Citrus Sinensis ID: 013012

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-
MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLSLSSNEYL
ccEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHcccccEEEEEEEEcccccccccccccccccccccccEEEEcccccEEEEEEccccccccccccHHHHccccEEEEccccccEEEEEEcHHHHHHHHHcccccccccccHHHHHHHHHcccccHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccEEEEcccHHHHHHHcHHHcccccccccccccccccEEccccEEccccEEccccEEccccEEccccEEcccEEccccEEccccEEEccEEccccEEccccEEEccEEccccEEccccEEcccEEEcccEEEcccccccccc
cccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEEEcHHHHHHHHHcccccEEEEEEEEEccccccccHHHHHHHHHHHccccEEEEEcccEccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccHHccEEEEccccEEEEEEEcccccHHcEEEccEEcccccccccccccEccEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccccccEEEccccccccccHHHHHHHHHHHHcccccEEEEccccccccccccccccEEEEcccccccccEEcccEEEccccEEccccEEcccEEEcccEEEccccEEccccEEEEEEEcccEEEcccEEEEEEEEEEcEEEcccEEEEEEEEEccEEEEccEEEcccEEEcccEEEEcccEEcccc
MDFQVVVLaggtskklvplvskevpkallpvanrpVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVatvpedvgtAGALRAIAHHLTAKDVLVvsgdlvsdvppgavtaahRRHDAVVTAMICSvpvsglseagssgakdktkkpgryniigmdptKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKseilingapqgqqakengndkvSYRIlanastpsfhelyalgpngsapvrrthKCCVYIASNSKYCVRLNSIQAFMDINRDVIGeanhlsgynfsaqnniihpsaelgskttvgphcmlgegsqmgdkcsvkrsvigrhcrigsNVKVVNSVVMNHVtigdgcsiqgsvicsNAQLQERVALKDCQVLSLSTSVFLslssneyl
mdfqvvvlaggtskklvplvskevpkallpvanRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVsglseagssgakdktkkpgryniigmdptKQFLLHIATgaelekdtriRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILingapqgqqakengNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGrhcrigsnvKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSlstsvflslssneyl
MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKdvlvvsgdlvsdvPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSnvkvvnsvvmnhvTIGDGCSIQGSVICSNAQLQERVALKDCQVlslstsvflslssNEYL
***QVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVP*********************YNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILIN****************SYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLS*******
MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPV****************KPGRYNIIGMDPTKQFLLHIATGA******RIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLSLSSNE*L
MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSG*************KKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLSLSSNEYL
*DFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVS**************KKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGAPQGQ**KENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLSLSS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLSLSSNEYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query451 2.2.26 [Sep-21-2011]
Q54FQ8440 Translation initiation fa yes no 0.904 0.927 0.290 3e-51
P70541452 Translation initiation fa yes no 0.915 0.913 0.315 2e-48
Q4R6T3452 Translation initiation fa N/A no 0.915 0.913 0.324 1e-47
Q9NR50452 Translation initiation fa yes no 0.915 0.913 0.319 5e-46
A5PJI7452 Translation initiation fa yes no 0.915 0.913 0.312 3e-44
P56288458 Probable translation init yes no 0.862 0.849 0.264 9e-37
P32501 712 Translation initiation fa yes no 0.824 0.522 0.219 3e-18
P80361404 Probable translation init yes no 0.809 0.903 0.241 6e-17
P56287 678 Probable translation init no no 0.813 0.541 0.200 1e-16
Q13144 721 Translation initiation fa no no 0.835 0.522 0.232 5e-16
>sp|Q54FQ8|EI2BG_DICDI Translation initiation factor eIF-2B subunit gamma OS=Dictyostelium discoideum GN=eif2b3 PE=3 SV=1 Back     alignment and function desciption
 Score =  203 bits (516), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 127/437 (29%), Positives = 234/437 (53%), Gaps = 29/437 (6%)

Query: 3   FQVVVLA---GGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIK---DLIVVV 56
           FQVV+LA      + KL P +   +P +LLP+ANRP++SY LE LE +  +   + +++V
Sbjct: 6   FQVVILATDKASGNSKLEP-IDATIPHSLLPIANRPLISYQLEFLEKAGFETKSEPVIIV 64

Query: 57  EGADAALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLV-S 115
               +  ++  ++S  Y  ++ VE   + + + T   L  I   +  +  +V++ +LV  
Sbjct: 65  VNETSQEKIKQYVSEIYKGKIEVEFFVLKDQLATCEILYRIRDKIRLEYFMVLNANLVLE 124

Query: 116 DVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRY-NIIGMDPTKQF 174
           D     +   HR+ ++ +T ++   P   + + G    +  TK+   + + I ++   Q 
Sbjct: 125 DTFIRQMADLHRKEESSLTVLL-KPPTPKVEQKGKGATETSTKQDKLFTDYIALEEKSQK 183

Query: 175 LLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVL-DQKDK---F 230
           ++ +    E+E+D    KS+L+    + I  +L D  +Y F+R VL  ++ DQK+K   F
Sbjct: 184 IVMMEPATEVEEDLNFNKSLLKYFPNVTIYTNLQDTQLYIFSRWVLDLIIEDQKEKYPLF 243

Query: 231 QSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTP--SFHELYAL 288
             +K+ ++PYL+  Q+ +       P    +  N N  +S + +++ ++P   F EL   
Sbjct: 244 FDIKKHLIPYLLSCQIPNIKRKRALPA---SAFNQNQTLS-QTMSSTTSPFDQFSEL--- 296

Query: 289 GPNGSAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVI-GEANHLSGYNFSAQNNI 347
               +A   +T KC  ++     YC+ +N+I+ +  INRD+  G+  +L     S +N  
Sbjct: 297 ----NAQKNKTIKCFAHLLKKEGYCMNVNTIKNYQQINRDIAKGDLQYLPNEPKSEKNFF 352

Query: 348 IHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIG 407
           I P+A + + T VGP C++G  + +G KCSVK S+IG+HC+IG  V++ NS++M+HV I 
Sbjct: 353 IDPTANV-TITQVGPQCVIGTSTTLGAKCSVKFSIIGKHCKIGDGVRIENSIIMDHVIIE 411

