Citrus Sinensis ID: 013267


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRENSQ
ccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEcccHHHHHHHHHHHHccccEEccEEEEEEEccccccccccccccccccccccEEEEEEccccccccHHHHHHHccccccEEEEEEEcccccEEEEEccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccEEEEEEccccccccHHHHHHHHccccccEEEEEccccccEEEEEcccHHHHHHHHHHHcccEEcccEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHccccEEEEEEEEEcccEEEEEEcccHHHHHHHHHHHccccccccEEEEEEccccccccccc
ccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHHHHHHHHHccccccEcccEEEEEEccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHcccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHcccccccccEEEEEEEcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccHccccHHHHHHHHcccccEEEEEEEEcccccEEEEcccHHHHHHHHHHHccccEcccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEEcccHcccccc
MTEPSKVIHVrnvgheisendllqlfqpfgVITKLVMLRAKNQALLQMQDVPSAINALQFytnvqptirgrnvyvqfsshqelTTMEqnaqgrgdepnrILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSslqgrniydgccqldiqfsnLDELQVNynnersrdftnpnlpaeqkgrpsqsgyseaggmyapgaravafPQMANAAAIAAAfggglppgitgtndrCTVLVSnlnsdridedKLFNLFSLYGNIIRIkllrnkpdhalvQMGDGFQAELAVHFLKGALLFGKRlevnfskhpnitqgadtHEYMNSNLNRfnrnaaknyryccsptkmihlstlpqdvtEEEIVSHLEEhgsivntklfemngKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRENSQ
mtepskvihvrnvgheisendllqLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMeqnaqgrgdEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERsrdftnpnlpaeqkgrpsQSGYSEAGGMYAPGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNlnsdridedKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHAsslggsiirisfsqlqsirensq
MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQManaaaiaaaFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRENSQ
******VIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFS*******************NRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNY**********************************PGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISF***********
*TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNER*RDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAV*************AFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVN*******************NLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRI*************
MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLP*************EAGGMYAPGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQL********
****SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSH***************EPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQ*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRENSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query446 2.2.26 [Sep-21-2011]
Q6ICX4432 Polypyrimidine tract-bind yes no 0.968 1.0 0.848 0.0
Q9Z118523 Polypyrimidine tract-bind yes no 0.970 0.827 0.356 2e-75
Q8BHD7523 Polypyrimidine tract-bind no no 0.970 0.827 0.358 2e-75
P26599531 Polypyrimidine tract-bind yes no 0.964 0.809 0.371 2e-75
Q9UKA9531 Polypyrimidine tract-bind no no 0.961 0.807 0.373 3e-75
Q66H20531 Polypyrimidine tract-bind no no 0.957 0.804 0.369 3e-75
Q91Z31531 Polypyrimidine tract-bind yes no 0.957 0.804 0.369 3e-75
Q29099557 Polypyrimidine tract-bind yes no 0.961 0.770 0.347 1e-74
Q8WN55531 Polypyrimidine tract-bind yes no 0.964 0.809 0.367 2e-74
O95758552 Polypyrimidine tract-bind no no 0.959 0.775 0.349 7e-74
>sp|Q6ICX4|PTBP3_ARATH Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana GN=At1g43190 PE=2 SV=1 Back     alignment and function desciption
 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/441 (84%), Positives = 409/441 (92%), Gaps = 9/441 (2%)

Query: 1   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF 60
           M E SKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA++ALQF
Sbjct: 1   MAESSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF 60

Query: 61  YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV 120
           +TNVQPTIRGRNVYVQFSSHQELTT+EQN  GR DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct: 61  FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV 120

Query: 121 FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL 180
           FSP+GFVEK+VTFQKSAGFQALIQYQ++  A  AR++LQGRNIYDGCCQLDIQFSNL+EL
Sbjct: 121 FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL 180

Query: 181 QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQMANAAAIAAAFG 240
           QVNYNN+RSRD+TNPNLPAEQKGR S   Y + G         VA+PQMAN +AIAAAFG
Sbjct: 181 QVNYNNDRSRDYTNPNLPAEQKGRSSHPCYGDTG---------VAYPQMANTSAIAAAFG 231

Query: 241 GGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGD 300
           GGLPPGITGTNDRCTVLVSNLN+D IDEDKLFNLFSLYGNI+RIKLLRNKPDHALVQMGD
Sbjct: 232 GGLPPGITGTNDRCTVLVSNLNADSIDEDKLFNLFSLYGNIVRIKLLRNKPDHALVQMGD 291

Query: 301 GFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCC 360
           GFQAELAVHFLKGA+LFGKRLEVNFSKHPNIT G D+H+Y+NSNLNRFNRNAAKNYRYCC
Sbjct: 292 GFQAELAVHFLKGAMLFGKRLEVNFSKHPNITPGTDSHDYVNSNLNRFNRNAAKNYRYCC 351

Query: 361 SPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVC 420
           SPTKMIHLSTLPQDVTEEE+++H++EHG++VNTK+FEMNGKKQALV FE EE+A EALVC
Sbjct: 352 SPTKMIHLSTLPQDVTEEEVMNHVQEHGAVVNTKVFEMNGKKQALVQFENEEEAAEALVC 411

Query: 421 KHASSLGGSIIRISFSQLQSI 441
           KHA+SLGGSIIRISFSQLQ+I
Sbjct: 412 KHATSLGGSIIRISFSQLQTI 432




Plays a role in pre-mRNA splicing. Binds to the polypyrimidine tract of introns. May promote the binding of U2 snRNP to pre-mRNA.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9Z118|PTBP3_RAT Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus GN=Ptbp3 PE=2 SV=1 Back     alignment and function description
>sp|Q8BHD7|PTBP3_MOUSE Polypyrimidine tract-binding protein 3 OS=Mus musculus GN=Ptbp3 PE=2 SV=1 Back     alignment and function description
>sp|P26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens GN=PTBP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKA9|PTBP2_HUMAN Polypyrimidine tract-binding protein 2 OS=Homo sapiens GN=PTBP2 PE=1 SV=1 Back     alignment and function description
>sp|Q66H20|PTBP2_RAT Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus GN=Ptbp2 PE=2 SV=1 Back     alignment and function description
>sp|Q91Z31|PTBP2_MOUSE Polypyrimidine tract-binding protein 2 OS=Mus musculus GN=Ptbp2 PE=1 SV=2 Back     alignment and function description
>sp|Q29099|PTBP1_PIG Polypyrimidine tract-binding protein 1 OS=Sus scrofa GN=PTBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WN55|PTBP1_BOVIN Polypyrimidine tract-binding protein 1 OS=Bos taurus GN=PTBP1 PE=2 SV=1 Back     alignment and function description
>sp|O95758|PTBP3_HUMAN Polypyrimidine tract-binding protein 3 OS=Homo sapiens GN=PTBP3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
296081200443 unnamed protein product [Vitis vinifera] 0.988 0.995 0.907 0.0
359493141445 PREDICTED: polypyrimidine tract-binding 0.988 0.991 0.903 0.0
359493143432 PREDICTED: polypyrimidine tract-binding 0.968 1.0 0.893 0.0
209362272445 RBP50 [Cucurbita maxima] 0.988 0.991 0.889 0.0
359480735448 PREDICTED: polypyrimidine tract-binding 0.988 0.984 0.866 0.0
356499519439 PREDICTED: polypyrimidine tract-binding 0.984 1.0 0.886 0.0
356535770443 PREDICTED: polypyrimidine tract-binding 0.986 0.993 0.880 0.0
449503770432 PREDICTED: polypyrimidine tract-binding 0.968 1.0 0.877 0.0
334702289444 polypyrimidine tract-binding protein 6 [ 0.988 0.993 0.840 0.0
255566638437 polypyrimidine tract binding protein, pu 0.975 0.995 0.881 0.0
>gi|296081200|emb|CBI18226.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/443 (90%), Positives = 423/443 (95%), Gaps = 2/443 (0%)

Query: 1   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF 60
           MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA NA+QF
Sbjct: 1   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAANAMQF 60

