Citrus Sinensis ID: 013323


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-----
MRLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLLRGRPGAVRQQ
ccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHcccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcHcHccHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccc
MRLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVyddmmldgvqptrDLFHSLIVGtmkgsrlqdtFFFRDqmkangflpdVAVYNYLISVCGKCKNSDQAIRIFEEMkkyevkpngqtYVCLLNACaaagqldpVYAIVRDMTAAGAGLDKFCYAGLItahtnkipraddtATKIIELVEQskgwssvetsgnnaenemmgvskeelynlptaeyvhrrggFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKkdrkspdvyIVMQNIRCYlhsgdidnghKVFEDyicsekfppaeLYATLVEGAmfgytpkgmqLAQDTLVNMnsrniflsprmgSDLLLVAAGEKSGGYTTANYIWDLMQarkitpslpaVEAYYNglkdrevpaddprlVVVSRAYDnllrgrpgavrqq
MRLLQSIYRhhksvggalgrrFFVTSAGAEEYArrnyannaseyntvvtsltsqRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHtnkipraddTATKIIELveqskgwssveTSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLkkdrkspdVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLkdrevpaddprlVVVSRaydnllrgrpgavrqq
MRLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLLRGRPGAVRQQ
******IYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVE*************************ELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLL**********
MRLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLLRGRPGAVR**
MRLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQ***********NNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLLRG********
*RLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLLRGRPG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLQSIYRHHKSVGGALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDNLLRGRPGAVRQQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query445 2.2.26 [Sep-21-2011]
Q8VYR5444 Pentatricopeptide repeat- yes no 0.979 0.981 0.653 1e-172
Q9FIT7 974 Pentatricopeptide repeat- no no 0.662 0.302 0.225 1e-14
Q9SAK0836 Pentatricopeptide repeat- no no 0.393 0.209 0.305 3e-14
P0C8A0638 Pentatricopeptide repeat- no no 0.4 0.278 0.244 6e-13
Q9ZUU3 757 Pentatricopeptide repeat- no no 0.323 0.190 0.255 1e-11
Q9M1D8473 Pentatricopeptide repeat- no no 0.330 0.310 0.267 1e-11
Q9SH26577 Pentatricopeptide repeat- no no 0.712 0.549 0.227 2e-11
Q940A6838 Pentatricopeptide repeat- no no 0.343 0.182 0.264 2e-11
Q9C8T7 559 Pentatricopeptide repeat- no no 0.737 0.586 0.210 4e-11
Q9FMD3504 Pentatricopeptide repeat- no no 0.685 0.605 0.219 1e-10
>sp|Q8VYR5|PP351_ARATH Pentatricopeptide repeat-containing protein At4g35850, mitochondrial OS=Arabidopsis thaliana GN=At4g35850 PE=1 SV=1 Back     alignment and function desciption
 Score =  605 bits (1561), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 288/441 (65%), Positives = 354/441 (80%), Gaps = 5/441 (1%)

Query: 3   LLQSIYRHHKSVGGAL-GRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLR 61
           L+QSI   ++S+  AL  RR+F +S   EE A+RNYAN+ SEYNT V S+T+QRR +LLR
Sbjct: 4   LMQSISGRNRSLVRALVSRRYFASSP--EEIAKRNYANDLSEYNTAVNSVTAQRRHYLLR 61

Query: 62  DVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVC 121
           DVYDDM LDGVQPT D+FHS +VGTMKG+RL D FFFR++MKA G  PDV +YN+LIS C
Sbjct: 62  DVYDDMKLDGVQPTADIFHSFVVGTMKGARLSDAFFFREEMKAMGIAPDVNLYNFLISTC 121

Query: 122 GKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDK 181
           GKCKN  +AIR+++EMK+Y+VKPNGQT+VCLLNACA +GQLD VYAIVRDMTAAG GL++
Sbjct: 122 GKCKNGKEAIRVYDEMKRYDVKPNGQTFVCLLNACAVSGQLDLVYAIVRDMTAAGVGLNQ 181

Query: 182 FCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLP 241
           FCYAGLITAH NK PR D+ +TKI+E VEQSKGWS++++S  +AE+ M  +S+EELYN+P
Sbjct: 182 FCYAGLITAHLNKQPRPDNLSTKILEFVEQSKGWSAIDSSRKSAEDVMFSISEEELYNIP 241

Query: 242 TAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRC 301
           TA+Y H R  FL R LTVYHVAF A A+LKDV+A E LLEMLKKD K  D Y ++Q +RC
Sbjct: 242 TADYSH-RTRFLQRNLTVYHVAFSALADLKDVKATEALLEMLKKDGKDTDTYCMLQIMRC 300

Query: 302 YLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNI 361
           YLHS D +NG K+F+DY+ ++K P  ELY TL+EGAM GYT  GM++AQDTL+ MN RN 
Sbjct: 301 YLHSQDFENGLKLFQDYMSADKIPAMELYTTLIEGAMTGYTDNGMKIAQDTLIQMNERNF 360

Query: 362 FLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADD 421
           FL PR GS+LLL AAGEK+GGYT AN IWDLM AR I P+L AVEAYY GLK+RE+P DD
Sbjct: 361 FLDPRTGSNLLLKAAGEKTGGYTVANMIWDLMLARNILPTLAAVEAYYKGLKEREIPEDD 420

Query: 422 PRLVVVSRAYDNLLRGRPGAV 442
           PRL++V+R Y+N LR R G +
Sbjct: 421 PRLMLVTRTYNN-LRLREGTL 440





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 Back     alignment and function description
>sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 Back     alignment and function description
>sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUU3|PP190_ARATH Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1D8|PP288_ARATH Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 Back     alignment and function description
>sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 Back     alignment and function description
>sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query445
225452280445 PREDICTED: pentatricopeptide repeat-cont 0.932 0.932 0.762 0.0
255572062510 pentatricopeptide repeat-containing prot 0.955 0.833 0.739 0.0
449446722442 PREDICTED: pentatricopeptide repeat-cont 0.970 0.977 0.680 1e-178
356570223450 PREDICTED: pentatricopeptide repeat-cont 0.970 0.96 0.670 1e-174
356512038450 PREDICTED: pentatricopeptide repeat-cont 0.970 0.96 0.659 1e-172
21593882444 unknown [Arabidopsis thaliana] 0.979 0.981 0.655 1e-171
18419731444 pentatricopeptide repeat-containing prot 0.979 0.981 0.653 1e-170
297802344444 hypothetical protein ARALYDRAFT_912780 [ 0.964 0.966 0.660 1e-170
3805851477 putative protein [Arabidopsis thaliana] 0.966 0.901 0.608 1e-165
357496963444 Pentatricopeptide repeat-containing prot 0.970 0.972 0.629 1e-163
>gi|225452280|ref|XP_002270990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Vitis vinifera] gi|296087577|emb|CBI34833.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/417 (76%), Positives = 367/417 (88%), Gaps = 2/417 (0%)

Query: 17  ALGRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTR 76
           ALGRR+F  +A  EEYA+RNYA+N SEY TVV+SLT+QRR FLLRD YDDMMLDGVQP+R
Sbjct: 19  ALGRRYF--AASTEEYAKRNYASNVSEYTTVVSSLTAQRRHFLLRDAYDDMMLDGVQPSR 76

Query: 77  DLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEE 136
           D+FHSLIVGTMKG+RLQD+FFF DQMK  G +PDVA+YN+L+S CGKCKNSDQAI I EE
Sbjct: 77  DIFHSLIVGTMKGARLQDSFFFIDQMKTMGLVPDVALYNFLVSTCGKCKNSDQAIHILEE 136

Query: 137 MKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIP 196
           MKK EVKP GQTY+CLLNACAA+G+ D VYAIVRDMTAAG GL+KFCYAGLI AH NKIP
Sbjct: 137 MKKNEVKPTGQTYICLLNACAASGRTDRVYAIVRDMTAAGLGLNKFCYAGLIAAHKNKIP 196

Query: 197 RADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRL 256
             DDTA+KIIELVEQSKGWSS+E + + AEN MMGVS+EELYN+PTAEYVHRR GFL+R 
Sbjct: 197 LTDDTASKIIELVEQSKGWSSIEATRDMAENVMMGVSEEELYNIPTAEYVHRRAGFLNRQ 256

Query: 257 LTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFE 316
           LTVYHVA HA A+L++V+AMETLLEMLKK+ K+PDV+++MQ +RCYLHSG+ID G ++FE
Sbjct: 257 LTVYHVALHAFADLRNVEAMETLLEMLKKEGKTPDVFLIMQTMRCYLHSGNIDRGLQIFE 316

Query: 317 DYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNIFLSPRMGSDLLLVAA 376
           +Y+ S K    ELY TLVEGAM GYTPKGM+LAQDTLV MN+R  FLSPRMGS+LLLVA+
Sbjct: 317 EYMNSGKPAMVELYVTLVEGAMVGYTPKGMELAQDTLVKMNARGFFLSPRMGSELLLVAS 376

Query: 377 GEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADDPRLVVVSRAYDN 433
           GEK+GGYTTANYIWDLMQARKITPS PAVEAYYNGL++RE+P DD RLV+VSRAYDN
Sbjct: 377 GEKTGGYTTANYIWDLMQARKITPSFPAVEAYYNGLREREIPEDDARLVLVSRAYDN 433




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255572062|ref|XP_002526972.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533724|gb|EEF35459.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449446722|ref|XP_004141120.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Cucumis sativus] gi|449489492|ref|XP_004158328.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356570223|ref|XP_003553289.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356512038|ref|XP_003524728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|21593882|gb|AAM65849.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18419731|ref|NP_567990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75248494|sp|Q8VYR5.1|PP351_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g35850, mitochondrial; Flags: Precursor gi|17979139|gb|AAL49827.1| unknown protein [Arabidopsis thaliana] gi|20259115|gb|AAM14273.1| unknown protein [Arabidopsis thaliana] gi|332661180|gb|AEE86580.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297802344|ref|XP_002869056.1| hypothetical protein ARALYDRAFT_912780 [Arabidopsis lyrata subsp. lyrata] gi|297314892|gb|EFH45315.1| hypothetical protein ARALYDRAFT_912780 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3805851|emb|CAA21471.1| putative protein [Arabidopsis thaliana] gi|7270537|emb|CAB81494.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357496963|ref|XP_003618770.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355493785|gb|AES74988.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query445
TAIR|locus:2125379444 AT4G35850 "AT4G35850" [Arabido 0.979 0.981 0.653 2.1e-155
TAIR|locus:2174008 974 AT5G61990 "AT5G61990" [Arabido 0.669 0.305 0.227 4.9e-14
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.797 0.387 0.246 9.6e-14
TAIR|locus:2206385836 EMB2217 "embryo defective 2217 0.413 0.220 0.304 1.1e-12
TAIR|locus:2060226624 AT2G32630 "AT2G32630" [Arabido 0.667 0.475 0.231 1.1e-11
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.734 0.566 0.224 1.2e-11
TAIR|locus:2146549727 AT5G28370 [Arabidopsis thalian 0.685 0.419 0.222 3.9e-11
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.640 0.381 0.234 4.1e-11
TAIR|locus:2146554766 AT5G28460 [Arabidopsis thalian 0.685 0.398 0.222 4.2e-11
TAIR|locus:2097395638 AT3G49730 [Arabidopsis thalian 0.4 0.278 0.244 1.1e-10
TAIR|locus:2125379 AT4G35850 "AT4G35850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1515 (538.4 bits), Expect = 2.1e-155, P = 2.1e-155
 Identities = 288/441 (65%), Positives = 354/441 (80%)

Query:     3 LLQSIYRHHKSVGGAL-GRRFFVTSAGAEEYARRNYANNASEYNTVVTSLTSQRRFFLLR 61
             L+QSI   ++S+  AL  RR+F +S   EE A+RNYAN+ SEYNT V S+T+QRR +LLR
Sbjct:     4 LMQSISGRNRSLVRALVSRRYFASSP--EEIAKRNYANDLSEYNTAVNSVTAQRRHYLLR 61

Query:    62 DVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVC 121
             DVYDDM LDGVQPT D+FHS +VGTMKG+RL D FFFR++MKA G  PDV +YN+LIS C
Sbjct:    62 DVYDDMKLDGVQPTADIFHSFVVGTMKGARLSDAFFFREEMKAMGIAPDVNLYNFLISTC 121

Query:   122 GKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDK 181
             GKCKN  +AIR+++EMK+Y+VKPNGQT+VCLLNACA +GQLD VYAIVRDMTAAG GL++
Sbjct:   122 GKCKNGKEAIRVYDEMKRYDVKPNGQTFVCLLNACAVSGQLDLVYAIVRDMTAAGVGLNQ 181

Query:   182 FCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLP 241
             FCYAGLITAH NK PR D+ +TKI+E VEQSKGWS++++S  +AE+ M  +S+EELYN+P
Sbjct:   182 FCYAGLITAHLNKQPRPDNLSTKILEFVEQSKGWSAIDSSRKSAEDVMFSISEEELYNIP 241

Query:   242 TAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRC 301
             TA+Y HR   FL R LTVYHVAF A A+LKDV+A E LLEMLKKD K  D Y ++Q +RC
Sbjct:   242 TADYSHRTR-FLQRNLTVYHVAFSALADLKDVKATEALLEMLKKDGKDTDTYCMLQIMRC 300

Query:   302 YLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGMQLAQDTLVNMNSRNI 361
             YLHS D +NG K+F+DY+ ++K P  ELY TL+EGAM GYT  GM++AQDTL+ MN RN 
Sbjct:   301 YLHSQDFENGLKLFQDYMSADKIPAMELYTTLIEGAMTGYTDNGMKIAQDTLIQMNERNF 360

Query:   362 FLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYYNGLKDREVPADD 421
             FL PR GS+LLL AAGEK+GGYT AN IWDLM AR I P+L AVEAYY GLK+RE+P DD
Sbjct:   361 FLDPRTGSNLLLKAAGEKTGGYTVANMIWDLMLARNILPTLAAVEAYYKGLKEREIPEDD 420

Query:   422 PRLVVVSRAYDNLLRGRPGAV 442
             PRL++V+R Y+NL R R G +
Sbjct:   421 PRLMLVTRTYNNL-RLREGTL 440




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206385 EMB2217 "embryo defective 2217" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060226 AT2G32630 "AT2G32630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146549 AT5G28370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146554 AT5G28460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097395 AT3G49730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYR5PP351_ARATHNo assigned EC number0.65300.97970.9819yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00020628001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (445 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00030047001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (427 aa)
      0.495
GSVIVG00026907001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (232 aa)
       0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-05
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-04
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-04
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.002
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
 Score = 61.3 bits (150), Expect = 2e-12
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 109 PDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACA 157
           PDV  YN LI    K    ++A+++F EMKK  +KPN  TY  L++   
Sbjct: 1   PDVVTYNTLIDGYCKKGKVEEALKLFNEMKKRGIKPNVYTYSILIDGLC 49


This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 445
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.63
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.61
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.56
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.53
PF1304150 PPR_2: PPR repeat family 99.51
PF1304150 PPR_2: PPR repeat family 99.51
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.46
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.46
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.43
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.39
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.39
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.38
PRK14574 822 hmsH outer membrane protein; Provisional 99.37
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.37
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.35
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.26
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.26
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.26
PRK14574 822 hmsH outer membrane protein; Provisional 99.25
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.25
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.21
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.14
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.1
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.09
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.09
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.07
KOG1126638 consensus DNA-binding cell division cycle control 99.06
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.04
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.04
PF1285434 PPR_1: PPR repeat 98.97
KOG2003 840 consensus TPR repeat-containing protein [General f 98.96
PF1285434 PPR_1: PPR repeat 98.95
PRK12370553 invasion protein regulator; Provisional 98.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.94
KOG2076 895 consensus RNA polymerase III transcription factor 98.9
PRK12370553 invasion protein regulator; Provisional 98.88
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.85
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.8
KOG1126638 consensus DNA-binding cell division cycle control 98.78
KOG2003840 consensus TPR repeat-containing protein [General f 98.76
KOG2076 895 consensus RNA polymerase III transcription factor 98.73
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.7
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.62
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.57
KOG1915677 consensus Cell cycle control protein (crooked neck 98.55
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.53
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.52
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.51
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.51
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.47
PRK11189296 lipoprotein NlpI; Provisional 98.47
KOG1129478 consensus TPR repeat-containing protein [General f 98.44
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.43
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.43
KOG1129478 consensus TPR repeat-containing protein [General f 98.42
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.4
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.4
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.38
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.37
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.36
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.36
PRK11189296 lipoprotein NlpI; Provisional 98.35
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.34
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.33
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.29
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.26
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.25
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.23
KOG0547606 consensus Translocase of outer mitochondrial membr 98.22
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.19
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.18
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.17
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.13
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.12
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.09
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.08
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.07
KOG0547606 consensus Translocase of outer mitochondrial membr 98.04
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.03
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.02
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.01
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.99
PLN02789320 farnesyltranstransferase 97.95
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.91
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.9
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.89
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.86
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.83
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.82
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.79
PRK15359144 type III secretion system chaperone protein SscB; 97.79
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.74
PRK15359144 type III secretion system chaperone protein SscB; 97.74
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.71
PRK04841 903 transcriptional regulator MalT; Provisional 97.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.68
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.66
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.64
PRK10370198 formate-dependent nitrite reductase complex subuni 97.63
KOG1128777 consensus Uncharacterized conserved protein, conta 97.61
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.6
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.59
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.58
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.57
PRK04841903 transcriptional regulator MalT; Provisional 97.53
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.52
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.51
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.5
PRK10370198 formate-dependent nitrite reductase complex subuni 97.5
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.5
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.49
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.48
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.46
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.41
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.36
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.33
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.28
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.27
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.19
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.17
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.15
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.15
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.12
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.12
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.09
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.08
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.04
KOG3941406 consensus Intermediate in Toll signal transduction 96.83
PLN02789320 farnesyltranstransferase 96.8
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.78
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.78
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.78
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.77
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.77
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.77
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.75
KOG3941406 consensus Intermediate in Toll signal transduction 96.75
KOG1125579 consensus TPR repeat-containing protein [General f 96.75
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.66
KOG1125579 consensus TPR repeat-containing protein [General f 96.61
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.59
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.52
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.48
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.46
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.45
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.42
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.41
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.37
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.32
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.3
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.28
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 96.27
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.2
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.18
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.12
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.1
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.09
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.04
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.85
PF12688120 TPR_5: Tetratrico peptide repeat 95.84
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.63
PF12688120 TPR_5: Tetratrico peptide repeat 95.61
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.54
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.5
PRK10803263 tol-pal system protein YbgF; Provisional 95.47
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.46
smart00299140 CLH Clathrin heavy chain repeat homology. 95.45
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.4
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.29
KOG4162799 consensus Predicted calmodulin-binding protein [Si 95.19
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.07
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.03
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 94.92
PRK10803263 tol-pal system protein YbgF; Provisional 94.89
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.8
PF1337173 TPR_9: Tetratricopeptide repeat 94.78
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.76
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.76
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.68
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.65
KOG3060289 consensus Uncharacterized conserved protein [Funct 94.36
KOG0553304 consensus TPR repeat-containing protein [General f 94.28
PF1337173 TPR_9: Tetratricopeptide repeat 94.26
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 94.1
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.02
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.01
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 94.01
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.37
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.37
smart00299140 CLH Clathrin heavy chain repeat homology. 93.33
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.32
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.22
PF13929292 mRNA_stabil: mRNA stabilisation 93.19
KOG0553304 consensus TPR repeat-containing protein [General f 93.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.94
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.88
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.78
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.69
COG3629280 DnrI DNA-binding transcriptional activator of the 92.52
COG4700251 Uncharacterized protein conserved in bacteria cont 92.46
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.44
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.43
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.37
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.22
PF13762145 MNE1: Mitochondrial splicing apparatus component 92.17
PRK15331165 chaperone protein SicA; Provisional 92.15
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.02
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 91.99
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.95
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 91.92
COG3629280 DnrI DNA-binding transcriptional activator of the 91.92
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 91.92
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 91.72
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 91.71
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 91.39
KOG4570418 consensus Uncharacterized conserved protein [Funct 91.35
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 90.32
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.23
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.18
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.0
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.84
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.72
COG3898531 Uncharacterized membrane-bound protein [Function u 89.35
KOG20411189 consensus WD40 repeat protein [General function pr 88.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.47
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 88.41
PF13762145 MNE1: Mitochondrial splicing apparatus component 88.18
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.01
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 87.25
PF13512142 TPR_18: Tetratricopeptide repeat 87.14
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.09
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 86.66
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.41
PF13512142 TPR_18: Tetratricopeptide repeat 85.74
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 85.56
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 85.22
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.78
PF13929292 mRNA_stabil: mRNA stabilisation 84.69
KOG4555175 consensus TPR repeat-containing protein [Function 84.23
PRK15331165 chaperone protein SicA; Provisional 83.84
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 83.58
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 83.5
PF1342844 TPR_14: Tetratricopeptide repeat 82.94
PF1342844 TPR_14: Tetratricopeptide repeat 82.78
COG1729262 Uncharacterized protein conserved in bacteria [Fun 82.14
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.94
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 81.69
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.78
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 80.5
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 80.48
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 80.48
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-59  Score=472.24  Aligned_cols=367  Identities=14%  Similarity=0.174  Sum_probs=255.3

Q ss_pred             HHHhcCCCCChhhHHHHHHHHHhcCcHhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcCCChhHHHHHHHHHHHCCCCCC
Q 013323           31 EYARRNYANNASEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPD  110 (445)
Q Consensus        31 ~~~~~~~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~p~  110 (445)
                      ++.+....||..+||.+|.+|++.|+++.|.++|+.|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||
T Consensus       427 ~lf~~M~~pd~~Tyn~LL~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~Pd  506 (1060)
T PLN03218        427 RFAKLIRNPTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEAN  506 (1060)
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCC
Confidence            33444445999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHccCCHHHHHHHHHHHHhCCCCccHHHHHHHHHHHHHcCChhhHHHHHHHHHH--cCCCCCHHHHHHHH
Q 013323          111 VAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTA--AGAGLDKFCYAGLI  188 (445)
Q Consensus       111 ~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~y~~li~~~~~~g~~~~a~~~~~~m~~--~g~~p~~~~~~~li  188 (445)
                      ..+||+||.+|++.|++++|.++|++|.+.|+.||..||+.+|.+|++.|++++|.++|++|..  .|+.||..+|+++|
T Consensus       507 vvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI  586 (1060)
T PLN03218        507 VHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALM  586 (1060)
T ss_pred             HHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999986  67899999999999


Q ss_pred             HHHHccCCCchHHHHHHHHHHHHhcCCccccccccccchhhcccchhhhcchhhhhHHhhhcCcccCchhHHHHHHHHHH
Q 013323          189 TAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACA  268 (445)
Q Consensus       189 ~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~li~~~~  268 (445)
                      .+|++.|+.  +.|.++|+.|.+.+..+................   .+.........|...|+ .||..+|+++|.+|+
T Consensus       587 ~ay~k~G~l--deA~elf~~M~e~gi~p~~~tynsLI~ay~k~G---~~deAl~lf~eM~~~Gv-~PD~~TynsLI~a~~  660 (1060)
T PLN03218        587 KACANAGQV--DRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKG---DWDFALSIYDDMKKKGV-KPDEVFFSALVDVAG  660 (1060)
T ss_pred             HHHHHCCCH--HHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcC---CHHHHHHHHHHHHHcCC-CCCHHHHHHHHHHHH
Confidence            999999977  899999999988643211111000000000000   01111111122333343 455555555555555


Q ss_pred             hcccHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChhhHHHHHHHHHhCCCCCCHHHHHHHHHhHhhcCChhhH-H
Q 013323          269 ELKDVQAMETLLEMLKKDRKSPDVYIVMQNIRCYLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGM-Q  347 (445)
Q Consensus       269 ~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~~~~~g~-~  347 (445)
                      +.|++++|.++|++|.+.|+.||..+|++||.+|++.|++++|.++|++|.+.|+.||..+|++||.    +|++.|. +
T Consensus       661 k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~----gy~k~G~~e  736 (1060)
T PLN03218        661 HAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALIT----ALCEGNQLP  736 (1060)
T ss_pred             hCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHH----HHHHCCCHH
Confidence            5555555555555555555555555555555555555555555555555555555555555555555    4455555 5


Q ss_pred             HHHHHHHHHHhCCCCCCcchhhHHHHHhhcccCCChhhHHHHHHHHHHCCCCCCHHHHHHHH
Q 013323          348 LAQDTLVNMNSRNIFLSPRMGSDLLLVAAGEKSGGYTTANYIWDLMQARKITPSLPAVEAYY  409 (445)
Q Consensus       348 ~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~  409 (445)
                      +|.++|++|.+.|+.||..||+.+|.+|.  +.|++++|.++|++|.+.|+.||..+|++++
T Consensus       737 eAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~--k~G~le~A~~l~~~M~k~Gi~pd~~tynsLI  796 (1060)
T PLN03218        737 KALEVLSEMKRLGLCPNTITYSILLVASE--RKDDADVGLDLLSQAKEDGIKPNLVMCRCIT  796 (1060)
T ss_pred             HHHHHHHHHHHcCCCCCHHHHHHHHHHHH--HCCCHHHHHHHHHHHHHcCCCCCHHHHHHHH
Confidence            55555555555555555555555555544  5555555555555555555555555555554



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-08
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 72.2 bits (176), Expect = 1e-13
 Identities = 77/519 (14%), Positives = 142/519 (27%), Gaps = 140/519 (26%)

Query: 2   RLLQSIYRHHKS-----VGGALGRRF-FVTSAGAEEYARRNYANNASEYNTVVTSLTSQR 55
           RL  ++    +      V   L   + F+ S    E   R  +     Y      L +  
Sbjct: 66  RLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQ--RQPSMMTRMYIEQRDRLYNDN 123

Query: 56  RFFLLRDVY-DDMM------LDGVQPTRDLFHSLIVGTMKGS-------------RLQDT 95
           + F   +V            L  ++P +++    I G + GS             ++Q  
Sbjct: 124 QVFAKYNVSRLQPYLKLRQALLELRPAKNVL---IDG-VLGSGKTWVALDVCLSYKVQCK 179

Query: 96  FFF-------RDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRI---FEEMK------- 138
             F       ++       L  +    Y I        SD +  I      ++       
Sbjct: 180 MDFKIFWLNLKNCNSPETVLEMLQKLLYQID-PNWTSRSDHSSNIKLRIHSIQAELRRLL 238

Query: 139 KYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKF---CYAGLITAHTNKI 195
           K +   N     CLL        L  V     +  A     + F   C   L+T  T   
Sbjct: 239 KSKPYEN-----CLL-------VLLNVQ----NAKA----WNAFNLSCKI-LLT--TRFK 275

Query: 196 PRADD---TATKIIELVEQSKGWSSVETSG---NNAENEMMGVSKEELYNLPTA------ 243
              D      T  I L   S   +  E         +     + +E L   P        
Sbjct: 276 QVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAE 335

Query: 244 ---EYVHRRGGFL----SRLLTV------------YHVAFHACAEL-KDVQAMETLLEML 283
              + +     +      +L T+            Y   F   +           LL ++
Sbjct: 336 SIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLI 395

Query: 284 KKDRKSPDVYIVMQ-------------NIRCYLHSGDIDNG---------HKVF-EDYIC 320
             D    DV +V+                   + S  ++           H+   + Y  
Sbjct: 396 WFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNI 455

Query: 321 SEKFPPAELYATLVEGAMF---GYTPKGMQLAQDTLVNMNSRNIFLSPR-MGSDLLLVAA 376
            + F   +L    ++   +   G+  K ++  +   +    R +FL  R +   +   + 
Sbjct: 456 PKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTL---FRMVFLDFRFLEQKIRHDST 512

Query: 377 GEKSGGYTTANYIWDLMQARK-ITPSLPAVEAYYNGLKD 414
              + G    N +  L   +  I  + P  E   N + D
Sbjct: 513 AWNASGSIL-NTLQQLKFYKPYICDNDPKYERLVNAILD 550


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query445
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.87
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.86
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.85
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.77
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.75
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.74
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.72
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.66
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.66
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.64
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.62
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.61
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.61
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.6
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.6
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.59
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.59
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.58
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.56
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.55
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.53
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.48
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.41
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.41
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.4
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.37
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.35
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.35
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.35
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.34
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.33
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.27
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.27
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.27
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.26
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.25
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.24
3u4t_A272 TPR repeat-containing protein; structural genomics 99.24
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.21
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.2
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.15
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.13
3u4t_A272 TPR repeat-containing protein; structural genomics 99.12
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.12
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.1
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.1
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.1
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.07
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.02
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.02
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.01
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.01
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.99
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.94
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.93
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.92
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.83
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.8
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.77
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.72
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.7
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.7
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.69
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.69
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.68
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.66
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.64
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.61
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.59
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.59
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.42
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.39
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.38
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.33
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.3
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.28
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.27
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.27
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.26
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.25
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.22
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.2
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.18
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.17
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.15
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.14
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.14
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.13
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.13
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.12
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.11
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.1
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.1
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.07
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.06
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.03
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.01
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.99
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.98
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.97
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.95
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.94
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.94
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.92
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.92
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.88
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.88
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.84
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.84
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.82
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.81
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.81
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.8
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.79
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.79
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.79
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.78
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.76
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.75
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.7
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.69
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.68
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.67
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.64
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.64
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.63
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.59
3k9i_A117 BH0479 protein; putative protein binding protein, 97.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.55
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.54
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.52
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.51
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.45
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.42
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.37
3k9i_A117 BH0479 protein; putative protein binding protein, 97.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.36
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.34
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.17
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.14
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.14
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.01
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.88
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.85
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.81
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.8
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.79
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.78
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.67
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.6
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.52
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.52
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.49
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.4
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.21
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.18
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.94
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.88
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.68
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.68
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.49
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 95.43
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 95.43
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.39
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 95.28
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.01
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.97
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.93
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 94.79
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.77
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.02
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.85
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.63
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.44
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.33
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.29
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.45
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 92.04
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.92
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 91.51
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 91.18
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.11
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 90.82
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.75
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.66
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.45
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 87.86
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.73
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.71
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 87.35
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.12
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.66
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 83.91
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.53
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 82.91
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=3.3e-33  Score=266.87  Aligned_cols=202  Identities=13%  Similarity=0.163  Sum_probs=173.6

Q ss_pred             HHHHHhcCCCCCh-hhHHHHHHHHHhcCcHhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcCCC---------hhHHHHH
Q 013323           29 AEEYARRNYANNA-SEYNTVVTSLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSR---------LQDTFFF   98 (445)
Q Consensus        29 ~~~~~~~~~~p~~-~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~---------~~~a~~~   98 (445)
                      ..++.+++..+++ ..++.+|.+|++.|++++|+++|++|.+.|++||..||++||.+|++.+.         ++.|.++
T Consensus        13 ~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~l   92 (501)
T 4g26_A           13 SRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDI   92 (501)
T ss_dssp             -----------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHH
T ss_pred             HHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHH
Confidence            3455566665554 35888999999999999999999999999999999999999999987654         6789999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhCCCCccHHHHHHHHHHHHHcCChhhHHHHHHHHHHcCCC
Q 013323           99 RDQMKANGFLPDVAVYNYLISVCGKCKNSDQAIRIFEEMKKYEVKPNGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAG  178 (445)
Q Consensus        99 ~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~y~~li~~~~~~g~~~~a~~~~~~m~~~g~~  178 (445)
                      |++|.+.|+.||..|||+||++|++.|++++|.++|++|.+.|+.||..||+++|.+|++.|++++|.++|++|.+.|+.
T Consensus        93 f~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~  172 (501)
T 4g26_A           93 FKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVV  172 (501)
T ss_dssp             HHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHccCCCchHHHHHHHHHHHHhcCCccccccccccchhhcccchhhhcchhhhhHHhhhcCcccCchh
Q 013323          179 LDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSGNNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLT  258 (445)
Q Consensus       179 p~~~~~~~li~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~  258 (445)
                      ||..||+++|.+|++.|+.  +.|.++++.|...+.                                       .|+..
T Consensus       173 Pd~~ty~~Li~~~~~~g~~--d~A~~ll~~Mr~~g~---------------------------------------~ps~~  211 (501)
T 4g26_A          173 PEEPELAALLKVSMDTKNA--DKVYKTLQRLRDLVR---------------------------------------QVSKS  211 (501)
T ss_dssp             CCHHHHHHHHHHHHHTTCH--HHHHHHHHHHHHHTS---------------------------------------SBCHH
T ss_pred             CCHHHHHHHHHHHhhCCCH--HHHHHHHHHHHHhCC---------------------------------------CcCHH
Confidence            9999999999999999976  889999999887642                                       78889


Q ss_pred             HHHHHHHHHHhcc
Q 013323          259 VYHVAFHACAELK  271 (445)
Q Consensus       259 ~~~~li~~~~~~g  271 (445)
                      ||+.++..|+..+
T Consensus       212 T~~~l~~~F~s~~  224 (501)
T 4g26_A          212 TFDMIEEWFKSEV  224 (501)
T ss_dssp             HHHHHHHHHHSHH
T ss_pred             HHHHHHHHHhcCc
Confidence            9999999888754



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query445
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.69
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.52
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.23
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.82
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.69
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.63
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.5
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.43
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.43
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.13
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.11
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.92
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.91
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.82
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.72
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.68
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.6
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.57
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.56
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.52
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.5
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.29
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.84
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.77
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.72
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.69
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.61
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.51
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.43
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.24
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.2
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.15
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.14
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.0
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.91
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.85
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.7
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.5
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.29
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.05
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.74
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 93.44
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.78
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.71
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.12
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 90.37
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 90.1
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.21
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 87.56
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 80.72
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=2.1e-13  Score=124.01  Aligned_cols=309  Identities=12%  Similarity=-0.010  Sum_probs=196.9

Q ss_pred             HHHhcCcHhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcCCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHH
Q 013323           50 SLTSQRRFFLLRDVYDDMMLDGVQPTRDLFHSLIVGTMKGSRLQDTFFFRDQMKANGFLPDVAVYNYLISVCGKCKNSDQ  129 (445)
Q Consensus        50 ~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~  129 (445)
                      .+.+.|++++|.+.|+++.+.. +-+...+..+-..+.+.|++++|...|+...+.. +-+..+|..+..+|.+.|++++
T Consensus         8 ~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           8 REYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccccc
Confidence            4456677777777776665542 1235556666666666777777777777666543 1235566666667777777777


Q ss_pred             HHHHHHHHHhCCCC------------------------------------------------------------------
Q 013323          130 AIRIFEEMKKYEVK------------------------------------------------------------------  143 (445)
Q Consensus       130 a~~~~~~m~~~g~~------------------------------------------------------------------  143 (445)
                      |...+.........                                                                  
T Consensus        86 A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (388)
T d1w3ba_          86 AIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ  165 (388)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC
Confidence            76666655432211                                                                  


Q ss_pred             c-cHHHHHHHHHHHHHcCChhhHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCCCchHHHHHHHHHHHHhcCCccccccc
Q 013323          144 P-NGQTYVCLLNACAAAGQLDPVYAIVRDMTAAGAGLDKFCYAGLITAHTNKIPRADDTATKIIELVEQSKGWSSVETSG  222 (445)
Q Consensus       144 p-~~~~y~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  222 (445)
                      | +...+..+...+...|++++|...++...+.. +-+...+..+-..+...|+.  +.|...++......         
T Consensus       166 ~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~--~~A~~~~~~~~~~~---------  233 (388)
T d1w3ba_         166 PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIF--DRAVAAYLRALSLS---------  233 (388)
T ss_dssp             TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCT--THHHHHHHHHHHHC---------
T ss_pred             cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccH--HHHHHHHHHhHHHh---------
Confidence            1 22334444455555566666666666555432 11344555555555555554  55555555544321         


Q ss_pred             cccchhhcccchhhhcchhhhhHHhhhcCcccCchhHHHHHHHHHHhcccHHHHHHHHHHHHhCCCCC-CHHHHHHHHHH
Q 013323          223 NNAENEMMGVSKEELYNLPTAEYVHRRGGFLSRLLTVYHVAFHACAELKDVQAMETLLEMLKKDRKSP-DVYIVMQNIRC  301 (445)
Q Consensus       223 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p-~~~~~~~li~~  301 (445)
                                                     +.+...+..+-..+.+.|++++|...++...+.  .| +..++..+...
T Consensus       234 -------------------------------~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~  280 (388)
T d1w3ba_         234 -------------------------------PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANA  280 (388)
T ss_dssp             -------------------------------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHH
T ss_pred             -------------------------------hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHH
Confidence                                           345556777788888889999999999887763  34 45678888888


Q ss_pred             HHhcCChhhHHHHHHHHHhCCCCCCHHHHHHHHHhHhhcCChhhH-HHHHHHHHHHHhCCCCCC-cchhhHHHHHhhccc
Q 013323          302 YLHSGDIDNGHKVFEDYICSEKFPPAELYATLVEGAMFGYTPKGM-QLAQDTLVNMNSRNIFLS-PRMGSDLLLVAAGEK  379 (445)
Q Consensus       302 ~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~~~~~g~-~~a~~~~~~m~~~~~~p~-~~~~~~ll~~~~~~~  379 (445)
                      +...|++++|.+.|+..... .+.+...+..+..    .+...|. ++|.+.|++..+..  |+ +.++..+-..+.  +
T Consensus       281 ~~~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~----~~~~~~~~~~A~~~~~~al~~~--p~~~~~~~~la~~~~--~  351 (388)
T d1w3ba_         281 LKEKGSVAEAEDCYNTALRL-CPTHADSLNNLAN----IKREQGNIEEAVRLYRKALEVF--PEFAAAHSNLASVLQ--Q  351 (388)
T ss_dssp             HHHHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHH----HHHTTTCHHHHHHHHHHHTTSC--TTCHHHHHHHHHHHH--T
T ss_pred             HHHcCCHHHHHHHHHhhhcc-CCccchhhhHHHH----HHHHCCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHH--H
Confidence            99999999999999887765 2345566666655    4566777 88999998887643  44 334555555555  8


Q ss_pred             CCChhhHHHHHHHHHHCCCCCC-HHHHHHHHhhhhccC
Q 013323          380 SGGYTTANYIWDLMQARKITPS-LPAVEAYYNGLKDRE  416 (445)
Q Consensus       380 ~g~~~~A~~~~~~m~~~~~~p~-~~~~~~l~~~~~~~~  416 (445)
                      .|++++|...|++..+  +.|+ ...|..+...+.+.|
T Consensus       352 ~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         352 QGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             TTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTC
T ss_pred             cCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcC
Confidence            9999999999988775  4464 556777777776655



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure