Citrus Sinensis ID: 013090
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 449 | ||||||
| 224108635 | 443 | predicted protein [Populus trichocarpa] | 0.986 | 1.0 | 0.862 | 0.0 | |
| 255541934 | 443 | amino acid binding protein, putative [Ri | 0.986 | 1.0 | 0.860 | 0.0 | |
| 356499934 | 449 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.995 | 0.837 | 0.0 | |
| 356495189 | 449 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.995 | 0.830 | 0.0 | |
| 224101597 | 443 | predicted protein [Populus trichocarpa] | 0.986 | 1.0 | 0.826 | 0.0 | |
| 356499936 | 433 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.993 | 0.812 | 0.0 | |
| 357487953 | 451 | ACR4 [Medicago truncatula] gi|355515599| | 0.986 | 0.982 | 0.809 | 0.0 | |
| 449452827 | 444 | PREDICTED: uncharacterized protein LOC10 | 0.982 | 0.993 | 0.802 | 0.0 | |
| 312281803 | 451 | unnamed protein product [Thellungiella h | 0.991 | 0.986 | 0.782 | 0.0 | |
| 42572033 | 455 | ACT domain-containing protein [Arabidops | 1.0 | 0.986 | 0.769 | 0.0 |
| >gi|224108635|ref|XP_002314917.1| predicted protein [Populus trichocarpa] gi|222863957|gb|EEF01088.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 793 bits (2047), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 384/445 (86%), Positives = 413/445 (92%), Gaps = 2/445 (0%)
Query: 5 MSYSHDSDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLI 64
MS+S+D DDEYEKL RR+NPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLI
Sbjct: 1 MSFSNDMDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLI 60
Query: 65 VTKAYISSDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMRSVGVKQSMD 124
+TKAYISSDG WFMDVFNVTD DGNK+TDE ILDYI K LGPE+CF SSMRSVGVKQSMD
Sbjct: 61 ITKAYISSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFTSSMRSVGVKQSMD 120
Query: 125 HTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAISDPE 184
HTAIELTGSDRPGLLSEVSAVLTHLKCNVV+AEVWTHN RAAA+MQVTDEETG AI DPE
Sbjct: 121 HTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSAIIDPE 180
Query: 185 RLSVIKELLCNVLKGSNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTDDDSLDEK 244
+LS IKELLCNVLKGSNKS AKT VS VTHTERRLHQMMFADRDYER ++D LDEK
Sbjct: 181 KLSRIKELLCNVLKGSNKSRGAKTVVSHGVTHTERRLHQMMFADRDYER--ANNDELDEK 238
Query: 245 QRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEYF 304
QRPNV+VVN +KDYSVVTITSKDRPKL+FDTVCTLTDM+YVVFHANIDAEGPEA+QEY+
Sbjct: 239 QRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEYY 298
Query: 305 IRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT 364
I+HIDGSPVKS+AER+R+IQCL+AAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLT
Sbjct: 299 IKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT 358
Query: 365 VTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTILKVKGNPEDLKSASQDS 424
VTRAEV T++GKAVNTFYV ASGYPVDAK IDSIRQ+IGQTILKVK +PE+ K SQ+S
Sbjct: 359 VTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTILKVKSSPEEQKPVSQES 418
Query: 425 PTRFLFGGLFKSRSFVNFGLVRSCS 449
PTRFLFGGLFKSRSFVNFGLVRS S
Sbjct: 419 PTRFLFGGLFKSRSFVNFGLVRSYS 443
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255541934|ref|XP_002512031.1| amino acid binding protein, putative [Ricinus communis] gi|223549211|gb|EEF50700.1| amino acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356499934|ref|XP_003518790.1| PREDICTED: uncharacterized protein LOC100813551 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356495189|ref|XP_003516462.1| PREDICTED: uncharacterized protein LOC100787134 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224101597|ref|XP_002312346.1| predicted protein [Populus trichocarpa] gi|222852166|gb|EEE89713.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356499936|ref|XP_003518791.1| PREDICTED: uncharacterized protein LOC100813551 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357487953|ref|XP_003614264.1| ACR4 [Medicago truncatula] gi|355515599|gb|AES97222.1| ACR4 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449452827|ref|XP_004144160.1| PREDICTED: uncharacterized protein LOC101218703 [Cucumis sativus] gi|449524655|ref|XP_004169337.1| PREDICTED: uncharacterized protein LOC101228960 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|312281803|dbj|BAJ33767.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|42572033|ref|NP_974107.1| ACT domain-containing protein [Arabidopsis thaliana] gi|332196758|gb|AEE34879.1| ACT domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 449 | ||||||
| TAIR|locus:2033223 | 455 | ACR4 "ACT domain repeat 4" [Ar | 1.0 | 0.986 | 0.769 | 2.9e-183 | |
| TAIR|locus:2044289 | 456 | ACR5 "ACT domain repeat 5" [Ar | 0.991 | 0.975 | 0.696 | 5.7e-162 | |
| TAIR|locus:2078678 | 433 | ACR6 "ACT domain repeat 6" [Ar | 0.939 | 0.974 | 0.616 | 1.6e-132 | |
| TAIR|locus:2025317 | 453 | ACR3 "ACT domain repeat 3" [Ar | 0.884 | 0.876 | 0.569 | 2.1e-116 | |
| TAIR|locus:2034630 | 441 | ACR8 "AT1G12420" [Arabidopsis | 0.948 | 0.965 | 0.498 | 2e-104 | |
| TAIR|locus:2145482 | 500 | AT5G25320 [Arabidopsis thalian | 0.472 | 0.424 | 0.473 | 1.2e-100 | |
| TAIR|locus:2132609 | 449 | ACR7 "ACT domain repeat 7" [Ar | 0.875 | 0.875 | 0.514 | 7.4e-98 | |
| TAIR|locus:2152094 | 477 | ACR1 "ACT domain repeat 1" [Ar | 0.643 | 0.605 | 0.417 | 9.6e-57 | |
| TAIR|locus:2175458 | 301 | ACR12 "ACT domain repeats 12" | 0.171 | 0.255 | 0.346 | 5.7e-09 | |
| TAIR|locus:2057936 | 410 | ACR10 "ACT domain repeats 10" | 0.763 | 0.836 | 0.208 | 8.4e-09 |
| TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1778 (630.9 bits), Expect = 2.9e-183, P = 2.9e-183
Identities = 350/455 (76%), Positives = 395/455 (86%)
Query: 1 MELSMSYSHDSDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD 60
M++SMS+S D D+EYEKLIRRMNPPRVVIDN++CK ATVIRVDSAN++GILLEVVQ+LTD
Sbjct: 1 MDVSMSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTD 60
Query: 61 LNLIVTKAYISSDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMRSVGVK 120
LNL +TKAYISSDG WFMDVFNVTD+DGNK+TDE +LDYI+K LGPEACF++SMRSVGV
Sbjct: 61 LNLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMRSVGVI 120
Query: 121 QSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAI 180
S D T IELTG DRPGLLSE+SAVLTHLKC+V++AE+WTHNTRAAA+MQVTD+ TG I
Sbjct: 121 PSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGI 180
Query: 181 SDPERLSVIKELLCNVLKGSNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTDDDS 240
SDPERLS IK LL NVLKGSN AKT VS HT+RRLHQMMF DRDYE DDDS
Sbjct: 181 SDPERLSRIKNLLRNVLKGSNTPREAKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDS 240
Query: 241 L--DEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPE 298
DE+QRP+V V N DKDYSVVT+ KDRPKL+FDTVCTLTDMQYVVFH ++D EG E
Sbjct: 241 SIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTE 300
Query: 299 AYQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIF 358
A+QEY++RHIDGSPVKS+AE++RVIQCL+AAI+RRVSEGLKLELCTTDRVGLLSNVTRIF
Sbjct: 301 AFQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIF 360
Query: 359 RENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTILKVKGNPEDL- 417
RENSLTVTRAEV TK GKA+NTFYV ASGY +DAK IDSIRQ+IGQTILKVK NP++
Sbjct: 361 RENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQQ 420
Query: 418 ---KSASQDSPTRFLFGGLFKSRSFVNFGLVRSCS 449
KS S +SPTRFLFGGLFKS+SFVNFGLVRS S
Sbjct: 421 QRQKSPSHESPTRFLFGGLFKSKSFVNFGLVRSYS 455
|
|
| TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145482 AT5G25320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175458 ACR12 "ACT domain repeats 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057936 ACR10 "ACT domain repeats 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_X0513 | hypothetical protein (443 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 449 | |||
| cd04897 | 75 | cd04897, ACT_ACR_3, ACT domain-containing protein | 9e-39 | |
| cd04895 | 72 | cd04895, ACT_ACR_1, ACT domain-containing protein | 8e-34 | |
| cd04925 | 74 | cd04925, ACT_ACR_2, ACT domain-containing protein | 3e-33 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 1e-30 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 2e-19 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 5e-19 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 9e-16 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 1e-14 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 7e-13 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 7e-13 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 9e-12 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 1e-10 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 3e-09 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 7e-09 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 2e-08 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 4e-08 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 2e-07 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 3e-07 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 2e-06 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 3e-06 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 3e-06 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 4e-06 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 4e-06 | |
| PRK01759 | 854 | PRK01759, glnD, PII uridylyl-transferase; Provisio | 4e-06 | |
| cd04900 | 73 | cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU | 6e-06 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 1e-05 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 1e-05 | |
| PRK05007 | 884 | PRK05007, PRK05007, PII uridylyl-transferase; Prov | 3e-05 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 4e-05 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 4e-05 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 7e-05 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 7e-05 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 1e-04 | |
| cd04876 | 71 | cd04876, ACT_RelA-SpoT, ACT domain found C-termina | 1e-04 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 2e-04 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 3e-04 | |
| PRK01759 | 854 | PRK01759, glnD, PII uridylyl-transferase; Provisio | 4e-04 | |
| cd04900 | 73 | cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU | 5e-04 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 6e-04 | |
| cd04900 | 73 | cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU | 0.001 | |
| pfam13740 | 76 | pfam13740, ACT_6, ACT domain | 0.002 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 0.003 | |
| PRK04374 | 869 | PRK04374, PRK04374, PII uridylyl-transferase; Prov | 0.003 | |
| cd04893 | 77 | cd04893, ACT_GcvR_1, ACT domains that comprise the | 0.004 |
| >gnl|CDD|153169 cd04897, ACT_ACR_3, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
Score = 134 bits (339), Expect = 9e-39
Identities = 50/75 (66%), Positives = 63/75 (84%)
Query: 259 YSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEYFIRHIDGSPVKSDAE 318
YSVVT+ +DRPKL+FD VCTLTDM YVVFHA ID +G +A+QEY+IRH DG + ++ E
Sbjct: 1 YSVVTVQCRDRPKLLFDVVCTLTDMDYVVFHATIDTDGDDAHQEYYIRHKDGRTLSTEGE 60
Query: 319 RERVIQCLKAAIERR 333
R+RVI+CL+AAIERR
Sbjct: 61 RQRVIKCLEAAIERR 75
|
This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 75 |
| >gnl|CDD|153167 cd04895, ACT_ACR_1, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153197 cd04925, ACT_ACR_2, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234980 PRK01759, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235329 PRK05007, PRK05007, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234980 PRK01759, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|205914 pfam13740, ACT_6, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|179839 PRK04374, PRK04374, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153165 cd04893, ACT_GcvR_1, ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 449 | |||
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.95 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.95 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.95 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.94 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.94 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.93 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.93 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.92 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.92 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.92 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.92 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.92 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.92 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.92 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.91 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.91 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.91 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.91 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.82 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.74 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.73 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.72 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.71 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.67 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.67 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.61 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.6 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.55 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.54 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.54 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.51 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.51 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.49 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.44 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.34 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.3 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.27 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.27 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.19 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.18 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.17 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.16 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.86 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.78 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 98.76 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.75 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 98.62 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.53 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 98.49 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.4 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.32 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.3 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.3 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.24 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.23 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 97.99 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 97.98 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.98 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 97.89 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.85 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 97.85 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 97.79 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.76 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.75 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.74 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 97.63 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.56 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.56 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.54 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.52 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.49 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.47 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.43 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.37 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.33 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.3 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.3 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.29 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 97.26 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 97.25 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.21 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.18 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 97.11 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.06 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.04 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.94 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.87 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.83 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 96.83 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.81 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.76 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.76 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.75 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 96.71 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 96.64 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.64 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.62 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.58 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.52 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.52 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 96.52 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.47 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.41 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 96.38 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.38 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.37 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.37 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 96.32 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.27 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 96.25 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 96.22 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.14 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.13 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.11 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 96.11 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 96.11 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.09 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.06 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.03 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.02 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 96.0 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.0 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 95.97 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 95.95 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 95.93 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 95.9 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 95.89 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 95.78 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 95.73 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 95.71 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 95.62 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 95.6 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.59 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 95.59 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 95.57 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 95.53 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 95.52 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 95.52 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 95.42 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 95.39 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 95.27 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 95.21 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.09 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 94.97 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 94.86 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 94.55 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 94.55 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 94.44 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 94.0 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 93.87 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 93.86 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 93.76 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 93.75 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 93.7 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 93.37 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 93.35 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 93.2 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 93.16 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 93.11 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 93.04 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 92.97 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 92.96 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 92.76 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 92.59 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 92.56 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 92.55 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 92.38 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 92.36 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 92.35 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 92.15 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 92.12 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 91.79 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 91.17 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 90.84 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 90.66 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 90.59 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 90.08 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 89.95 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 89.63 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 89.49 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 89.41 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 89.31 | |
| PLN02551 | 521 | aspartokinase | 89.04 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 88.96 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 88.77 | |
| PRK09181 | 475 | aspartate kinase; Validated | 88.74 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 88.72 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 88.65 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 88.59 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 88.52 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 88.14 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 88.01 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 87.94 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 87.76 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 87.32 | |
| PLN02317 | 382 | arogenate dehydratase | 87.09 | |
| PRK14630 | 143 | hypothetical protein; Provisional | 87.07 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 86.81 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 86.08 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 86.07 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 85.85 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 85.55 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 85.12 | |
| PRK14646 | 155 | hypothetical protein; Provisional | 84.74 | |
| PRK14634 | 155 | hypothetical protein; Provisional | 84.72 | |
| PLN02551 | 521 | aspartokinase | 84.61 | |
| PRK09181 | 475 | aspartate kinase; Validated | 84.11 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 84.06 | |
| PRK14636 | 176 | hypothetical protein; Provisional | 83.6 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 83.34 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 83.26 | |
| PRK12483 | 521 | threonine dehydratase; Reviewed | 83.05 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 83.03 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 82.85 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 82.62 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 82.6 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 82.07 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 81.58 | |
| PRK11898 | 283 | prephenate dehydratase; Provisional | 81.48 | |
| TIGR01268 | 436 | Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra | 81.33 | |
| PRK14645 | 154 | hypothetical protein; Provisional | 81.3 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 80.97 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 80.62 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 80.48 |
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
Probab=99.95 E-value=6.5e-27 Score=261.00 Aligned_cols=174 Identities=24% Similarity=0.335 Sum_probs=147.5
Q ss_pred hcCCCEEEEecCCCCCeEEEEEEeCCCcchHHHHHHHHHhCCceEEEEEEEe-cCCEEEEEEEEEcCCCCCCCChHHHHH
Q 013090 21 RMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYISS-DGCWFMDVFNVTDEDGNKITDEGILDY 99 (449)
Q Consensus 21 ~~~~p~V~i~~~~~~~~t~V~V~~~Dr~GLl~~i~~vL~~~gl~I~~A~I~t-~~g~~~d~F~V~~~~g~~~~~~~~~~~ 99 (449)
...+|.|.+++++..++|+|+|+++||||||++|+++|+.+|+||++|+|+| .+|+++|+|+|++++|.+++ ++.++.
T Consensus 661 ~~~~~~V~i~~~~~~~~t~V~V~~~DrpGLfa~Ia~~L~~~~L~I~~A~I~T~~~g~alD~F~V~d~~g~~~~-~~~~~~ 739 (854)
T PRK01759 661 FRGDLLVKISNRFSRGGTEIFIYCQDQANLFLKVVSTIGAKKLSIHDAQIITSQDGYVLDSFIVTELNGKLLE-FDRRRQ 739 (854)
T ss_pred cCCCCEEEEEecCCCCeEEEEEEecCCccHHHHHHHHHHHCCCeEEEEEEEEccCCEEEEEEEEeCCCCCCCC-HHHHHH
Confidence 3457899999999999999999999999999999999999999999999987 89999999999999999885 444444
Q ss_pred HHH----Hhccccccc----CC--------cceee--ccCCCceEEEEEEeCCccchHHHHHHHHHhCCCeEEEEEEEcc
Q 013090 100 IRK----CLGPEACFA----SS--------MRSVG--VKQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTH 161 (449)
Q Consensus 100 I~~----~L~~~~~~~----~~--------~~~V~--~~~~~~~t~i~v~~~DrpGLl~~I~~~l~~~g~~I~~A~i~T~ 161 (449)
|++ +|.+..... .+ +.+|. ++.+..+|+|+|.++||||||++|+++|.++|++|+.|+|+|.
T Consensus 740 l~~~L~~aL~~~~~~~~~~~~~~~~~~~~~~~~V~~dn~~s~~~T~iev~a~DrpGLL~~I~~~l~~~~l~i~~AkI~T~ 819 (854)
T PRK01759 740 LEQALTKALNTNKLKKLNLEENHKLQHFHVKTEVRFLNEEKQEQTEMELFALDRAGLLAQVSQVFSELNLNLLNAKITTI 819 (854)
T ss_pred HHHHHHHHHcCCCCcchhccccccccCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCCEEEEEEEccc
Confidence 554 444332110 01 12344 4677899999999999999999999999999999999999999
Q ss_pred CCceEEEEEEeeCCCCCCCCCHHHHHHHHHHhcccc
Q 013090 162 NTRAAALMQVTDEETGGAISDPERLSVIKELLCNVL 197 (449)
Q Consensus 162 ~~~~~dvf~V~~~~~g~~i~~~~~~~~l~~~L~~~L 197 (449)
|++|+|+|||++ .+|.++.++++ +.|+++|..+|
T Consensus 820 gerv~D~Fyv~~-~~g~~l~~~~~-~~l~~~L~~~l 853 (854)
T PRK01759 820 GEKAEDFFILTN-QQGQALDEEER-KALKSRLLSNL 853 (854)
T ss_pred CceEEEEEEEEC-CCCCcCChHHH-HHHHHHHHHHh
Confidence 999999999999 48899987666 99999987765
|
|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02317 arogenate dehydratase | Back alignment and domain information |
|---|
| >PRK14630 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14646 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14634 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK14636 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12483 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >PRK11898 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form | Back alignment and domain information |
|---|
| >PRK14645 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 449 | |||
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 1e-08 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 3e-06 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 4e-05 |
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Length = 192 | Back alignment and structure |
|---|
Score = 53.9 bits (129), Expect = 1e-08
Identities = 20/132 (15%), Positives = 42/132 (31%), Gaps = 1/132 (0%)
Query: 39 VIRVDSANKHGILLEVVQVLTDLNLIVTKAYISSDGCWFMDVFNVTDEDGNKITDEGILD 98
VI ++ GI EVV+++T + + I+ G F + ++ N E L
Sbjct: 8 VITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSPSNITRVETTLP 67
Query: 99 YIRKCLGPEACFASSMRSVGVKQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEV 158
+ + + + + D+ GL + + + + S
Sbjct: 68 LLGQQHD-LITMMKRTSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSA 126
Query: 159 WTHNTRAAALMQ 170
T + Q
Sbjct: 127 QTISKDKLHSEQ 138
|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Length = 192 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Length = 195 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 449 | |||
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.75 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.73 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.69 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.63 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.75 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.72 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.54 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.26 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.11 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 97.91 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 97.9 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 97.74 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 97.73 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.48 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.28 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.27 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.26 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.24 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.17 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.14 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.12 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.1 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.07 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.01 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 96.94 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 96.81 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 96.79 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 96.73 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 96.73 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 96.71 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 96.69 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.47 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.38 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 96.28 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.2 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.15 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 96.11 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 95.89 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 95.82 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 95.78 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 95.3 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 95.12 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 94.72 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 94.65 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 94.37 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 94.34 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 94.17 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 94.1 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 93.74 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 93.46 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 92.87 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 92.48 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 91.77 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 91.64 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 89.94 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 89.66 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 88.45 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 88.27 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 86.76 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 83.74 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 83.36 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 83.06 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 80.08 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 80.01 |
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
Probab=99.75 E-value=5e-18 Score=157.49 Aligned_cols=141 Identities=15% Similarity=0.182 Sum_probs=109.6
Q ss_pred ceeEEEEEcCCCcchHHHHHHHHHhCCceEEEEEEEec-CCeeEEEEEEEecCCCCCCCHHHHHHHHHHHHHHHhh----
Q 013090 258 DYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAE-GPEAYQEYFIRHIDGSPVKSDAERERVIQCLKAAIER---- 332 (449)
Q Consensus 258 ~~tvv~V~~~DrpgLl~~i~~~L~~~gl~I~~A~i~t~-g~~a~d~F~V~~~~g~~l~~~~~~~~l~~~L~~~l~~---- 332 (449)
..++|+|+|+|||||++.++.+|+++|+||.+|++.+. |++++ .|.+... + .....+++.|++.|...+..
T Consensus 4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m-~~~v~~~-~--~~~~~~~~~l~~~L~~~~~~~~~~ 79 (195)
T 2nyi_A 4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAM-IVLVSLN-A--KDGKLIQSALESALPGFQISTRRA 79 (195)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEE-EEEEEES-S--SSSHHHHHHHHHHSTTCEEEEEEC
T ss_pred eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEE-EEEEEec-C--ccchhHHHHHHHHHHHHHHhcCCe
Confidence 34799999999999999999999999999999999988 55666 6777533 2 12223567777777654421
Q ss_pred --------c-cCCceEEEEEeCCCcChHHHHHHHHHhCCCcEEEEEEeecC--CceeeEEEEEcCCCCCCCHHHHHHHHH
Q 013090 333 --------R-VSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATKS--GKAVNTFYVGGASGYPVDAKIIDSIRQ 401 (449)
Q Consensus 333 --------r-~~~~~~l~v~~~DrpGLL~~it~~l~~~~i~I~~a~i~T~g--~~~~d~F~v~~~~g~p~~~~~~~~lr~ 401 (449)
. ....+.|+|.|+|||||+++||++|.++|+||..+++.|.+ ++++++|++....+.|- ... +.|++
T Consensus 80 ~~~~~~~~~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~~~F~m~~~~~~~~-~~~-~~l~~ 157 (195)
T 2nyi_A 80 SSVAERHVSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRMGSRVAFPF-PLY-QEVVT 157 (195)
T ss_dssp CCC----CCTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTCEEEEEEEEEEEEG-GGH-HHHHH
T ss_pred EEEEeCCcCCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCCCeEEEEEEEEcCC-Ccc-HHHHH
Confidence 0 12358999999999999999999999999999999999998 78899999987766552 223 56666
Q ss_pred Hhc
Q 013090 402 SIG 404 (449)
Q Consensus 402 ~l~ 404 (449)
+|.
T Consensus 158 ~l~ 160 (195)
T 2nyi_A 158 ALS 160 (195)
T ss_dssp HHH
T ss_pred HHH
Confidence 554
|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 449 | ||||
| d1u8sa1 | 86 | d.58.18.5 (A:2-87) putative transcriptional repres | 3e-05 | |
| d1y7pa2 | 77 | d.58.18.12 (A:2-78) Hypothetical protein AF1403, N | 2e-04 | |
| d1u8sa2 | 93 | d.58.18.5 (A:88-180) putative transcriptional repr | 4e-04 | |
| d1zpva1 | 83 | d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Strepto | 6e-04 |
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: Glycine cleavage system transcriptional repressor domain: putative transcriptional repressor VC2159 species: Vibrio cholerae [TaxId: 666]
Score = 40.2 bits (94), Expect = 3e-05
Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Query: 122 SM-DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVT 172
S+ H I G+DRPG+ +EV ++T CN++ + + LM ++
Sbjct: 1 SLTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLIS 52
|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 93 | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 449 | |||
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.72 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.58 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 98.42 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.41 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.36 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.87 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.82 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.76 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.66 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.45 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.36 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.34 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.34 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.3 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.28 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.19 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.13 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 96.88 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 96.8 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 96.67 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 96.58 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 96.55 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 96.48 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 96.03 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 92.11 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 92.05 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 83.87 |
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: Glycine cleavage system transcriptional repressor domain: putative transcriptional repressor VC2159 species: Vibrio cholerae [TaxId: 666]
Probab=98.72 E-value=2.3e-08 Score=78.04 Aligned_cols=64 Identities=25% Similarity=0.500 Sum_probs=55.6
Q ss_pred ceEEEEEEeCCccchHHHHHHHHHhCCCeEEEEEEEccCCceEEEEEEeeCCCCCCCCCHHHHHHHHHHhcc
Q 013090 124 DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAISDPERLSVIKELLCN 195 (449)
Q Consensus 124 ~~t~i~v~~~DrpGLl~~I~~~l~~~g~~I~~A~i~T~~~~~~dvf~V~~~~~g~~i~~~~~~~~l~~~L~~ 195 (449)
++++|++.|+||||++++++++|+++||||..++.++.++.....+.|+-+ +...++++..|..
T Consensus 4 ~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~~--------~~~~~~l~~~L~~ 67 (86)
T d1u8sa1 4 QHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGS--------PSNITRVETTLPL 67 (86)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEEC--------HHHHHHHHHHHHH
T ss_pred cEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEcC--------cccHHHHHHHHHH
Confidence 578999999999999999999999999999999999999998888888852 3456777776655
|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|