Query: 61  YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV 120
           YTNVQP+IRGRNVYVQFSSHQELTT++QNAQGRGDEPNRILLVTIHH+LYPITVEVLHQV
Sbjct: 61  YTNVQPSIRGRNVYVQFSSHQELTTVDQNAQGRGDEPNRILLVTIHHLLYPITVEVLHQV 120

Query: 121 FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL 180
           FSPHGFVEKIVTFQKSAGFQALIQYQ R SAV AR+SLQGRNIYDGCCQLDIQFSNLDEL
Sbjct: 121 FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARNSLQGRNIYDGCCQLDIQFSNLDEL 180

Query: 181 QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYA--PGARAVAFPQMANAAAIAAA 238
           QVNYNNERSRDFTNP+LP+EQKGR SQSGY +AGGMYA  PGAR V FPQM NA+AIAAA
Sbjct: 181 QVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDAGGMYALQPGARTVGFPQMPNASAIAAA 240

Query: 239 FGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQM 298
           FGGGLPPGI+GTNDRCTVLVSNLN DRIDEDKLFNLFS+YGNI+RIKLLRNKPDHALVQM
Sbjct: 241 FGGGLPPGISGTNDRCTVLVSNLNPDRIDEDKLFNLFSIYGNIVRIKLLRNKPDHALVQM 300

Query: 299 GDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRY 358
           GDGFQAELAVHFLKGA+LFGKRLEVNFSK+ NIT GADTHEYMNS+LNRFNRNAAKNYRY
Sbjct: 301 GDGFQAELAVHFLKGAMLFGKRLEVNFSKYSNITTGADTHEYMNSSLNRFNRNAAKNYRY 360

Query: 359 CCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEAL 418
           CCSPTKMIH+STL QD+TEEEIVSHLEEHG+IVNTKLFEMNGKKQALV+FE EEQATEAL
Sbjct: 361 CCSPTKMIHVSTLNQDITEEEIVSHLEEHGTIVNTKLFEMNGKKQALVMFENEEQATEAL 420

Query: 419 VCKHASSLGGSIIRISFSQLQSI 441
           VCKHA+ LGG  IRISFSQLQ I
Sbjct: 421 VCKHATPLGGLAIRISFSQLQGI 443




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359493141|ref|XP_002264689.2| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493143|ref|XP_002264763.2| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|209362272|gb|ACI43571.1| RBP50 [Cucurbita maxima] Back     alignment and taxonomy information
>gi|359480735|ref|XP_002277938.2| PREDICTED: polypyrimidine tract-binding protein homolog 3-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356499519|ref|XP_003518587.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356535770|ref|XP_003536416.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449503770|ref|XP_004162168.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|334702289|gb|AEG89704.1| polypyrimidine tract-binding protein 6 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|255566638|ref|XP_002524303.1| polypyrimidine tract binding protein, putative [Ricinus communis] gi|223536394|gb|EEF38043.1| polypyrimidine tract binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
TAIR|locus:2018630432 PTB3 "polypyrimidine tract-bin 0.968 1.0 0.832 2.9e-199
UNIPROTKB|F1S6R7557 PTBP1 "Polypyrimidine tract-bi 0.535 0.429 0.337 2.5e-80
UNIPROTKB|J9P5T5557 PTBP1 "Uncharacterized protein 0.535 0.429 0.337 5.6e-80
UNIPROTKB|F1PCJ7558 PTBP1 "Uncharacterized protein 0.535 0.428 0.337 5.9e-80
UNIPROTKB|P26599531 PTBP1 "Polypyrimidine tract-bi 0.762 0.640 0.384 9.5e-80
UNIPROTKB|Q6P736556 Ptbp1 "Polypyrimidine tract bi 0.535 0.429 0.329 1.1e-79
UNIPROTKB|F1LM18554 Ptbp1 "Polypyrimidine tract-bi 0.524 0.422 0.331 1.4e-79
UNIPROTKB|Q8WN55531 PTBP1 "Polypyrimidine tract-bi 0.762 0.640 0.378 8.4e-79
RGD|62047555 Ptbp1 "polypyrimidine tract bi 0.520 0.418 0.326 1.1e-78
UNIPROTKB|Q29099557 PTBP1 "Polypyrimidine tract-bi 0.535 0.429 0.329 6e-78
TAIR|locus:2018630 PTB3 "polypyrimidine tract-binding protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1929 (684.1 bits), Expect = 2.9e-199, P = 2.9e-199
 Identities = 367/441 (83%), Positives = 401/441 (90%)

Query:     1 MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF 60
             M E SKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA++ALQF
Sbjct:     1 MAESSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF 60

Query:    61 YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV 120
             +TNVQPTIRGRNVYVQFSSHQELTT+EQN  GR DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct:    61 FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV 120

Query:   121 FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL 180
             FSP+GFVEK+VTFQKSAGFQALIQYQ++  A  AR++LQGRNIYDGCCQLDIQFSNL+EL
Sbjct:   121 FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL 180

Query:   181 QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQMXXXXXXXXXFG 240
             QVNYNN+RSRD+TNPNLPAEQKGR S   Y + G         VA+PQM         FG
Sbjct:   181 QVNYNNDRSRDYTNPNLPAEQKGRSSHPCYGDTG---------VAYPQMANTSAIAAAFG 231

Query:   241 GGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGD 300
             GGLPPGITGTNDRCTVLVSNLN+D IDEDKLFNLFSLYGNI+RIKLLRNKPDHALVQMGD
Sbjct:   232 GGLPPGITGTNDRCTVLVSNLNADSIDEDKLFNLFSLYGNIVRIKLLRNKPDHALVQMGD 291

Query:   301 GFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCC 360
             GFQAELAVHFLKGA+LFGKRLEVNFSKHPNIT G D+H+Y+NSNLNRFNRNAAKNYRYCC
Sbjct:   292 GFQAELAVHFLKGAMLFGKRLEVNFSKHPNITPGTDSHDYVNSNLNRFNRNAAKNYRYCC 351

Query:   361 SPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVC 420
             SPTKMIHLSTLPQDVTEEE+++H++EHG++VNTK+FEMNGKKQALV FE EE+A EALVC
Sbjct:   352 SPTKMIHLSTLPQDVTEEEVMNHVQEHGAVVNTKVFEMNGKKQALVQFENEEEAAEALVC 411