Query: 408 DGCSIQGSVICSNAQLQ 424
           D C I  S+IC++  ++
Sbjct: 412 DRCVINSSIICNDVYIK 428
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Dictyostelium discoideum (taxid: 44689)
>sp|P70541|EI2BG_RAT Translation initiation factor eIF-2B subunit gamma OS=Rattus norvegicus GN=Eif2b3 PE=2 SV=2 Back     alignment and function description
>sp|Q4R6T3|EI2BG_MACFA Translation initiation factor eIF-2B subunit gamma OS=Macaca fascicularis GN=EIF2B3 PE=2 SV=1 Back     alignment and function description
>sp|Q9NR50|EI2BG_HUMAN Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens GN=EIF2B3 PE=1 SV=1 Back     alignment and function description
>sp|A5PJI7|EI2BG_BOVIN Translation initiation factor eIF-2B subunit gamma OS=Bos taurus GN=EIF2B3 PE=2 SV=1 Back     alignment and function description
>sp|P56288|EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif223 PE=1 SV=2 Back     alignment and function description
>sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 Back     alignment and function description
>sp|P80361|EI2BG_CAEEL Probable translation initiation factor eIF-2B subunit gamma OS=Caenorhabditis elegans GN=ppp-1 PE=2 SV=3 Back     alignment and function description
>sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 Back     alignment and function description
>sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query451
224103999458 predicted protein [Populus trichocarpa] 0.953 0.938 0.814 0.0
356525249459 PREDICTED: translation initiation factor 0.955 0.938 0.789 0.0
359494464463 PREDICTED: translation initiation factor 0.982 0.956 0.816 0.0
296082668461 unnamed protein product [Vitis vinifera] 0.982 0.960 0.816 0.0
357518837 565 Translation initiation factor eIF-2B sub 0.955 0.762 0.778 0.0
356512489468 PREDICTED: translation initiation factor 0.962 0.927 0.763 0.0
224059672508 predicted protein [Populus trichocarpa] 0.953 0.846 0.735 0.0
449452670461 PREDICTED: translation initiation factor 0.955 0.934 0.771 0.0
79328173456 translation initiation factor eIF-2B gam 0.953 0.942 0.736 0.0
297812131456 acyltransferase [Arabidopsis lyrata subs 0.953 0.942 0.736 0.0
>gi|224103999|ref|XP_002313277.1| predicted protein [Populus trichocarpa] gi|222849685|gb|EEE87232.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/442 (81%), Positives = 396/442 (89%), Gaps = 12/442 (2%)

Query: 1   MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGAD 60
           MDFQVVVLAGGT KKL+PLVSK+VPKALLPVANRPVLSYVLEQLELSN+KDLIVVVEG D
Sbjct: 1   MDFQVVVLAGGTCKKLLPLVSKDVPKALLPVANRPVLSYVLEQLELSNLKDLIVVVEGED 60

Query: 61  AALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPG 120
           AAL VGGWIS AYVDRLHVEVA VPEDVGTAGALRAIAHHLTA D+LVVSGDLVSD+PPG
Sbjct: 61  AALHVGGWISNAYVDRLHVEVAAVPEDVGTAGALRAIAHHLTANDILVVSGDLVSDIPPG 120

Query: 121 AVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIAT 180
           A+ A HR+HDAVVT M+CS PVSG +E+GSSG KDK KKP R+NIIG+DP+KQFLLHIAT
Sbjct: 121 ALAAVHRQHDAVVTTMLCSAPVSGPTESGSSGGKDKIKKPRRHNIIGLDPSKQFLLHIAT 180

Query: 181 GAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPY 240
           GAE+EK+ RI+KSILRAV QM+IRADLMDAHMYAF RSVLQEVLD+KDKF+SLK+D+LPY
Sbjct: 181 GAEVEKEIRIQKSILRAVDQMEIRADLMDAHMYAFKRSVLQEVLDEKDKFRSLKEDMLPY 240

Query: 241 LVRSQLKSEILINGAPQGQQAKENGNDKVS--------YRILANASTPSFHELYALGPNG 292
           LVRSQ+KSE+L+NGAPQ +    NGN+KVS         RIL NASTPSFH+LYA   N 
Sbjct: 241 LVRSQMKSEVLLNGAPQAK----NGNEKVSSQNNQAVVSRILTNASTPSFHDLYASSNND 296

Query: 293 SAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSA 352
           S+ VRR HKCC YIAS S+YC RLNSIQAF DINRDVIG+A+HLSGY+FS+ NNIIHPSA
Sbjct: 297 SSLVRRIHKCCAYIASESRYCQRLNSIQAFSDINRDVIGDASHLSGYSFSSHNNIIHPSA 356

Query: 353 ELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSI 412
           +LGS+TTVGPHCML EGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSV+MNHVTIGDGCSI
Sbjct: 357 QLGSRTTVGPHCMLWEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVIMNHVTIGDGCSI 416

Query: 413 QGSVICSNAQLQERVALKDCQV 434
           QGSVICSNAQLQER  LKDCQV
Sbjct: 417 QGSVICSNAQLQERAVLKDCQV 438

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356525249|ref|XP_003531239.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Glycine max] Back     alignment and taxonomy information
>gi|359494464|ref|XP_002266884.2| PREDICTED: translation initiation factor eIF-2B subunit gamma [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082668|emb|CBI21673.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357518837|ref|XP_003629707.1| Translation initiation factor eIF-2B subunit gamma [Medicago truncatula] gi|355523729|gb|AET04183.1| Translation initiation factor eIF-2B subunit gamma [Medicago truncatula] Back     alignment and taxonomy information
>gi|356512489|ref|XP_003524951.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Glycine max] Back     alignment and taxonomy information
>gi|224059672|ref|XP_002299963.1| predicted protein [Populus trichocarpa] gi|222847221|gb|EEE84768.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449452670|ref|XP_004144082.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Cucumis sativus] gi|449493530|ref|XP_004159334.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79328173|ref|NP_001031908.1| translation initiation factor eIF-2B gamma subunit [Arabidopsis thaliana] gi|98961849|gb|ABF59254.1| unknown protein [Arabidopsis thaliana] gi|332005333|gb|AED92716.1| translation initiation factor eIF-2B gamma subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297812131|ref|XP_002873949.1| acyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297319786|gb|EFH50208.1| acyltransferase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query451
TAIR|locus:1009023495456 AT5G19485 [Arabidopsis thalian 0.951 0.940 0.700 3.7e-158
DICTYBASE|DDB_G0290693440 eif2b3 "eukaryotic translation 0.906 0.929 0.270 2.8e-41
UNIPROTKB|F1P4Z9437 EIF2B3 "Uncharacterized protei 0.917 0.947 0.291 9.6e-41
UNIPROTKB|Q4R6T3452 EIF2B3 "Translation initiation 0.953 0.951 0.288 1.1e-39
UNIPROTKB|Q9NR50452 EIF2B3 "Translation initiation 0.953 0.951 0.284 2.1e-38
UNIPROTKB|F1NBJ8418 EIF2B3 "Uncharacterized protei 0.893 0.964 0.290 3.4e-38
RGD|620821452 Eif2b3 "eukaryotic translation 0.953 0.951 0.284 3.4e-38
UNIPROTKB|P70541452 Eif2b3 "Translation initiation 0.953 0.951 0.284 3.4e-38
UNIPROTKB|A5PJI7452 EIF2B3 "Translation initiation 0.917 0.915 0.277 2.4e-37
UNIPROTKB|E2RBJ1452 EIF2B3 "Uncharacterized protei 0.953 0.951 0.267 7.2e-36
TAIR|locus:1009023495 AT5G19485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1541 (547.5 bits), Expect = 3.7e-158, P = 3.7e-158
 Identities = 309/441 (70%), Positives = 352/441 (79%)

Query:     1 MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGAD 60
             MDFQVV+LAGG S  LVPLV+KEVPKALLPVANRPVLSYVL+ LE SN+KDLIVVVEG D
Sbjct:     1 MDFQVVILAGGFSSYLVPLVAKEVPKALLPVANRPVLSYVLDLLESSNLKDLIVVVEGED 60

Query:    61 AALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKXXXXXXXXXXXXXPPG 120
             AAL+VGGWIS+A VDRLHVEVA V E+VGTAGALRAIAHHLTAK             PPG
Sbjct:    61 AALKVGGWISSACVDRLHVEVAAVAENVGTAGALRAIAHHLTAKDILIVSGDIVSDIPPG 120

Query:   121 AVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIAT 180
             AV A HRRHDA VT M+C+ PVSG SE+G SG KDKTKKP   +IIG+D  KQFLL+IA 
Sbjct:   121 AVAATHRRHDAAVTVMLCAQPVSGPSESGGSGGKDKTKKPACDDIIGLDSLKQFLLYIAK 180

Query:   181 GAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPY 240
             G E++KDTR++KSIL A G+M+IR+DLMD+H+YAF R+VLQEVLDQK  F+SLKQDVLPY
Sbjct:   181 GTEIKKDTRVKKSILCAAGKMEIRSDLMDSHIYAFKRAVLQEVLDQKPAFRSLKQDVLPY 240

Query:   241 LVRSQLKSEILI-------NGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGS 293
             LVR+QL+S++         NG   G+   +N N+ V  +IL+NAS PSFH++Y  G    
Sbjct:   241 LVRTQLRSDVFSDQSNVEENGNGNGKNNMQN-NEVVLSQILSNASMPSFHQVYESGLG-- 297

Query:   294 APVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAE 353
                R+THKCCVYIA  SKY VRLNSIQAFMD+NRDVIGE+NHLSGY+FSA +NI+HPSAE
Sbjct:   298 --TRKTHKCCVYIADESKYFVRLNSIQAFMDVNRDVIGESNHLSGYSFSAHHNIVHPSAE 355

Query:   354 LGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSXXXXXXXXXXXXXTIGDGCSIQ 413
             LGSKTTVGPHCMLGEGSQ+GDKCSVKRSVIGRHCRIGS             TIGDGCSIQ
Sbjct:   356 LGSKTTVGPHCMLGEGSQVGDKCSVKRSVIGRHCRIGSNVKIVNSVVMDHATIGDGCSIQ 415

Query:   414 GSVICSNAQLQERVALKDCQV 434
             GSVICSNAQLQERV L+DCQV
Sbjct:   416 GSVICSNAQLQERVTLRDCQV 436
GO:0005737 "cytoplasm" evidence=ISM
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016779 "nucleotidyltransferase activity" evidence=IEA
DICTYBASE|DDB_G0290693 eif2b3 "eukaryotic translation initiation factor 2B, subunit 3 gamma" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4Z9 EIF2B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R6T3 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR50 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBJ8 EIF2B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|620821 Eif2b3 "eukaryotic translation initiation factor 2B, subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P70541 Eif2b3 "Translation initiation factor eIF-2B subunit gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJI7 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBJ1 EIF2B3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NR50EI2BG_HUMANNo assigned EC number0.31990.91570.9137yesno
A5PJI7EI2BG_BOVINNo assigned EC number0.31250.91570.9137yesno
P70541EI2BG_RATNo assigned EC number0.31540.91570.9137yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 7e-64
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 8e-49
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 1e-33
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, 5e-31
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 3e-25
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 2e-21
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 3e-19
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 1e-18
cd04197217 cd04197, eIF-2B_epsilon_N, The N-terminal domain o 1e-15
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 5e-14
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 7e-13
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 2e-11
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 3e-11
PRK00892 343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 5e-11
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 8e-11
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 2e-10
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 4e-10
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 5e-10
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 3e-09
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 5e-09
cd03352 205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 6e-09
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 8e-09
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 1e-08
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 3e-08
PRK05289 262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr 4e-08
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 8e-08
cd03351 254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin 1e-07
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 2e-07
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 2e-07
pfam12804178 pfam12804, NTP_transf_3, MobA-like NTP transferase 2e-07
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 2e-07
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 3e-07
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 4e-07
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 5e-07
PRK14353446 PRK14353, glmU, bifunctional N-acetylglucosamine-1 5e-07
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 1e-06
PRK12461 255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr 2e-06
TIGR01852 254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei 2e-06
COG1213239 COG1213, COG1213, Predicted sugar nucleotidyltrans 2e-06
COG4750231 COG4750, LicC, CTP:phosphocholine cytidylyltransfe 3e-06
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 4e-06
COG0746192 COG0746, MobA, Molybdopterin-guanine dinucleotide 4e-06
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 5e-06
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short f 5e-06
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 6e-06
PRK02862429 PRK02862, glgC, glucose-1-phosphate adenylyltransf 7e-06
PRK14360450 PRK14360, glmU, bifunctional N-acetylglucosamine-1 8e-06
cd02503181 cd02503, MobA, MobA catalyzes the formation of mol 8e-06
cd02516218 cd02516, CDP-ME_synthetase, CDP-ME synthetase is i 9e-06
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-05
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 1e-05
TIGR01853 324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 2e-05
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 3e-05
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyl 3e-05
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p 3e-05
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 4e-05
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 4e-05
TIGR01853 324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 5e-05
TIGR01207286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltra 5e-05
cd04182186 cd04182, GT_2_like_f, GT_2_like_f is a subfamily o 6e-05
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti 7e-05
PRK14354 458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 9e-05
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca 1e-04
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell 1e-04
cd0582480 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate 2e-04
COG1043 260 COG1043, LpxA, Acyl-[acyl carrier protein] 2e-04
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 2e-04
TIGR00453217 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phospha 2e-04
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p 3e-04
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 4e-04
PRK00155227 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphat 4e-04
PRK14358481 PRK14358, glmU, bifunctional N-acetylglucosamine-1 4e-04
COG1211230 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erith 5e-04
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch 5e-04
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase ( 5e-04
PRK09382378 PRK09382, ispDF, bifunctional 2-C-methyl-D-erythri 6e-04
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 7e-04
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 8e-04
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 8e-04
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 0.001
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 0.001
TIGR01105297 TIGR01105, galF, UTP-glucose-1-phosphate uridylylt 0.001
COG2068199 COG2068, COG2068, Uncharacterized MobA-related pro 0.001
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 0.001
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 0.001
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 0.002
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): 0.004
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr 0.004
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information 
 Score =  204 bits (522), Expect = 7e-64
 Identities = 86/220 (39%), Positives = 126/220 (57%), Gaps = 8/220 (3%)

Query: 3   FQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAA 62
           FQ V+LAGG   +L PL    +PKALLPVAN+P++ Y L+ LE +  +D+IVVV   + A
Sbjct: 1   FQAVILAGGGGSRLYPLTDN-IPKALLPVANKPMIWYPLDWLEKAGFEDVIVVVPEEEQA 59

Query: 63  LRVGGWISA--AYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPG 120
                  S       +L      + ED+GTA +LR I   +  KD LV+S DL++D+P  
Sbjct: 60  EISTYLRSFPLNLKQKLDEVTIVLDEDMGTADSLRHIRKKIK-KDFLVLSCDLITDLPLI 118

Query: 121 AVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIAT 180
            +   HR HDA +T ++   PVS   +    G K K+KK    ++IG+D   Q LL I +
Sbjct: 119 ELVDLHRSHDASLTVLLYPPPVSSEQK----GGKGKSKKADERDVIGLDEKTQRLLFITS 174

Query: 181 GAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVL 220
             +L++D  +RKS+L+   ++ I   L+DAH+Y F R VL
Sbjct: 175 EEDLDEDLELRKSLLKRHPRVTITTKLLDAHVYIFKRWVL 214

N-terminal domain of gamma subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit gamma shares sequence similarity with epsilon subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 214
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221780 pfam12804, NTP_transf_3, MobA-like NTP transferase domain Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|223817 COG0746, MobA, Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133000 cd02503, MobA, MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|133025 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|213532 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|234670 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224132 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|236492 PRK09382, ispDF, bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|130175 TIGR01105, galF, UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>gnl|CDD|224979 COG2068, COG2068, Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 451
KOG1462433 consensus Translation initiation factor 2B, gamma 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 100.0
KOG1461 673 consensus Translation initiation factor 2B, epsilo 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 100.0
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 100.0
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 100.0
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 99.98
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 99.98
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 99.98
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.97
PRK10122297 GalU regulator GalF; Provisional 99.97
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 99.97
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 99.97
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 99.97
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.96
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 99.96
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 99.96
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 99.96
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 99.96
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 99.96
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.96
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.95
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.95
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.95
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.92
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.92
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.91
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.91
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.89
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.88
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.87
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.85
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.84
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.83
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.81
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.8
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 99.72
PLN02917293 CMP-KDO synthetase 99.7
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.66
COG4750231 LicC CTP:phosphocholine cytidylyltransferase invol 99.65
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 99.65
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.62
TIGR00454183 conserved hypothetical protein TIGR00454. At this 99.61
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.58
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.58
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 99.57
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.56
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.56
PRK13627196 carnitine operon protein CaiE; Provisional 99.56
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.55
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.54
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 99.52
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 99.52
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.51
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 99.51
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.5
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.5
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.49
cd03351 254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.49
PLN02296269 carbonate dehydratase 99.49
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.48
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.48
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 99.48
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.48
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.47
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 99.47
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.47
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.46
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.46
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.46
PLN02472246 uncharacterized protein 99.46
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.46
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 99.46
cd02503181 MobA MobA catalyzes the formation of molybdopterin 99.46
PRK05289 262 UDP-N-acetylglucosamine acyltransferase; Provision 99.45
TIGR01852 254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.45
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.44
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.44
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.44
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.44
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.44
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 99.44
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.44
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.43
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 99.43
KOG1461 673 consensus Translation initiation factor 2B, epsilo 99.43
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.43
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.41
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.41
COG2068199 Uncharacterized MobA-related protein [General func 99.4
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.4
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.4
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.4
PLN02296269 carbonate dehydratase 99.39
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 99.39
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 99.39
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.39
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 99.39
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.39
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.38
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.38
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.38
PRK12461 255 UDP-N-acetylglucosamine acyltransferase; Provision 99.38
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.38
KOG1462433 consensus Translation initiation factor 2B, gamma 99.37
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.36
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.36
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.35
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.35
PF01128221 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.35
PLN02472246 uncharacterized protein 99.35
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.34
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.33
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.33
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.32
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.32
PRK13627196 carnitine operon protein CaiE; Provisional 99.32
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.31
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.31
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.3
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 99.3
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.29
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.28
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.28
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.28
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.28
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.28
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.27
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.27
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.27
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.26
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.26
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 99.25
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.24
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 99.24
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 99.23
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.23
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.22
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.22
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.21
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.21
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.21
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.21
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.2
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.2
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.18
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.17
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 99.17
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 99.16
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 99.15
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.13
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.13
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 99.13
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 99.12
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.11
PRK14500346 putative bifunctional molybdopterin-guanine dinucl 99.11
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.1
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 99.03
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.03
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 99.01
PLN02694294 serine O-acetyltransferase 98.99
COG1043260 LpxA Acyl-[acyl carrier protein] 98.99
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.98
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 98.98
PRK10502182 putative acyl transferase; Provisional 98.97
PRK10191146 putative acyl transferase; Provisional 98.96
PRK10092183 maltose O-acetyltransferase; Provisional 98.96
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.96
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.96
PRK11132273 cysE serine acetyltransferase; Provisional 98.96
PRK10502182 putative acyl transferase; Provisional 98.95
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.93
PLN02357360 serine acetyltransferase 98.92
PLN02241436 glucose-1-phosphate adenylyltransferase 98.92
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.92
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.91
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.9
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.89
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.89
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.88
PRK10191146 putative acyl transferase; Provisional 98.86
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.86
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.86
PRK11132273 cysE serine acetyltransferase; Provisional 98.85
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.84
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.84
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 98.83
PLN02739355 serine acetyltransferase 98.83
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.82
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.81
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 98.81
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.8
PLN02694294 serine O-acetyltransferase 98.79
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.79
PLN02357360 serine acetyltransferase 98.77
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.77
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.77
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 98.77
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.76
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.76
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.71
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.7
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 98.67
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 98.66
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.64
PLN02739355 serine acetyltransferase 98.62
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.62
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 98.6
PRK10092183 maltose O-acetyltransferase; Provisional 98.59
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 98.58
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 98.51
PTZ00339482 UDP-N-acetylglucosamine pyrophosphorylase; Provisi 98.49
COG1861241 SpsF Spore coat polysaccharide biosynthesis protei 98.47
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.44
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.41
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.29
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.26
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.07
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 98.02
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.01
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthes 97.94
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 97.88
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.88
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 97.87
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.72
COG4801 277 Predicted acyltransferase [General function predic 97.66
PLN02474469 UTP--glucose-1-phosphate uridylyltransferase 97.58
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glu 97.57
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.56
COG4801 277 Predicted acyltransferase [General function predic 97.41
PLN02435493 probable UDP-N-acetylglucosamine pyrophosphorylase 97.41
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.4
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.4
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.31
PF01704420 UDPGP: UTP--glucose-1-phosphate uridylyltransferas 97.24
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transp 97.01
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 96.93
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 96.87
PLN02830615 UDP-sugar pyrophosphorylase 96.48
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 95.78
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 95.57
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 95.39
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 94.98
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 91.18
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 91.04
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 90.75
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 88.6
cd06423180 CESA_like CESA_like is the cellulose synthase supe 88.52
cd04188211 DPG_synthase DPG_synthase is involved in protein N 88.23
PRK10073328 putative glycosyl transferase; Provisional 87.94
cd06442224 DPM1_like DPM1_like represents putative enzymes si 87.4
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 86.36
KOG2388477 consensus UDP-N-acetylglucosamine pyrophosphorylas 85.88
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 85.85
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 85.51
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 84.89
PRK10018279 putative glycosyl transferase; Provisional 84.43
PRK11204420 N-glycosyltransferase; Provisional 83.91
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 82.96
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 81.57
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 81.2
KOG2978238 consensus Dolichol-phosphate mannosyltransferase [ 80.56
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=2e-58  Score=423.66  Aligned_cols=410  Identities=31%  Similarity=0.516  Sum_probs=315.5

Q ss_pred             CCceEEEEecCCCCCCCCCCCCCCcccccccCCcchHHHHHHHHHHCCCcEEEEEecCchhhHHHHHhhhhhccCceeeE
Q 013012            1 MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVE   80 (451)
Q Consensus         1 m~~~avIlAgG~g~Rl~pl~~~~~pK~llpv~gkpli~~~l~~l~~~gi~~iivv~~~~~~~~~i~~~~~~~~~~~~~~~   80 (451)
                      |+|||||+|||.|+||--+ +...||+||||+|+|||+|+|++|.++|+++++|++...+ .+.+++++.+.+.-+....
T Consensus         8 ~efqavV~a~~ggt~~p~~-~~~~pKaLLPIgn~PMi~YpL~~L~~~gfteiiVv~~e~e-~~~i~~al~~~~~l~~~~~   85 (433)
T KOG1462|consen    8 SEFQAVVLAGGGGTRMPEV-TSRLPKALLPIGNKPMILYPLNSLEQAGFTEIIVVVNEDE-KLDIESALGSNIDLKKRPD   85 (433)
T ss_pred             HHhhhheeecCCceechhh-hhhcchhhcccCCcceeeeehhHHHhcCCeEEEEEecHHH-HHHHHHHHhcCCccccccc
Confidence            4689999999999999666 8899999999999999999999999999999999998433 4578888866443232222


Q ss_pred             EEEcC----CCCChHHHHHHHHhcCCCCcEEEEcCCccCCCCchHHHHHHHhcCceEEEEEeeeccCCCccCCCCCCccc
Q 013012           81 VATVP----EDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDK  156 (451)
Q Consensus        81 i~~~~----~~~gt~~~l~~~~~~l~~~~~lvl~~D~i~~~~~~~~l~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~  156 (451)
                      ++..+    +..||+++|+.....++.+||+|++||++++.++..+++++|..++.+.+++....    ++...++.+.+
T Consensus        86 ~v~ip~~~~~d~gtadsLr~Iy~kikS~DflvlsCD~Vtdv~l~~lvd~FR~~d~slamli~~~~----s~~~~pgqk~k  161 (433)
T KOG1462|consen   86 YVEIPTDDNSDFGTADSLRYIYSKIKSEDFLVLSCDFVTDVPLQPLVDKFRATDASLAMLIGNAL----SEVPIPGQKGK  161 (433)
T ss_pred             EEEeecccccccCCHHHHhhhhhhhccCCEEEEecccccCCCcHHHHHHHhccChhHhHHhcccc----ccccccCcccc
Confidence            33222    24799999999999998779999999999999999999999988877666555221    11111122222


Q ss_pred             CCCCCcccEEEecCCCceEEEeeccccccccccccHHHHhhcCeeEEecCCccceEEeechHHHHHHHhcCccccccccc
Q 013012          157 TKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQD  236 (451)
Q Consensus       157 ~~~~~~~~~v~~d~~~~~l~~~~~~~~~ek~~~i~~~~~~~~~~~~~~s~l~~~giYi~~~~~l~~~~~~~~~~~s~~~d  236 (451)
                        ++....++..+++++++.+.....+.++++.++++++++||++++.++|.|+|+|+|+.|+++. +.+.++..|++-+
T Consensus       162 --~k~~~d~igi~e~t~rl~y~~~~~d~~~~l~i~~slL~~~prltl~t~L~dahiY~~k~~v~d~-l~~~~sisSfk~~  238 (433)
T KOG1462|consen  162 --KKQARDVIGINEDTERLAYSSDSADEEEPLVIRKSLLWNHPRLTLTTKLVDAHIYVFKHWVIDL-LSEKESISSFKAD  238 (433)
T ss_pred             --cccccceeeeccccceeEEeecCCcCCCceehhhhhhhcCCceEEeccccceeeeeeHHHHHHH-HhcCCcceeeccc
Confidence              2234578999999998888887778899999999999999999999999999999999999974 5777788999999


Q ss_pred             hhhHHHHhccccccccCCCCCCccccccCCCcchhhhhccCCCCCccccccCCCCCCCCCCCcceeEEEEeccchhhhhc
Q 013012          237 VLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRL  316 (451)
Q Consensus       237 ~lp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i  316 (451)
                      |+|+|+++|++.........         +--...+.+.+       .      .+........+|++|..+....+.|+
T Consensus       239 f~P~lvkkQ~q~~~~~~~~~---------~~~l~t~~~~~-------~------d~~~~~~d~ik~y~~~~p~e~~~~ra  296 (433)
T KOG1462|consen  239 FLPYLVKKQFQKNPPLKKNE---------TSILPTPNLNN-------P------DGIHSPDDRIKCYAYILPTESLFVRA  296 (433)
T ss_pred             ccchhhhhhhhcCCCccccc---------ccccCCccccC-------c------ccccCcccceeeeEEEccCccceEEe
Confidence            99999999986543321100         00000001100       0      01000012478999999998888999


Q ss_pred             cCHHHHHHHchhc-cccccccCCccccCCCceeCCCCeeCCCcEECCCCEECCCCEECCCCEEeceEECCCCEECCCcEE
Q 013012          317 NSIQAFMDINRDV-IGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKV  395 (451)
Q Consensus       317 ~~~~~y~~~~~~~-l~~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i~~svig~~~~ig~~~~i  395 (451)
                      +++..|+++|++- +.....   .     ...+...+..  .+.+|.+++++++|.|++++.|+.|+||.+|.||+.++|
T Consensus       297 NtL~~y~eiN~~k~~~~l~~---e-----~~~~k~~~~~--~~l~g~d~iv~~~t~i~~~s~ik~SviG~nC~Ig~~~~v  366 (433)
T KOG1462|consen  297 NTLLSYMEINRDKKLKKLCS---E-----AKFVKNYVKK--VALVGADSIVGDNTQIGENSNIKRSVIGSNCDIGERVKV  366 (433)
T ss_pred             cchHHHHhhhHHHHHHHhcc---c-----cccccchhhh--eeccchhhccCCCceecccceeeeeeecCCccccCCcEE
Confidence            9999999999632 111110   0     0001111111  145678899999999999999999999999999999999


Q ss_pred             eceEECCCCEECCCcEEeCeEECCCCEECCCcEEcceEECCCCEECCCCccCCCcC
Q 013012          396 VNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVLSLSTSVFLSLSSNEYL  451 (451)
Q Consensus       396 ~~s~i~~~~~Ig~~~~i~~~ii~~~~~i~~~~~i~~~~ig~~~~i~~~~~~~~~~~  451 (451)
                      .+|+||+||+||+|+.|++||||.+|+||+|+.+.+|.||+|.+|+++.+..++.+
T Consensus       367 ~nSilm~nV~vg~G~~IensIIg~gA~Ig~gs~L~nC~Ig~~yvVeak~~~~~ev~  422 (433)
T KOG1462|consen  367 ANSILMDNVVVGDGVNIENSIIGMGAQIGSGSKLKNCIIGPGYVVEAKGKHGGEVL  422 (433)
T ss_pred             EeeEeecCcEecCCcceecceecccceecCCCeeeeeEecCCcEEcccccccccEe
Confidence            99999999999999999999999999999999999999999999999988887753

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>PLN02830 UDP-sugar pyrophosphorylase Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>KOG2388 consensus UDP-N-acetylglucosamine pyrophosphorylase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>KOG2978 consensus Dolichol-phosphate mannosyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
1lvw_A295 Crystal Structure Of Glucose-1-phosphate Thymidylyl 5e-05
1h5t_A293 Thymidylyltransferase Complexed With Thymidylyldiph 1e-04
3pkq_A292 Q83d Variant Of S. Enterica Rmla With Dgtp Length = 1e-04
3pkp_A292 Q83s Variant Of S. Enterica Rmla With Datp Length = 1e-04
1h5r_B293 Thymidylyltransferase Complexed With Thimidine And 1e-04
1h5s_A293 Thymidylyltransferase Complexed With Tmp Length = 2 1e-04
1h5s_D293 Thymidylyltransferase Complexed With Tmp Length = 2 1e-04
1mp3_A292 L89t Variant Of S. Enterica Rmla Length = 292 3e-04
1mp4_A292 W224h Variant Of S. Enterica Rmla Length = 292 3e-04
1mp5_A292 Y177f Variant Of S. Enterica Rmla Length = 292 3e-04
1iim_A292 Thymidylyltransferase Complexed With Ttp Length = 2 3e-04
>pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
Query: 6  VVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAAL 63
          +VLAGG+  +L P +++ V K LLP+ ++P++ Y L  L L+ I+D++++    D  L
Sbjct: 7  IVLAGGSGTRLYP-ITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPL 63
>pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 Back     alignment and structure
>pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 Back     alignment and structure
>pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 1e-15
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 6e-15
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 2e-13
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 5e-13
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 6e-13
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 7e-10
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 7e-12
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 1e-11
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 1e-11
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 1e-10
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 3e-06
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 2e-09
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 2e-09
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 6e-09
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 1e-08
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 4e-04
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 1e-08
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 4e-08
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 2e-08
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 1e-05
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 2e-08
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 5e-08
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 6e-08
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 7e-08
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 8e-08
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 1e-07
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 2e-07
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 2e-04
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 8e-04
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 2e-07
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 3e-04
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 4e-07
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 4e-05
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 4e-07
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 5e-07
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 1e-06
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 2e-04
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 4e-04
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 1e-06
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 6e-05
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 2e-06
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 3e-06
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 3e-06
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 5e-06
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 5e-06
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 2e-05
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 2e-05
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 3e-05
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 4e-05
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 4e-05
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 5e-05
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 6e-05
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 6e-05
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 8e-05
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 3e-04
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 8e-05
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structura 2e-04
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 2e-04
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 3e-04
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 5e-04
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
 Score = 75.5 bits (186), Expect = 1e-15
 Identities = 23/121 (19%), Positives = 52/121 (42%), Gaps = 17/121 (14%)

Query: 1   MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGAD 60
           +  + ++LA G   +L PL ++  PKAL+ V  +P++ Y +E L+   I D+I++V    
Sbjct: 24  IRVKAIILAAGLGTRLRPL-TENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIV---- 78

Query: 61  AALRVGGWIS---AAYVDRLHVEVATVPEDV--GTAGALRAIAHHLTAKDVLVVSGDLVS 115
                 G++        ++  V +    +        +L  +   L     ++ + + + 
Sbjct: 79  ------GYLKEQFDYLKEKYGVRLVFNDKYADYNNFYSLYLVKEELA-NSYVIDADNYLF 131

Query: 116 D 116
            
Sbjct: 132 K 132
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Length = 197 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Length = 199 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Length = 236 Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Length = 223 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Length = 231 Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} PDB: 3q7u_A* 3okr_A 2xwn_A* Length = 231 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Length = 228 Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Length = 236 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Length = 236 Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Length = 234 Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Length = 201 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Length = 371 Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Length = 197 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query451
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 100.0
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 100.0
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 99.97
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 99.96
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.95
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.95
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.95
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.95
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.94
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.94
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.94
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.94
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.94
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.93
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.91
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.91
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.89
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.89
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.87
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.86
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.81
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.81
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.78
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.78
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.75
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 99.74
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.73
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 99.73
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.72
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.71
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.7
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.7
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.69
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 99.67
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 99.65
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.64
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.64
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 99.62
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 99.61
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 99.61
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.61
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 99.61
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.61
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 99.58
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.58
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.57
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.57
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.57
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.56
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.56
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 99.56
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.54
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 99.53
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.53
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.52
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 99.51
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.5
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.49
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.49
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.48
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.48
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.48
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.48
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.48
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.47
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structura 99.47
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 99.47
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.46
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.46
4e6u_A 265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.46
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.46
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.46
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.46
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.46
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.46
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.46
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.46
4e79_A 357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.46
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.46
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.45
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.45
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.45
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 99.44
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 99.44
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.44
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.44
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 99.44
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.43
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.43
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.43
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.43
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.42
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.42
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.42
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.42
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.42
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 99.39
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.39
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.38
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.37
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.37
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.37
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.36
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.35
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.34
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.34
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.34
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.34
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.34
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.33
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.33
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.32
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.31
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.3
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.29
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.28
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 99.27
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.22
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.22
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.22
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.19
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.18
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 99.18
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.17
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 99.17
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.17
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.15
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.14
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.13
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.12
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.12
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.12
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.11
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.11
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.11
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.09
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.08
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.07
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.05
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.02
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.02
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.01
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.01
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.01
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.01
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.0
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.0
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 98.99
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 98.91
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 98.89
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.88
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.85
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 98.81
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 98.79
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.7
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.69
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.63
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.57
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.48
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.36
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.27
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.1
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 97.81
3r3i_A528 UTP--glucose-1-phosphate uridylyltransferase; ross 97.48
3gue_A484 UTP-glucose-1-phosphate uridylyltransferase 2; pho 97.01
3ogz_A630 UDP-sugar pyrophosphorylase; LEFT handed beta heli 96.73
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 90.38
3bcv_A240 Putative glycosyltransferase protein; protein stru 90.22
3cgx_A242 Putative nucleotide-diphospho-sugar transferase; Y 87.61
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 86.58
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 83.07
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-45  Score=371.40  Aligned_cols=363  Identities=20%  Similarity=0.332  Sum_probs=254.8

Q ss_pred             CceEEEEecCCCCCCCCCCCCCCcccccccCCc-chHHHHHHHHHHCCCcEEEEEecCchhhHHHHHhhhhhc---cC--
Q 013012            2 DFQVVVLAGGTSKKLVPLVSKEVPKALLPVANR-PVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAY---VD--   75 (451)
Q Consensus         2 ~~~avIlAgG~g~Rl~pl~~~~~pK~llpv~gk-pli~~~l~~l~~~gi~~iivv~~~~~~~~~i~~~~~~~~---~~--   75 (451)
                      +|+|||||||.|+||+|| |...||+|+|++|+ |||+|++++|.++|+++++|+++++.  +.+.+++.+.+   ..  
T Consensus        20 ~~~avILAaG~gtRl~pl-T~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~--~~i~~~~~~~~~~~~~~~   96 (451)
T 1yp2_A           20 SVLGIILGGGAGTRLYPL-TKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNS--ASLNRHLSRAYASNMGGY   96 (451)
T ss_dssp             HEEEEEC------CCTTT-TTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCC--HHHHHHHHHHCC------
T ss_pred             ceEEEEECCCCCCcccch-hcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCH--HHHHHHHhhhhhcccccc
Confidence            389999999999999999 88999999999999 99999999999999999999998652  35556554422   10  


Q ss_pred             --ceeeEEEEc--C-----CCCChHHHHHHHHhcCC---CCcEEEEcCCccCCCCchHHHHHHHhcCceEEEEEeeeccC
Q 013012           76 --RLHVEVATV--P-----EDVGTAGALRAIAHHLT---AKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVS  143 (451)
Q Consensus        76 --~~~~~i~~~--~-----~~~gt~~~l~~~~~~l~---~~~~lvl~~D~i~~~~~~~~l~~~~~~~~~~t~~~~~~~~~  143 (451)
                        ...+.++..  .     ...||+++++.+++++.   .++|+|++||.+++.++.++++.|++.++++|+++.+.+..
T Consensus        97 ~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~~~~tl~~~~~~~~  176 (451)
T 1yp2_A           97 KNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEK  176 (451)
T ss_dssp             --CCEEEEEESCSSTTSCCCCCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEEEEECHH
T ss_pred             cccCcEEEecccccccccccccCcHHHHHHHHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHcCCcEEEEEEEcChh
Confidence              011344431  1     14799999999988774   46799999999889999999999998888888887654311


Q ss_pred             CCccCCCCCCcccCCCCCcccEEEecCCCceEEEeecccccc--ccccccHHHHhhcCee-EEecCCccceEEeechHHH
Q 013012          144 GLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELE--KDTRIRKSILRAVGQM-DIRADLMDAHMYAFNRSVL  220 (451)
Q Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~v~~d~~~~~l~~~~~~~~~e--k~~~i~~~~~~~~~~~-~~~s~l~~~giYi~~~~~l  220 (451)
                                     .+..||++.+|+++++ ..+.++++.+  +...++..++.+++.. ...++++++|+|+|++++|
T Consensus       177 ---------------~~~~~g~v~~d~~~~v-~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l  240 (451)
T 1yp2_A          177 ---------------RATAFGLMKIDEEGRI-IEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVM  240 (451)
T ss_dssp             ---------------HHTTSEEEEECTTSBE-EEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHH
T ss_pred             ---------------hcccCCEEEECCCCCE-EEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHH
Confidence                           1356899999977764 4555322111  0011222222221110 0024688999999999998


Q ss_pred             HHHHhcC-ccccccccchhhHHHHhccccccccCCCCCCccccccCCCcchhhhhccCCCCCccccccCCCCCCCCCCCc
Q 013012          221 QEVLDQK-DKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRT  299 (451)
Q Consensus       221 ~~~~~~~-~~~~s~~~d~lp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  299 (451)
                      ..+++.. ....++.+|+++.+++++                                                      
T Consensus       241 ~~~l~~~~~~~~~~~~~~l~~~i~~g------------------------------------------------------  266 (451)
T 1yp2_A          241 LNLLRDKFPGANDFGSEVIPGATSLG------------------------------------------------------  266 (451)
T ss_dssp             HHHHHTTCTTCCCTTTTHHHHHHHTT------------------------------------------------------
T ss_pred             HHHHHhhcccccchHhhHHHHHHhcC------------------------------------------------------
Confidence            6665543 233456678888776542                                                      


Q ss_pred             ceeEEEEeccchhhhhccCHHHHHHHchhccccccccCCccccCC------CceeCCCCeeCCCcEECCCCEECCCCEEC
Q 013012          300 HKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQ------NNIIHPSAELGSKTTVGPHCMLGEGSQMG  373 (451)
Q Consensus       300 ~~~~~~~~~~~~~~~~i~~~~~y~~~~~~~l~~~~~~~~~~~~~~------~~~i~~~~~i~~~~~i~~~~~i~~~~~i~  373 (451)
                      .++++|  +..++|.+++++++|+++++.++....  .+..++++      .+.+++++.+ .++.| .++.||++|.|+
T Consensus       267 ~~v~~~--~~~~~w~digt~~~l~~a~~~l~~~~~--~~~~~~~~~~~i~~~~~i~~~~~i-~~~~I-~~~~Ig~~~~I~  340 (451)
T 1yp2_A          267 MRVQAY--LYDGYWEDIGTIEAFYNANLGITKKPV--PDFSFYDRSAPIYTQPRYLPPSKM-LDADV-TDSVIGEGCVIK  340 (451)
T ss_dssp             CCEEEE--ECCSCCEECSSHHHHHHHHHGGGCSSS--CSSCSCCSSSCCCCCCCCCCCEEE-EEEEE-EEEEECTTCEEE
T ss_pred             CceEEE--EeCCEEEECCCHHHHHHHHHHHhcccc--cchhccCCCCeeccCCccCCCeEE-cceEE-eCeEECCCCEEc
Confidence            123444  346799999999999999998876531  11122233      3444444444 34555 467888888887


Q ss_pred             CCCEEeceEECCCCEECCCcEEeceEECCC-------------------CEECCCcEEeCeEECCCCEECCCcEEcc---
Q 013012          374 DKCSVKRSVIGRHCRIGSNVKVVNSVVMNH-------------------VTIGDGCSIQGSVICSNAQLQERVALKD---  431 (451)
Q Consensus       374 ~~~~i~~svig~~~~ig~~~~i~~s~i~~~-------------------~~Ig~~~~i~~~ii~~~~~i~~~~~i~~---  431 (451)
                      . |.|.+++||++|.||++|+|.+++++.+                   +.||++|.|++++||++++||++++|.+   
T Consensus       341 ~-~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig~~~~IG~~~~i~~~~~  419 (451)
T 1yp2_A          341 N-CKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDN  419 (451)
T ss_dssp             E-EEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEECTTCEECTTCEECCSSC
T ss_pred             c-eEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeCCCcEECCCCEEeCCcc
Confidence            6 7888999999999999999999988888                   9999999999999999999999998874   


Q ss_pred             -----------------eEECCCCEECCCC
Q 013012          432 -----------------CQVLSLSTSVFLS  444 (451)
Q Consensus       432 -----------------~~ig~~~~i~~~~  444 (451)
                                       ++||++++|++++
T Consensus       420 ~~~~~~ig~~~~ig~~~v~Ig~~a~i~ags  449 (451)
T 1yp2_A          420 VQEAARETDGYFIKSGIVTVIKDALIPSGI  449 (451)
T ss_dssp             CSCEEEGGGTEEEETTEEEECTTCEECTTC
T ss_pred             cccCceeCCCEEEcCCEEEECCCcEECCCc
Confidence                             3566666666665
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure
>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A Back     alignment and structure
>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} Back     alignment and structure
>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>3cgx_A Putative nucleotide-diphospho-sugar transferase; YP_389115.1, joint center for structural genomics; 1.90A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 451
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 2e-15
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 2e-14
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 3e-13
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 3e-13
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 8e-12
d1jyka_229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 1e-09
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-09
d2f9ca1320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-04
d2dpwa1231 c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 2e-08
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 2e-08
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 4e-07
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 0.001
d2oi6a2248 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate 7e-08
d1g97a2250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 1e-07
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 3e-07
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 9e-06
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 4e-04
d1i52a_225 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 2e-06
d1vpaa_221 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 7e-06
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 2e-05
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 2e-05
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 2e-05
d1vgwa_226 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 2e-05
d1w55a1205 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, 2e-05
d1mr7a_203 b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero 4e-05
d1w77a1226 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl- 6e-05
d2cu2a2268 c.68.1.20 (A:1-268) Putative mannose-1-phosphate g 2e-04
d1yp2a1135 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt 0.001
d1g97a1196 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha 0.002
d1e5ka_188 c.68.1.8 (A:) Molybdenum cofactor biosynthesis pro 0.004
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RffH
species: Escherichia coli [TaxId: 562]

 Score = 74.4 bits (183), Expect = 2e-15
 Identities = 31/143 (21%), Positives = 59/143 (41%), Gaps = 9/143 (6%)

Query: 4   QVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAAL 63
           + ++LAGG+  +L P+ ++ V K LLP+ ++P++ Y L  L L+ I++++++    D   
Sbjct: 3   KGIILAGGSGTRLHPI-TRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGY 61

Query: 64  --RVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVV-SGDLVSDVPPG 120
             R+ G  S      + +E A  P   G A A       L  +   +V   ++       
Sbjct: 62  FQRLLGDGSE---FGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFS 118

Query: 121 AVTAAHRRHDAVVTAMICSVPVS 143
                         A +    V 
Sbjct: 119 PKLRHVAARTE--GATVFGYQVM 139
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Length = 221 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Length = 226 Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Length = 205 Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 226 Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268 Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query451
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 100.0
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 100.0
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 99.97
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.97
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.94
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.93
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.9
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.85
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 99.79
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 99.59
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.55
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.55
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.52
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.49
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.48
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.46
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.43
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.41
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 99.41
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.41
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.4
d2jf2a1 262 UDP N-acetylglucosamine acyltransferase {Escherich 99.4
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.39
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 99.38
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.37
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.35
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.34
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.29
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.28
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.25
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.24
d1j2za_ 259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.24
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.22
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.19
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.17
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.15
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.13
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.07
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.07
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.06
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.03
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.01
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 98.99
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 98.94
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 98.92
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.9
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.87
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 98.83
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.77
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.7
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 98.55
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.53
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.43
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.4
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.37
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 97.91
d1jv1a_501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 97.51
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 86.5
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 85.5
d2i5ea1208 Hypothetical protein MM2497 {Methanosarcina mazei 82.03
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 80.22
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=100.00  E-value=2.6e-35  Score=274.46  Aligned_cols=235  Identities=18%  Similarity=0.274  Sum_probs=182.3

Q ss_pred             CceEEEEecCCCCCCCCCCCCCCcccccccCCcchHHHHHHHHHHCCCcEEEEEecCchhhHHHHHhhhhhccCceeeEE
Q 013012            2 DFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEV   81 (451)
Q Consensus         2 ~~~avIlAgG~g~Rl~pl~~~~~pK~llpv~gkpli~~~l~~l~~~gi~~iivv~~~~~~~~~i~~~~~~~~~~~~~~~i   81 (451)
                      +++|||||||.||||+|+ |...||||+||+|+|||+|+|++|..+|+++++++++++. .+.+++++.+.......+.+
T Consensus         1 k~KavILAgG~GtRl~pl-T~~~pKpllpi~gkPiI~~~l~~l~~~Gi~ei~ii~~~~~-~~~i~~~~~~~~~~g~~I~y   78 (292)
T d1fxoa_           1 KRKGIILAGGSGTRLHPA-TLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQD-TPRFQQLLGDGSNWGLDLQY   78 (292)
T ss_dssp             CEEEEEECCCCCTTTTTH-HHHSCGGGSEETTEETTHHHHHHHHHTTCCEEEEEECTTT-HHHHHHHHTTSGGGTCEEEE
T ss_pred             CcEEEEECCCCCCcCChh-hcCCCcccCEECCEehHHHHHHHHHHCCCCEEEEEeCcCC-HHHHHHHhccccccCeEEEE
Confidence            468999999999999999 9999999999999999999999999999999998887443 44677776653222345777


Q ss_pred             EEcCCCCChHHHHHHHHhcCCCCc-EEEEcCCccCCCCchHHHHHHHhcCceEEEEEeeeccCCCccCCCCCCcccCCCC
Q 013012           82 ATVPEDVGTAGALRAIAHHLTAKD-VLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKP  160 (451)
Q Consensus        82 ~~~~~~~gt~~~l~~~~~~l~~~~-~lvl~~D~i~~~~~~~~l~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (451)
                      +.++++.||+++++.+.+++.+++ ++++++|.+++.++.+++++|.++++.+++++.+++                 +|
T Consensus        79 ~~q~~~~Gta~ai~~a~~~i~~~~~~lil~dD~~~~~dl~~ll~~h~~~~~~~~i~~~~V~-----------------~p  141 (292)
T d1fxoa_          79 AVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVL-----------------DP  141 (292)
T ss_dssp             EECSSCCCGGGHHHHTHHHHTTSEEEEEETTEEEECTTHHHHHHHHHTCCSSEEEEEEECS-----------------CG
T ss_pred             ccCCCCCcHHHHHHhhhhhcCCCceEEEEccccccCcCHHHHHHHHHhCCCCcEEEEEECC-----------------CH
Confidence            888889999999999999997665 567777799999999999999999999999887653                 26


Q ss_pred             CcccEEEecCCCceEEEeeccccccccccccHHHHhhcCeeEEecCCccceEEeechHHHHHHHhcCccc--cccccchh
Q 013012          161 GRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKF--QSLKQDVL  238 (451)
Q Consensus       161 ~~~~~v~~d~~~~~l~~~~~~~~~ek~~~i~~~~~~~~~~~~~~s~l~~~giYi~~~~~l~~~~~~~~~~--~s~~~d~l  238 (451)
                      ++||++.+|++++++. +.     |||.             ++.|+++.+|+|+|++++++.+-.-.++.  +..-.|++
T Consensus       142 ~~yGV~~~d~~~ki~~-~~-----EKP~-------------~p~Snla~~G~Y~f~~~~~~~~~~l~~s~rgE~eitD~~  202 (292)
T d1fxoa_         142 ERYGVVEFDQGGKAIS-LE-----EKPL-------------EPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVN  202 (292)
T ss_dssp             GGSEEEEECTTSCEEE-EE-----ESCS-------------SCSSSEEEEEEEEECTTHHHHHHHCCCCTTSSCCHHHHH
T ss_pred             HHCeEEEEcCCCCEeE-EE-----ECCC-------------CCCCCcEEEEEEEEChHHHHHHHhCCCCCCCchhhHHHH
Confidence            6899999999887654 43     5542             34589999999999999987543222211  11124677


Q ss_pred             hHHHHhccccccccCCCCCCccccccCCCcchhhhhccCCCCCccccccCCCCCCCCCCCcceeEEEEeccchhhhhccC
Q 013012          239 PYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRLNS  318 (451)
Q Consensus       239 p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  318 (451)
                      +.+++++.                                                       ..++......+|.|++|
T Consensus       203 ~~~l~~~~-------------------------------------------------------~~~~~~~~~~~W~D~Gt  227 (292)
T d1fxoa_         203 RAYLERGQ-------------------------------------------------------LSVEIMGRGYAWLDTGT  227 (292)
T ss_dssp             HHHHHTTC-------------------------------------------------------EEEEECCTTSEEEECCS
T ss_pred             HHHHHcCC-------------------------------------------------------eEEEEeCCCCEEEeCCC
Confidence            76665431                                                       12223344567999999


Q ss_pred             HHHHHHHchhc
Q 013012          319 IQAFMDINRDV  329 (451)
Q Consensus       319 ~~~y~~~~~~~  329 (451)
                      +++|++++..+
T Consensus       228 ~~~l~~a~~~v  238 (292)
T d1fxoa_         228 HDSLLEAGQFI  238 (292)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            99999999754
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5ea1 c.68.1.21 (A:1-208) Hypothetical protein MM2497 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure