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYS---VSKDEAEEVSLISCDTCSLIIELLHY 148 (155)
T ss_dssp HHTTCSSSEEEETTTSEEETTTTEEEEECSSSCEEE---EETTHHHHCCEEECSSSSCEEEEECC
T ss_pred ccccccccceeeHHHhccccCCcEEEEcCCCCCeEE---ecHHHhCCCCEEECCCCceEEEEEEc
Confidence 100 00 001123445665432 222222 57889999888777665
|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 453 | ||||
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 3e-13 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 6e-13 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 5e-12 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 4e-11 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 9e-11 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-10 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 6e-10 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 5e-08 | |
| d1fxra_ | 64 | d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte | 1e-05 | |
| d1iqza_ | 81 | d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyt | 4e-05 | |
| d1fxda_ | 58 | d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [T | 8e-05 |
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Large T antigen, the N-terminal J domain species: Murine polyomavirus [TaxId: 10634]
Score = 62.7 bits (152), Expect = 3e-13
Identities = 13/63 (20%), Positives = 22/63 (34%), Gaps = 4/63 (6%)
Query: 50 DLYDLLGID--SSSDQSQIKTAYRMLQKRCHPDIAGSAGHDMAIILNEAYSVLSDPNSRL 107
L +LL + D +++ AY+ HPD GS + N + L
Sbjct: 12 RLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQEL--NSLWGTFKTEVYNL 69
Query: 108 AYD 110
+
Sbjct: 70 RMN 72
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Length = 58 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 453 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.82 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.74 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.72 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.61 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.6 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.52 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.49 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 98.09 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 96.61 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 95.94 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 94.32 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 93.02 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.82 E-value=7.9e-21 Score=151.42 Aligned_cols=68 Identities=31% Similarity=0.567 Sum_probs=62.6
Q ss_pred ccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc--hHHHHHHHHHHHhhcCCCCchhhhhHHHhh
Q 012925 48 DFDLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAGSA--GHDMAIILNEAYSVLSDPNSRLAYDKEQAK 115 (453)
Q Consensus 48 ~~DyYevLGV~~~As~~eIKkAYRklalk~HPDk~~~~--a~~~f~~I~eAYevLsDp~kR~~YD~~g~~ 115 (453)
..|||+||||+++||.+|||+|||++++++|||+++.. ..+.|+.|++||+||+||.+|..||++|..
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~ 71 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA 71 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence 46999999999999999999999999999999998633 578899999999999999999999998753
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|