Query:   421 KHASSLGGSIIRISFSQLQSI 441
             KHA+SLGGSIIRISFSQLQ+I
Sbjct:   412 KHATSLGGSIIRISFSQLQTI 432




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006397 "mRNA processing" evidence=IEA
GO:0000932 "cytoplasmic mRNA processing body" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006417 "regulation of translation" evidence=IEP
GO:0043484 "regulation of RNA splicing" evidence=IDA
UNIPROTKB|F1S6R7 PTBP1 "Polypyrimidine tract-binding protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P5T5 PTBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCJ7 PTBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P26599 PTBP1 "Polypyrimidine tract-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P736 Ptbp1 "Polypyrimidine tract binding protein 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM18 Ptbp1 "Polypyrimidine tract-binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WN55 PTBP1 "Polypyrimidine tract-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|62047 Ptbp1 "polypyrimidine tract binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q29099 PTBP1 "Polypyrimidine tract-binding protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91Z31PTBP2_MOUSENo assigned EC number0.36950.95730.8041yesno
Q8WN55PTBP1_BOVINNo assigned EC number0.36760.96410.8097yesno
Q9Z118PTBP3_RATNo assigned EC number0.35680.97080.8279yesno
Q6ICX4PTBP3_ARATHNo assigned EC number0.84800.96861.0yesno
P26599PTBP1_HUMANNo assigned EC number0.37180.96410.8097yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00031740001
SubName- Full=Chromosome chr18 scaffold_59, whole genome shotgun sequence; (443 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 1e-118
cd1269288 cd12692, RRM2_PTBPH3, RNA recognition motif 2 in p 9e-54
cd1269876 cd12698, RRM3_PTBPH3, RNA recognition motif 3 in p 7e-47
cd1242679 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in p 4e-46
cd1268775 cd12687, RRM1_PTBPH3, RNA recognition motif 1 in p 4e-44
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 3e-40
cd1269396 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 2e-36
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 6e-32
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 1e-30
cd1269097 cd12690, RRM3_PTBPH1_PTBPH2, RNA recognition motif 4e-30
cd12784103 cd12784, RRM2_ROD1, RNA recognition motif 2 in ver 1e-28
cd12783101 cd12783, RRM2_PTBP2, RNA recognition motif 2 in ve 2e-28
cd12782100 cd12782, RRM2_PTBP1, RNA recognition motif 2 in ve 3e-27
cd1268881 cd12688, RRM1_PTBP1_like, RNA recognition motif 1 1e-24
cd1269486 cd12694, RRM2_hnRNPL_like, RNA recognition motif 2 1e-22
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 2e-22
cd1278696 cd12786, RRM2_hnRPLL, RNA recognition motif 2 in v 5e-20
cd1277781 cd12777, RRM1_PTBP1, RNA recognition motif 1 in ve 4e-19
cd12785100 cd12785, RRM2_hnRNPL, RNA recognition motif 2 in v 1e-18
cd1277990 cd12779, RRM1_ROD1, RNA recognition motif 1 in ver 1e-18
cd1269593 cd12695, RRM3_PTBP1, RNA recognition motif 3 in ve 4e-18
cd1277882 cd12778, RRM1_PTBP2, RNA recognition motif 1 in ve 9e-18
cd12696107 cd12696, RRM3_PTBP2, RNA recognition motif 3 in ve 4e-17
cd1269195 cd12691, RRM2_PTBPH1_PTBPH2, RNA recognition motif 4e-17
cd1269776 cd12697, RRM3_ROD1, RNA recognition motif 3 in ver 1e-16
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-15
cd1268980 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 1e-14
cd1269974 cd12699, RRM3_hnRNPL, RNA recognition motif 3 in v 2e-14
cd1270071 cd12700, RRM3_hnRPLL, RNA recognition motif 3 in v 9e-14
cd1268681 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 3e-12
cd1278080 cd12780, RRM1_hnRNPL, RNA recognition motif 1 in v 5e-12
cd1243676 cd12436, RRM1_2_MATR3_like, RNA recognition motif 3e-11
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-10
smart0036073 smart00360, RRM, RNA recognition motif 6e-10
cd1242576 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 1e-09
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 3e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 6e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 6e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-08
smart0036073 smart00360, RRM, RNA recognition motif 3e-08
cd1278184 cd12781, RRM1_hnRPLL, RNA recognition motif 1 in v 3e-08
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 5e-08
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 5e-08
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-08
smart0036073 smart00360, RRM, RNA recognition motif 1e-07
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 1e-07
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 2e-07
cd1242679 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in p 5e-07
cd1271580 cd12715, RRM2_MATR3, RNA recognition motif 2 in ve 7e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-07
cd1268681 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 9e-07
cd1271476 cd12714, RRM1_MATR3, RNA recognition motif 1 in ve 2e-06
cd1268576 cd12685, RRM_RBM20, RNA recognition motif of verte 2e-06
cd1277990 cd12779, RRM1_ROD1, RNA recognition motif 1 in ver 3e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-06
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 4e-06
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 5e-06
cd1268980 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 7e-06
cd1270381 cd12703, RRM4_ROD1, RNA recognition motif 4 in ver 7e-06
cd1270280 cd12702, RRM4_PTBP2, RNA recognition motif 4 in ve 1e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-05
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 4e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-05
cd1271676 cd12716, RRM1_2_NP220, RNA recognition motif 1 and 7e-05
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 1e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 2e-04
cd1250880 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2e-04
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 2e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-04
cd1270176 cd12701, RRM4_PTBP1, RNA recognition motif 4 in ve 2e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-04
cd1269288 cd12692, RRM2_PTBPH3, RNA recognition motif 2 in p 3e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 3e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 3e-04
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 3e-04
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 3e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 3e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 3e-04
cd1277781 cd12777, RRM1_PTBP1, RNA recognition motif 1 in ve 4e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 4e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 4e-04
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 5e-04
cd1242784 cd12427, RRM4_hnRNPL_like, RNA recognition motif 4 5e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 6e-04
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 6e-04
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 7e-04
cd1242576 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 8e-04
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 8e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 9e-04
cd1243676 cd12436, RRM1_2_MATR3_like, RNA recognition motif 0.001
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.001
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.001
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.001
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 0.001
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 0.001
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 0.001
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 0.002
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 0.002
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.002
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.002
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 0.002
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.002
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.002
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 0.002
cd1268881 cd12688, RRM1_PTBP1_like, RNA recognition motif 1 0.003
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.003
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.003
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 0.003
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 0.003
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 0.003
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.003
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.004
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.004
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.004
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 0.004
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 0.004
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 0.004
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
 Score =  354 bits (910), Expect = e-118
 Identities = 157/478 (32%), Positives = 252/478 (52%), Gaps = 46/478 (9%)

Query: 4   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTN 63
           PS V+HVRN+  ++ E DL++   PFG ++ ++ML  K QAL++ +D  SA   + F T+
Sbjct: 1   PSPVVHVRNLPQDVVEADLVEALIPFGPVSYVMMLPGKRQALVEFEDEESAKACVNFATS 60

Query: 64  VQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSP 123
           V   IRG+  +  +S+ QE+     N+      PN++L V + + +YPIT++VL+Q+F+P
Sbjct: 61  VPIYIRGQPAFFNYSTSQEIKRD-GNSDFDSAGPNKVLRVIVENPMYPITLDVLYQIFNP 119

Query: 124 HGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVN 183
           +G V +IVTF K+  FQAL++++   SA  A+++L G +IY+GCC L I+++    L V 
Sbjct: 120 YGKVLRIVTFTKNNVFQALVEFESVNSAQHAKAALNGADIYNGCCTLKIEYAKPTRLNVK 179

Query: 184 YNNERSRDFTNPNLPAEQ-------------------KGRPSQSGYSEAGGMYAP----- 219
           YN++ SRD+TNP+LP  +                          GYS  GG  AP     
Sbjct: 180 YNDDDSRDYTNPDLPGRRDPGLDQTHRQRQPALLGQHPSSYGHDGYSSHGGPLAPLAGGD 239

Query: 220 -GARAVAFPQMANAAAIAAAFGGGLP-PGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSL 277
                   P     A  AA     +   G  G      ++VS L+ ++++ D+LFNLF +
Sbjct: 240 RMGPPHGPPSRYRPAYEAAPLAPAISSYGPAGGGPGSVLMVSGLHQEKVNCDRLFNLFCV 299

Query: 278 YGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGAD- 336
           YGN+ R+K ++NK + AL++M D +QA+LA+  L G  LFGK L V  SK  N+    + 
Sbjct: 300 YGNVERVKFMKNKKETALIEMADPYQAQLALTHLNGVKLFGKPLRVCPSKQQNVQPPREG 359

Query: 337 --------THEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHG 388
                     +Y +S  +RF +  + N      P+  +HLS +P  V+EE++     E+G
Sbjct: 360 QLDDGLTSYKDYSSSRNHRFKKPGSANKNNIQPPSATLHLSNIPLSVSEEDLKELFAENG 419

Query: 389 --SIVNTKLF--EMNGKKQALVLFETEEQATEALVCKHASSLGGS------IIRISFS 436
              +   K F  +    K  L+ +E+ E A EAL+  +   L          +++SFS
Sbjct: 420 VHKVKKFKFFPKDNERSKMGLLEWESVEDAVEALIALNHHQLNEPNGSAPYHLKVSFS 477


Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067). Length = 481

>gnl|CDD|241136 cd12692, RRM2_PTBPH3, RNA recognition motif 2 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|241142 cd12698, RRM3_PTBPH3, RNA recognition motif 3 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|240872 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|241131 cd12687, RRM1_PTBPH3, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241137 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241134 cd12690, RRM3_PTBPH1_PTBPH2, RNA recognition motif 3 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|241228 cd12784, RRM2_ROD1, RNA recognition motif 2 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|241227 cd12783, RRM2_PTBP2, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|241226 cd12782, RRM2_PTBP1, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|241132 cd12688, RRM1_PTBP1_like, RNA recognition motif 1 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|241138 cd12694, RRM2_hnRNPL_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|241230 cd12786, RRM2_hnRPLL, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein L-like (hnRNP-LL) Back     alignment and domain information
>gnl|CDD|241221 cd12777, RRM1_PTBP1, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|241229 cd12785, RRM2_hnRNPL, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L) Back     alignment and domain information
>gnl|CDD|241223 cd12779, RRM1_ROD1, RNA recognition motif 1 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|241139 cd12695, RRM3_PTBP1, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|241222 cd12778, RRM1_PTBP2, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|241140 cd12696, RRM3_PTBP2, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|241135 cd12691, RRM2_PTBPH1_PTBPH2, RNA recognition motif 2 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|241141 cd12697, RRM3_ROD1, RNA recognition motif 3 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|241143 cd12699, RRM3_hnRNPL, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L) Back     alignment and domain information
>gnl|CDD|241144 cd12700, RRM3_hnRPLL, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein L-like (hnRNP-LL) Back     alignment and domain information
>gnl|CDD|241130 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|241224 cd12780, RRM1_hnRNPL, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L) Back     alignment and domain information
>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the matrin 3 family of nuclear proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240871 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241225 cd12781, RRM1_hnRPLL, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein L-like (hnRNP-LL) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240872 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|241159 cd12715, RRM2_MATR3, RNA recognition motif 2 in vertebrate matrin-3 Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241130 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|241158 cd12714, RRM1_MATR3, RNA recognition motif 1 in vertebrate matrin-3 Back     alignment and domain information
>gnl|CDD|241129 cd12685, RRM_RBM20, RNA recognition motif of vertebrate RNA-binding protein 20 (RBM20) Back     alignment and domain information
>gnl|CDD|241223 cd12779, RRM1_ROD1, RNA recognition motif 1 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|241147 cd12703, RRM4_ROD1, RNA recognition motif 4 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|241146 cd12702, RRM4_PTBP2, RNA recognition motif 4 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241160 cd12716, RRM1_2_NP220, RNA recognition motif 1 and 2 in vertebrate nuclear protein 220 (NP220) Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241145 cd12701, RRM4_PTBP1, RNA recognition motif 4 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241136 cd12692, RRM2_PTBPH3, RNA recognition motif 2 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241221 cd12777, RRM1_PTBP1, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240873 cd12427, RRM4_hnRNPL_like, RNA recognition motif 4 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240871 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the matrin 3 family of nuclear proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|241132 cd12688, RRM1_PTBP1_like, RNA recognition motif 1 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 446
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 100.0
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 100.0
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 100.0
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 100.0
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.97
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.96
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.96
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.95
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.94
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.94
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.94
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.93
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.93
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.91
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.91
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.91
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 99.9
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.87
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.87
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.86
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.86
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.85
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.84
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.8
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.78
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.76
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.73
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.72
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.72
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.69
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.66
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.64
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.64
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 99.64
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.62
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 99.62
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.61
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.58
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.57
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.54
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.52
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.51
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.49
PLN03120 260 nucleic acid binding protein; Provisional 99.48
KOG0122270 consensus Translation initiation factor 3, subunit 99.48
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.47
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.47
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.47
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.46
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.45
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.43
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 99.43
PLN03213 759 repressor of silencing 3; Provisional 99.43
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.43
PLN03120260 nucleic acid binding protein; Provisional 99.42
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.41
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.39
KOG0122270 consensus Translation initiation factor 3, subunit 99.38
KOG4660549 consensus Protein Mei2, essential for commitment t 99.36
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.35
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.35
PLN03121 243 nucleic acid binding protein; Provisional 99.35
smart0036272 RRM_2 RNA recognition motif. 99.34
PLN03121243 nucleic acid binding protein; Provisional 99.34
smart0036272 RRM_2 RNA recognition motif. 99.33
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.32
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.32
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.31
PLN03213 759 repressor of silencing 3; Provisional 99.3
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.28
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.28
smart0036071 RRM RNA recognition motif. 99.28
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.28
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.24
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.24
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 99.22
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.22
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.22
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.21
smart0036071 RRM RNA recognition motif. 99.18
KOG4207 256 consensus Predicted splicing factor, SR protein su 99.17
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.17
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 99.17
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 99.16
KOG4207256 consensus Predicted splicing factor, SR protein su 99.14
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 99.12
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 99.12
smart0036170 RRM_1 RNA recognition motif. 99.1
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.09
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.09
KOG0153377 consensus Predicted RNA-binding protein (RRM super 99.06
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.05
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.0
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.99
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.99
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.98
smart0036170 RRM_1 RNA recognition motif. 98.94
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.91
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.89
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.87
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.84
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.81
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.77
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.76
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.76
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.73
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.68
KOG0226290 consensus RNA-binding proteins [General function p 98.68
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.61
KOG0151 877 consensus Predicted splicing regulator, contains R 98.61
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.59
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.51
KOG4210285 consensus Nuclear localization sequence binding pr 98.51
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.49
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.49
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.48
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.44
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.42
KOG0151 877 consensus Predicted splicing regulator, contains R 98.41
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.41
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.29
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.26
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.25
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.23
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.21
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.13
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.1
KOG4210285 consensus Nuclear localization sequence binding pr 98.06
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.05
KOG0226290 consensus RNA-binding proteins [General function p 98.05
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 98.04
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.87
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 97.8
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.77
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.74
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.68
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 97.58
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.5
KOG1855484 consensus Predicted RNA-binding protein [General f 97.5
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 97.48
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.42
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 97.28
KOG1995 351 consensus Conserved Zn-finger protein [General fun 97.24
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.23
KOG3152 278 consensus TBP-binding protein, activator of basal 97.22
KOG1855 484 consensus Predicted RNA-binding protein [General f 97.19
KOG2314 698 consensus Translation initiation factor 3, subunit 97.17
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.17
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.13
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.13
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.02
KOG3152278 consensus TBP-binding protein, activator of basal 97.02
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 97.0
KOG1995351 consensus Conserved Zn-finger protein [General fun 96.87
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 96.78
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.74
KOG2314 698 consensus Translation initiation factor 3, subunit 96.7
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.68
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.56
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.47
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.39
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.65
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.61
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.6
KOG2591 684 consensus c-Mpl binding protein, contains La domai 95.5
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 95.47
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.4
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.4
KOG2135526 consensus Proteins containing the RNA recognition 95.35
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.3
KOG2591684 consensus c-Mpl binding protein, contains La domai 95.28
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 95.18
KOG2068 327 consensus MOT2 transcription factor [Transcription 94.64
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 94.22
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 94.21
KOG2068327 consensus MOT2 transcription factor [Transcription 94.2
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.1
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 93.84
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 93.37
KOG2135526 consensus Proteins containing the RNA recognition 93.13
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.59
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 92.22
KOG4019193 consensus Calcineurin-mediated signaling pathway i 92.2
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 92.2
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 92.0
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.95
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 91.34
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.14
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 89.68
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 89.39
KOG2318 650 consensus Uncharacterized conserved protein [Funct 89.26
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 88.82
KOG2318 650 consensus Uncharacterized conserved protein [Funct 87.4
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 86.83
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 84.8
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
Probab=100.00  E-value=7.5e-67  Score=513.57  Aligned_cols=434  Identities=34%  Similarity=0.571  Sum_probs=340.8

Q ss_pred             CceEEEEcCCCCCCCHHHHHHhccCccceeEEEEEccCCeEEEEecChhHHHHHHHhhccCCceecCeEeEEEecccccc
Q 013267            4 PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQEL   83 (446)
Q Consensus         4 ~s~~l~v~~lp~~~te~~l~~~f~~~G~i~~~~i~~~~~~afV~F~~~~~A~~A~~~~~~~~~~~~g~~i~v~~~~~~~~   83 (446)
                      ||++|||+|||.++||++|+++|++||+|.+|.+++++++|||+|.+.++|++|++.++..+..++|++|+|+|+.+++.
T Consensus         1 ps~vv~V~nLp~~~te~~L~~~f~~fG~V~~v~i~~~k~~afVef~~~e~A~~Ai~~~~~~~~~l~g~~l~v~~s~~~~~   80 (481)
T TIGR01649         1 PSPVVHVRNLPQDVVEADLVEALIPFGPVSYVMMLPGKRQALVEFEDEESAKACVNFATSVPIYIRGQPAFFNYSTSQEI   80 (481)
T ss_pred             CccEEEEcCCCCCCCHHHHHHHHHhcCCeeEEEEECCCCEEEEEeCchHHHHHHHHHhhcCCceEcCeEEEEEecCCccc
Confidence            79999999999999999999999999999999999999999999999999999999875555689999999999987654


Q ss_pred             cccccCCCCCCCCCCcEEEEEEcCCCCCcCHHHHHHhhcCCCceeEEEEEecCC-ceEEEEEecChhhHHHHHHHhCCCC
Q 013267           84 TTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSA-GFQALIQYQLRPSAVVARSSLQGRN  162 (446)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~v~v~nl~~~~t~~~l~~~f~~~G~i~~i~~~~~~~-g~~afv~f~~~~~A~~a~~~l~~~~  162 (446)
                      ....... ........+++|+|.||+.++|+++|+++|++||.|.+|.++++.. |+ |||+|.+.++|.+|++.|||..
T Consensus        81 ~~~~~~~-~~~~~~~~~~~v~v~nl~~~vt~~~L~~~F~~~G~V~~v~i~~~~~~~~-afVef~~~~~A~~A~~~Lng~~  158 (481)
T TIGR01649        81 KRDGNSD-FDSAGPNKVLRVIVENPMYPITLDVLYQIFNPYGKVLRIVTFTKNNVFQ-ALVEFESVNSAQHAKAALNGAD  158 (481)
T ss_pred             ccCCCCc-ccCCCCCceEEEEEcCCCCCCCHHHHHHHHhccCCEEEEEEEecCCceE-EEEEECCHHHHHHHHHHhcCCc
Confidence            4433111 0112345788899999999999999999999999999999887544 56 9999999999999999999999


Q ss_pred             CCCCCceEEEeeeCCCceeeeeCCCcccCCcCCCCCCCCCCCCC-------CCCCCCCCC----CCCCCC---------C
Q 013267          163 IYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPS-------QSGYSEAGG----MYAPGA---------R  222 (446)
Q Consensus       163 ~~~~~~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~----~~~~~~---------~  222 (446)
                      +++++++|+|.|++...+++.++++++|||+.|.++ +.+....       ++......+    ..+.+.         .
T Consensus       159 i~~~~~~l~v~~sk~~~l~v~~~~~~s~dyt~~~l~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~  237 (481)
T TIGR01649       159 IYNGCCTLKIEYAKPTRLNVKYNDDDSRDYTNPDLP-GRRDPGLDQTHRQRQPALLGQHPSSYGHDGYSSHGGPLAPLAG  237 (481)
T ss_pred             ccCCceEEEEEEecCCCceeEecccCCCCCcCCCCC-CCCCCCcCccccccccccccCCCccCCCcccccCCCCCCcccc
Confidence            999989999999999999999999999999999886 2111110       010000000    000000         0


Q ss_pred             CCCcccchh-hhhhhhccC-CCCC-----CCCccCCCcceEEEeCCCCCCCCHHHHHHHhcccCceEEEEEeeCCCCeEE
Q 013267          223 AVAFPQMAN-AAAIAAAFG-GGLP-----PGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHAL  295 (446)
Q Consensus       223 ~~~~~~~~~-~~~~~~~~~-~~~~-----~~~~~~~~~~~l~v~nl~~~~~~~~~l~~~F~~~G~v~~v~i~~~~~g~af  295 (446)
                      +..+++... ......+.+ ...+     .+....+++++|||+||+++.+++++|+++|+.||.|.+|+++.+++|+||
T Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nL~~~~vt~~~L~~lF~~yG~V~~vki~~~~~g~af  317 (481)
T TIGR01649       238 GDRMGPPHGPPSRYRPAYEAAPLAPAISSYGPAGGGPGSVLMVSGLHQEKVNCDRLFNLFCVYGNVERVKFMKNKKETAL  317 (481)
T ss_pred             cccCCCcccCCCCCcccccccccCccccccCCCCCCCCCEEEEeCCCCCCCCHHHHHHHHHhcCCeEEEEEEeCCCCEEE
Confidence            000000000 000000000 0000     011124577899999999535999999999999999999999998889999


Q ss_pred             EEeCCHHHHHHHHHHhcCCeeCCcEEEEEEecCCCCCCC---------CCccccccCCcccccccccccccccCCCccEE
Q 013267          296 VQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQG---------ADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMI  366 (446)
Q Consensus       296 V~f~~~~~A~~A~~~lng~~~~g~~l~v~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  366 (446)
                      |+|.+.++|..|++.|||..|.|+.|+|.+++.......         ....+|..+...|+..+..+++....+|+++|
T Consensus       318 V~f~~~~~A~~Ai~~lng~~l~g~~l~v~~s~~~~~~~~~~~~~~~~~~~~~d~~~~~~~r~~~~~~~~~~~~~~ps~~L  397 (481)
T TIGR01649       318 IEMADPYQAQLALTHLNGVKLFGKPLRVCPSKQQNVQPPREGQLDDGLTSYKDYSSSRNHRFKKPGSANKNNIQPPSATL  397 (481)
T ss_pred             EEECCHHHHHHHHHHhCCCEECCceEEEEEcccccccCCCCCcCcCCCcccccccCCccccCCCcccccccccCCCCcEE
Confidence            999999999999999999999999999999877654221         11255666666677666555555567889999


Q ss_pred             EEeCCCCCCCHHHHHHHhhccCC--eeEEEEEeeC--CceEEEEEeCCHHHHHHHHHHhCCCccCCCe------EEEEee
Q 013267          367 HLSTLPQDVTEEEIVSHLEEHGS--IVNTKLFEMN--GKKQALVLFETEEQATEALVCKHASSLGGSI------IRISFS  436 (446)
Q Consensus       367 ~v~nlp~~~t~~~l~~~F~~~G~--v~~~~i~~~~--~~g~~fV~f~~~~~A~~A~~~l~~~~~~g~~------l~v~~a  436 (446)
                      ||+|||..+++++|+++|+.||.  |..+++++.+  .+++|||+|.+.++|.+|+..|||..|.|+.      |+|+||
T Consensus       398 ~v~NLp~~~tee~L~~lF~~~G~~~i~~ik~~~~~~~~~~~gfVeF~~~e~A~~Al~~ln~~~l~~~~~~~~~~lkv~fs  477 (481)
T TIGR01649       398 HLSNIPLSVSEEDLKELFAENGVHKVKKFKFFPKDNERSKMGLLEWESVEDAVEALIALNHHQLNEPNGSAPYHLKVSFS  477 (481)
T ss_pred             EEecCCCCCCHHHHHHHHHhcCCccceEEEEecCCCCcceeEEEEcCCHHHHHHHHHHhcCCccCCCCCCccceEEEEec
Confidence            99999999999999999999998  8888887543  2689999999999999999999999999985      999999


Q ss_pred             cCcc
Q 013267          437 QLQS  440 (446)
Q Consensus       437 ~~~~  440 (446)
                      +++.
T Consensus       478 ~~~~  481 (481)
T TIGR01649       478 TSRI  481 (481)
T ss_pred             cCCC
Confidence            9863



Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067).

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4019 consensus Calcineurin-mediated signaling pathway inhibitor DSCR1 [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
2adc_A229 Solution Structure Of Polypyrimidine Tract Binding 6e-31
1qm9_A198 Nmr, Representative Structure Length = 198 1e-29
1sjr_A164 Nmr Structure Of Rrm2 From Human Polypyrimidine Tra 3e-25
2adb_A148 Solution Structure Of Polypyrimidine Tract Binding 4e-25
3zzy_A130 Crystal Structure Of A Raver1 Pri3 Peptide In Compl 6e-25
3to8_A218 Crystal Structure Of The Two C-Terminal Rrm Domains 2e-17
2e5i_A124 Solution Structure Of Rna Binding Domain 2 In Heter 2e-17
3tyt_A205 Crystal Structure Of A Heterogeneous Nuclear Ribonu 3e-17
2ad9_A119 Solution Structure Of Polypyrimidine Tract Binding 6e-17
2ad9_A119 Solution Structure Of Polypyrimidine Tract Binding 3e-05
1sjq_A105 Nmr Structure Of Rrm1 From Human Polypyrimidine Tra 7e-17
1sjq_A105 Nmr Structure Of Rrm1 From Human Polypyrimidine Tra 7e-05
2cq1_A101 Solution Structure Of Rna Binding Domain In Ptb-Lik 2e-15
3s01_A212 Crystal Structure Of A Heterogeneous Nuclear Ribonu 5e-14
3r27_A100 Crystal Structure Of The First Rrm Domain Of Hetero 2e-08
1wex_A104 Solution Structure Of Rrm Domain In Protein Bab2852 5e-07
1x4d_A102 Solution Structure Of Rrm Domain In Matrin 3 Length 8e-04
>pdb|2ADC|A Chain A, Solution Structure Of Polypyrimidine Tract Binding Protein Rbd34 Complexed With Cucucu Rna Length = 229 Back     alignment and structure

Iteration: 1

Score = 131 bits (330), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 76/201 (37%), Positives = 118/201 (58%), Gaps = 9/201 (4%) Query: 245 PGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQA 304 PG+ G + +LVSNLN +R+ LF LF +YG++ R+K+L NK ++ALVQM DG QA Sbjct: 27 PGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQA 85 Query: 305 ELAVHFLKGALLFGKRLEVNFSKHPNIT---QGAD----THEYMNSNLNRFNRNAAKNYR 357 +LA+ L G L GK + + SKH N+ +G + T +Y NS L+RF + +KN++ Sbjct: 86 QLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQ 145 Query: 358 YCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEA 417 P+ +HLS +P V+EE++ +G +V F +K AL+ + E+A +A Sbjct: 146 NIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQA 205 Query: 418 LVCKHASSLG-GSIIRISFSQ 437 L+ H LG +R+SFS+ Sbjct: 206 LIDLHNHDLGENHHLRVSFSK 226
>pdb|1QM9|A Chain A, Nmr, Representative Structure Length = 198 Back     alignment and structure
>pdb|1SJR|A Chain A, Nmr Structure Of Rrm2 From Human Polypyrimidine Tract Binding Protein Isoform 1 (Ptb1) Length = 164 Back     alignment and structure
>pdb|2ADB|A Chain A, Solution Structure Of Polypyrimidine Tract Binding Protein Rbd2 Complexed With Cucucu Rna Length = 148 Back     alignment and structure
>pdb|3ZZY|A Chain A, Crystal Structure Of A Raver1 Pri3 Peptide In Complex With Polypyrimidine Tract Binding Protein Rrm2 Length = 130 Back     alignment and structure
>pdb|3TO8|A Chain A, Crystal Structure Of The Two C-Terminal Rrm Domains Of Heterogeneous Nuclear Ribonucleoprotein L (Hnrnp L) Length = 218 Back     alignment and structure
>pdb|2E5I|A Chain A, Solution Structure Of Rna Binding Domain 2 In Heterogeneous Nuclear Ribonucleoprotein L-Like Length = 124 Back     alignment and structure
>pdb|3TYT|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein L (Hnrpl) From Mus Musculus At 1.60 A Resolution Length = 205 Back     alignment and structure
>pdb|2AD9|A Chain A, Solution Structure Of Polypyrimidine Tract Binding Protein Rbd1 Complexed With Cucucu Rna Length = 119 Back     alignment and structure
>pdb|2AD9|A Chain A, Solution Structure Of Polypyrimidine Tract Binding Protein Rbd1 Complexed With Cucucu Rna Length = 119 Back     alignment and structure
>pdb|1SJQ|A Chain A, Nmr Structure Of Rrm1 From Human Polypyrimidine Tract Binding Protein Isoform 1 (Ptb1) Length = 105 Back     alignment and structure
>pdb|1SJQ|A Chain A, Nmr Structure Of Rrm1 From Human Polypyrimidine Tract Binding Protein Isoform 1 (Ptb1) Length = 105 Back     alignment and structure
>pdb|2CQ1|A Chain A, Solution Structure Of Rna Binding Domain In Ptb-Like Protein L Length = 101 Back     alignment and structure
>pdb|3S01|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein L (Hnrpl) From Mus Musculus At 2.15 A Resolution Length = 212 Back     alignment and structure
>pdb|3R27|A Chain A, Crystal Structure Of The First Rrm Domain Of Heterogeneous Nuclear Ribonucleoprotein L (Hnrnp L) Length = 100 Back     alignment and structure
>pdb|1WEX|A Chain A, Solution Structure Of Rrm Domain In Protein Bab28521 Length = 104 Back     alignment and structure
>pdb|1X4D|A Chain A, Solution Structure Of Rrm Domain In Matrin 3 Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-61
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-19
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-16
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-57
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-16
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 8e-10
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 2e-04
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-48
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-14
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-06
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-42
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 9e-10
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 4e-09
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 4e-07
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 3e-41
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 9e-11
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 6e-10
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 5e-08
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-37
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 3e-11
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 3e-10
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 7e-05
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 6e-34
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-13
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 3e-06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-32
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 6e-12
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 5e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-32
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-14
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-32
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-13
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-09
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 7e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-32
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-16
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-10
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-31
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-09
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 8e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-30
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 9e-14
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-09
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-16
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-13
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 9e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-15
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-14
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-06
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-05
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-14
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 6e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-04
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 9e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-07
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 9e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-08
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-12
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-05
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-06
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-12
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-04
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-05
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 4e-08
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 8e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 6e-11
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-11
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-08
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-05
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-04
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 8e-11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-06
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-10
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-06
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-10
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-10
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 6e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-10
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-10
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-07
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-04
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-10
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 9e-07
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-04
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 7e-10
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-06
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 8e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 8e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-09
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-08
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-05
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 9e-10
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-05
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-09
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-09
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 6e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-09
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-04
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-09
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-09
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 6e-08
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 6e-06
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 9e-04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-09
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-07
1x5p_A97 Negative elongation factor E; structure genomics, 3e-09
1x5p_A97 Negative elongation factor E; structure genomics, 2e-07
1x5p_A97 Negative elongation factor E; structure genomics, 2e-06
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-09
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 9e-08
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 9e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-09
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-04
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 7e-04
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-09
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 5e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-05
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 6e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 6e-05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 6e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-09
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 9e-09
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 9e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-08
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-08
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-08
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-06
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 9e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 4e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 6e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 6e-07
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 4e-08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-04
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-08
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 8e-08
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 6e-04
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 9e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-07
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-05
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 9e-08
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-05
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 9e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 5e-04
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 7e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-07
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-07
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-07
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-07
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-05
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-07
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 4e-07
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-07
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-04
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-07
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 6e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 6e-07
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 7e-07
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 8e-07
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-05
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 9e-07
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-06
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-06
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-04
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 8e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-06
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 7e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-06
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-06
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-06
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-05
2dis_A109 Unnamed protein product; structural genomics, RRM 9e-05
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 3e-06
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 5e-06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-04
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 3e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-05
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 6e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 7e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-05
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-04
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-05
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 3e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 3e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-05
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 4e-05
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-05
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-05
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-05
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 9e-04
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 1e-04
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-04
2div_A99 TRNA selenocysteine associated protein; structural 1e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-04
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-04
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-04
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 6e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-04
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
 Score =  197 bits (502), Expect = 5e-61
 Identities = 77/226 (34%), Positives = 121/226 (53%), Gaps = 9/226 (3%)

Query: 220 GARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYG 279
           G+        +      +  G    PG+ G  +   +LVSNLN +R+    LF LF +YG
Sbjct: 2   GSSHHHHHHSSGLVPRGSHMGRIAIPGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYG 60

Query: 280 NIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGAD--- 336
           ++ R+K+L NK ++ALVQM DG QA+LA+  L G  L GK + +  SKH N+    +   
Sbjct: 61  DVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQE 120

Query: 337 ----THEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVN 392
               T +Y NS L+RF +  +KN++    P+  +HLS +P  V+EE++      +G +V 
Sbjct: 121 DQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVK 180

Query: 393 TKLFEMNGKKQALVLFETEEQATEALVCKHASSLG-GSIIRISFSQ 437
              F    +K AL+   + E+A +AL+  H   LG    +R+SFS+
Sbjct: 181 GFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSK 226


>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 100.0
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.97
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.97
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.97
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.97
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.97
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.97
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.96
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.96
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.96
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.95
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.95
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.95
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.95
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.95
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.95
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.94
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.88
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.86
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.85
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.85
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.84
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.84
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.82
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.82
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.82
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.82
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.82
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.82
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.82
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.81
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.81
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.8
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.8
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.79
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.79
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.78
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.78
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.78
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.77
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.77
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.76
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.76
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.76
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.75
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.75
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.75
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.74
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.74
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.74
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.74
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.74
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.74
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.74
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.74
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.73
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.73
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.73
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.73
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.73
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.73
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.73
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.73
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.73
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.73
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.73
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.72
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.72
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.72
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.72
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.72
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.72
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.72
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.72
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.72
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.72
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.72
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.72
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.72
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.71
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.71
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.71
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.71
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.71
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.71
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.71
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.71
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.71
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.71
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.71
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.71
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.71
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.71
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.71
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.71
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.71
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.71
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.71
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.71
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.71
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.7
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.7
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.7
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.7
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.7
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.7
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.7
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.7
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.7
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.7
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.7
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.7
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.7
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.7
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.7
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.7
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.7
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.7
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.7
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.7
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.69
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.69
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.69
2div_A99 TRNA selenocysteine associated protein; structural 99.69
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.69
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.69
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.69
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.69
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.69
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.69
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.69
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.69
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.68
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.68
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.68
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.68
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.68
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.68
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.68
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.68
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.68
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.68
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.68
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.68
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.68
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.68
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.68
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.68
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.68
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.68
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.68
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.68
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.68
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.68
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.67
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.67
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.67
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.67
1x5p_A97 Negative elongation factor E; structure genomics, 99.67
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.67
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.67
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.67
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.67
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.67
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.67
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.67
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.67
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.67
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.67
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.67
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.67
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.67
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.67
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.67
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.67
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.66
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.66
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.66
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.66
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.66
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.66
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.66
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.66
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.66
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.66
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.66
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.66
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.66
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.66
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.66
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.66
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.66
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.65
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.65
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.65
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.65
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.65
2div_A99 TRNA selenocysteine associated protein; structural 99.65
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.65
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.65
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.65
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.65
2dis_A109 Unnamed protein product; structural genomics, RRM 99.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.65
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.65
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.65
2dis_A109 Unnamed protein product; structural genomics, RRM 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.65
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.65
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.64
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.64
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.64
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.64
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.64
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.64
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.64
1x5p_A97 Negative elongation factor E; structure genomics, 99.64
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.64
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.64
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.64
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.63
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.63
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.63
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.63
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.63
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.63
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.63
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.63
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.63
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.63
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.63
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.63
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.63
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.63
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.63
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.63
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.63
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.63
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.62
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.62
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.62
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.62
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.62
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.62
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.62
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.62
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.62
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.61
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.61
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.61
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.61
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.61
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.61
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.61
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.61
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.61
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.61
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.6
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.6
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.6
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.6
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.6
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.6
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.6
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.6
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.6
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.6
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.6
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.59
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.59
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.59
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.59
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.59
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.59
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.59
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.59
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.59
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.59
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.59
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.58
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.58
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.58
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.58
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.58
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.58
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.58
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.58
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.36
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.58
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.58
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.57
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.57
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.57
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.57
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.56
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.56
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.56
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.56
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.55
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.55
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.55
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.55
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.55
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.55
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.55
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.55
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.31
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.54
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.53
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.53
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.53
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.53
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.52
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.52
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.51
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.51
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.51
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.5
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.49
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.49
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.48
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.47
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.47
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.46
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.46
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.46
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.46
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.43
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.43
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.41
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.4
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.4
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.39
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.38
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.37
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.36
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.29
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.28
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.26
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.2
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.15
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.11
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.05
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.03
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.89
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.7
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.69
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.58
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.16
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.15
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.93
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.78
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.75
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.69
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.45
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.4
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.39
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.27
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.23
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.14
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.56
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.3
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.2
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.2
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.08
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 92.08
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 90.48
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=2.7e-41  Score=312.43  Aligned_cols=236  Identities=20%  Similarity=0.202  Sum_probs=209.0

Q ss_pred             EEEEcCCCCCcCHHHHHHhhcCCCceeEEEEEecCCceEEEEEecChhhHHHHHHHhCCCCCCCCCceEEEeeeCCCcee
Q 013267          102 LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQ  181 (446)
Q Consensus       102 ~v~v~nl~~~~t~~~l~~~f~~~G~i~~i~~~~~~~g~~afv~f~~~~~A~~a~~~l~~~~~~~~~~~l~v~~~~~~~~~  181 (446)
                      +|||+|||.++|+++|+++|+.|| |..+.+ .+++|| |||+|.+.++|..|++.|+|..+.++  +|.+.++..    
T Consensus        24 ~l~V~nLp~~~te~~l~~~F~~~G-i~~~~~-~~~~g~-afV~f~~~~~A~~A~~~l~~~~~~g~--~i~v~~~~~----   94 (284)
T 3smz_A           24 KILIRGLPGDVTNQEVHDLLSDYE-LKYCFV-DKYKGT-AFVTLLNGEQAEAAINAFHQSRLRER--ELSVQLQPT----   94 (284)
T ss_dssp             EEEEECCCTTCCHHHHHHHTTTSC-EEEEEE-ETTTTE-EEEEESSHHHHHHHHHHHTTCEETTE--ECEEEECCC----
T ss_pred             EEEEeCCCCCCCHHHHHHHHHHcC-CEEEEE-ecCCCE-EEEEeCCHHHHHHHHHHcCCCeeCCe--EEEEEecCC----
Confidence            499999999999999999999999 888776 778998 99999999999999999999999876  777776421    


Q ss_pred             eeeCCCcccCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccchhhhhhhhccCCCCCCCCccCCCcceEEEeCC
Q 013267          182 VNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYAPGARAVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNL  261 (446)
Q Consensus       182 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl  261 (446)
                                                                                             .++|||+||
T Consensus        95 -----------------------------------------------------------------------~~~l~v~nl  103 (284)
T 3smz_A           95 -----------------------------------------------------------------------DALLCVANL  103 (284)
T ss_dssp             -----------------------------------------------------------------------SCEEEEESC
T ss_pred             -----------------------------------------------------------------------CCEEEEcCC
Confidence                                                                                   128999999


Q ss_pred             CCCCCCHHHHHHHhcccCceEEEEEeeCC-----CCeEEEEeCCHHHHHHHHHHhcCCeeCCcEEEEEEecCCCCCCCCC
Q 013267          262 NSDRIDEDKLFNLFSLYGNIIRIKLLRNK-----PDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGAD  336 (446)
Q Consensus       262 ~~~~~~~~~l~~~F~~~G~v~~v~i~~~~-----~g~afV~f~~~~~A~~A~~~lng~~~~g~~l~v~~~~~~~~~~~~~  336 (446)
                      |+ .+++++|+++|+.||.|..+.++.+.     +|+|||+|.+.++|..|++.|||..+.|+.|.|.|+.+....    
T Consensus       104 p~-~~t~~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~~i~v~~a~~~~~~----  178 (284)
T 3smz_A          104 PP-SLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLT----  178 (284)
T ss_dssp             CT-TCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCGGGCC----
T ss_pred             CC-cCCHHHHHHHHHhcCCeeEEEEEeeCCCCccceEEEEEECCHHHHHHHHHHhCCCEeCCcEEEEEECCCCCCC----
Confidence            96 79999999999999999999988764     579999999999999999999999999999999998754211    


Q ss_pred             ccccccCCcccccccccccccccCCCccEEEEeCCCCCC-CHHHHHHHhhccCCeeEEEEEeeC---CceEEEEEeCCHH
Q 013267          337 THEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDV-TEEEIVSHLEEHGSIVNTKLFEMN---GKKQALVLFETEE  412 (446)
Q Consensus       337 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~-t~~~l~~~F~~~G~v~~~~i~~~~---~~g~~fV~f~~~~  412 (446)
                                           ....++++|||+|||..+ |+++|+++|+.||.|.++.++.+.   .+|+|||+|.+.+
T Consensus       179 ---------------------~~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~~v~i~~~~~g~~~g~afV~f~~~~  237 (284)
T 3smz_A          179 ---------------------PALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAE  237 (284)
T ss_dssp             ---------------------TTTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCSEEEEEECSSCCEEEEEEEECSSHH
T ss_pred             ---------------------cccCCccEEEEecCCcccCCHHHHHHHhhCCCCeEEEEEEECCCCCcccEEEEEeCCHH
Confidence                                 012346899999999995 999999999999999999998652   2789999999999


Q ss_pred             HHHHHHHHhCCCccCCCeEEEEeecCccccc
Q 013267          413 QATEALVCKHASSLGGSIIRISFSQLQSIRE  443 (446)
Q Consensus       413 ~A~~A~~~l~~~~~~g~~l~v~~a~~~~~~~  443 (446)
                      +|.+|++.|||..++|++|+|+|++++..+.
T Consensus       238 ~A~~A~~~l~g~~~~g~~l~v~~a~~~~~~~  268 (284)
T 3smz_A          238 MAEEAQQQADGLSLGGSHLRVSFCAPGPPGR  268 (284)
T ss_dssp             HHHHHHHHHTTCEETTEECEEEECCSSSCHH
T ss_pred             HHHHHHHHhCCCccCCeEEEEEEecCCCccc
Confidence            9999999999999999999999999987653



>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 446
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 8e-24
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-09
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-16
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 3e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 9e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-15
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 1e-14
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 4e-13
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 8e-12
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 7e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-07
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 9e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 8e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-09
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 9e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-07
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 0.004
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 6e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-06
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 9e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 8e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 0.001
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-06
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-07
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 7e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 9e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-07
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-04
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-07
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-04
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-07
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-06
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-06
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-07
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-06
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-05
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 5e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-05
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 7e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-06
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 0.001
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 8e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-06
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-06
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 8e-06
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-06
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-06
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 6e-06
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-06
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-06
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-05
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-06
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 9e-06
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 8e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 7e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-04
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 3e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 0.003
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-06
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-06
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-06
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-06
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 9e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-06
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 5e-06
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 6e-06
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 4e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 7e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 7e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-05
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-05
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 7e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-04
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 0.002
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 3e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-04
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 5e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.003
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 7e-05
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-04
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 9e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 0.001
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 0.001
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 0.003
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-04
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 0.004
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-04
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 8e-04
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 0.004
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 0.001
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 0.002
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.002
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.002
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.002
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.003
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 0.002
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 0.003
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.003
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 0.003
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Polypyrimidine tract-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 93.2 bits (231), Expect = 8e-24
 Identities = 51/103 (49%), Positives = 72/103 (69%)

Query: 97  PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARS 156
            + +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    SA  A+ 
Sbjct: 4   QSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKL 63

Query: 157 SLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPA 199
           SL G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+
Sbjct: 64  SLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPS 106


>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.95
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.93
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.84
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.83
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.82
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.82
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.82
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.8
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.8
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.8
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.8
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.79
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.79
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.79
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.78
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.77
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.77
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.77
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.77
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.77
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.76
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.76
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.76
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.76
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.76
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.76
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.76
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.76
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.76
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.75
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.75
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.75
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.75
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.75
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.75
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.75
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.74
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.74
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.74
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.74
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.74
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.74
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.74
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.74
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.74
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.74
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.74
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.73
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.73
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.73
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.73
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.73
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.73
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.73
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.72
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.72
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.72
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.72
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.71
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.71
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.71
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.71
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.71
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.71
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.71
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.71
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.71
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.71
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.7
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.7
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.7
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.7
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.69
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.69
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.69
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.69
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.69
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.69
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.68
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.68
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.68
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.68
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.68
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.68
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.68
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.68
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.68
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.68
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.67
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.67
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.67
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.67
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.67
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.67
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.66
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.66
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.66
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.66
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.65
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.65
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.65
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.65
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.65
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.65
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.64
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.64
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.64
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.64
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.64
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.63
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.63
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.62
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.62
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.61
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.61
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.56
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.56
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.55
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.53
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.51
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.5
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.49
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.49
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.48
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.48
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.47
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.42
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.41
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.37
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.37
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.34
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.41
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.82
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.77
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.72
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.64
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.4
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.38
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.3
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.8e-27  Score=201.46  Aligned_cols=166  Identities=13%  Similarity=0.193  Sum_probs=139.5

Q ss_pred             cceEEEeCCCCCCCCHHHHHHHhcccCceEEEEEeeCC-----CCeEEEEeCCHHHHHHHHHHhcCCeeCCcEEEEEEec
Q 013267          253 RCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNK-----PDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSK  327 (446)
Q Consensus       253 ~~~l~v~nl~~~~~~~~~l~~~F~~~G~v~~v~i~~~~-----~g~afV~f~~~~~A~~A~~~lng~~~~g~~l~v~~~~  327 (446)
                      .++|||+|||+ .+++++|+++|++||.|.++.++.+.     +|+|||+|.+.++|..|+. +++..+.++.+.+.+..
T Consensus         6 ~r~lfV~nLp~-~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~   83 (183)
T d1u1qa_           6 LRKLFIGGLSF-ETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAV   83 (183)
T ss_dssp             HHEEEEESCCT-TCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECC
T ss_pred             CCEEEEECCCC-CCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhh
Confidence            35999999996 79999999999999999999988754     6799999999999999998 66777888888887765


Q ss_pred             CCCCCCCCCccccccCCcccccccccccccccCCCccEEEEeCCCCCCCHHHHHHHhhccCCeeEEEEEeeC----CceE
Q 013267          328 HPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMN----GKKQ  403 (446)
Q Consensus       328 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~t~~~l~~~F~~~G~v~~~~i~~~~----~~g~  403 (446)
                      ........                      ....+.++|||+|||..+|+++|+++|+.||.|..+.+..+.    .+|+
T Consensus        84 ~~~~~~~~----------------------~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~  141 (183)
T d1u1qa_          84 SREDSQRP----------------------GAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGF  141 (183)
T ss_dssp             CTTGGGST----------------------TTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEE
T ss_pred             hccccccc----------------------ccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCcccee
Confidence            44211000                      112345799999999999999999999999999999998643    3789


Q ss_pred             EEEEeCCHHHHHHHHHHhCCCccCCCeEEEEeecCccccc
Q 013267          404 ALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRE  443 (446)
Q Consensus       404 ~fV~f~~~~~A~~A~~~l~~~~~~g~~l~v~~a~~~~~~~  443 (446)
                      |||+|.+.++|.+|++ +++..+.|+.|+|.+|.++...+
T Consensus       142 ~fV~f~~~e~A~~Al~-~~~~~~~G~~i~V~~A~~k~e~~  180 (183)
T d1u1qa_         142 AFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRKALSKQEMA  180 (183)
T ss_dssp             EEEEESCHHHHHHHHT-SSCEEETTEEEEEEECCCHHHHH
T ss_pred             EEEEECCHHHHHHHHH-hCCCeECCEEEEEEecCCccccc
Confidence            9999999999999996 78889999999999998875543



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure