Citrus Sinensis ID: 013364

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIILIDFG

cccEEEEEccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccEEEEEEEEccccEEEEEEEcccccHHcHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccHHHHHHccccccccccccHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHHcc

cccEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEEccHHcEEEEEEEHHHHcHHHHHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccEccccccHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccEcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHccc

MLEQLLIFTRGGLILWTCKELgnalkgspidTLIRSCLLEersglasfnydsagaaYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFseiydpkrtdysdFDEMFRQLRKEAEARAEELKKSKqvtkpmnnlkkqggqlqkggfergsnrsgggsanddgdsdnmrgrklenghsnvgnveieesrvtgvangkentssnigafdvSKLQKLRnkggkktdtvvskgsnpdpkkkitkknrvwddsppeskldftdpaggngsnieveaadhgesmmdkeevfssdseseedeevgkhnkpdakktgwfSSMFQSIAgkanldkaDLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNgvgkstnlAKVKLIILIDFG

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSeiydpkrtdySDFDEMFRQLRKEAEARAEElkkskqvtkpmnnlkkqggqlqkggfergsnrsgggsanddgdsdnMRGRKLenghsnvgnveieESRVTgvangkentssnigafdvsklqklrnkggkktdtvvskgsnpdpkkkitkknrvwddsppeskldftdpaggngSNIEVEaadhgesmMDKEEVFssdseseedeevgkhnkpdakktgwFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAaslegkklaSFTRISSIVQAAMEEALVRILTPRRSIDILRDVhaakeqrkpyVVVFVGvngvgkstnlakvkliilidfg

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQlrkeaearaeelkkSKQVTKPMNNlkkqggqlqkggfergsnrsgggsanddgdsdnMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKeevfssdseseedeevGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYvvvfvgvngvgKSTNLAKVKLIILIDFG

***QLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYD***********************************************************************************************************************************************************************************************************************WFSSMFQSIA*************LKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIILIDF*

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQ***************************************************************************************************************************************************************************************************************SIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLE*******TRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIILIDFG

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFER**************DSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQK***********************KITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGE***************************DAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIILIDFG

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEEL******************************************************************************************************************************************************************************************TGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIILIDFG

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		444	2.2.26 [Sep-21-2011]
Q9DBG7		636	Signal recognition partic	yes	no	0.925	0.646	0.325	2e-55
Q9U5L1		614	Signal recognition partic	yes	no	0.909	0.657	0.343	9e-53
Q3MHE8		639	Signal recognition partic	yes	no	0.923	0.641	0.316	3e-50
P06625		638	Signal recognition partic	yes	no	0.907	0.631	0.318	2e-49
P08240		638	Signal recognition partic	yes	no	0.930	0.647	0.321	8e-49
Q54ZR7		615	Signal recognition partic	yes	no	0.279	0.201	0.528	1e-29
P32916		621	Signal recognition partic	yes	no	0.486	0.347	0.315	1e-20
O43032		547	Signal recognition partic	yes	no	0.261	0.212	0.457	2e-20
P27414		369	Signal recognition partic	yes	no	0.283	0.341	0.305	2e-11
Q57739		409	Signal recognition partic	yes	no	0.227	0.246	0.372	2e-07

>sp\|Q9DBG7\|SRPR_MOUSE Signal recognition particle receptor subunit alpha OS=Mus musculus GN=Srpr PE=1 SV=1	Back alignment and function desciption

 Score =  217 bits (552), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 153/470 (32%), Positives = 242/470 (51%), Gaps = 59/470 (12%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           ML+   IF++GGL+LW  + + ++  G P++ LIRS LL+ER G  SF ++    A TLK
Sbjct: 1   MLDFFTIFSKGGLVLWCFQGVSDSCTG-PVNALIRSVLLQERGGNNSFTHE----ALTLK 55

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYS---------DFDE 111
           +   N+  LVFV  +Q+IL L YVD L+  + + F + Y  +    S         DF  
Sbjct: 56  YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQN 115

Query: 112 MFRQLRKEAEARAE--------ELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGS 163
            F +L +EAE  ++        + + S++  KP+ ++ +  G+  K   E+  N      
Sbjct: 116 DFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKTK---EKAKN------ 166

Query: 164 ANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNK 223
                  +  RG K E     +   +   +  +G++ G EN   +       K ++   K
Sbjct: 167 -------NKKRGAKKEGSDGTLATSKTAPAEKSGLSAGPENGELSKEELIRRKREEFIQK 219

Query: 224 GGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESK--LDFTDPAGGNGS---------N 272
            GK  D       +  PK+K  K  RVW+     +K  LD++ P   NG+         N
Sbjct: 220 HGKGLDKSSKSTKSDTPKEKGKKAPRVWELGGCANKEVLDYSTPTT-NGTPEAALSEDIN 278

Query: 273 IEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKK--TGWFSSMFQSIAGKANL 330
           + +     G  + D       D  S +DE   ++ KP A K   G    M + + G  +L
Sbjct: 279 L-IRGTGPGGQLQD------LDCSSSDDEGATQNTKPSATKGTLGGMFGMLKGLVGSKSL 331

Query: 331 DKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEAL 390
            + D+E  L  ++D L+ KNVA +IA +LCESVA  LEGK + +F+ ++S V+ A++E+L
Sbjct: 332 SREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESL 391

Query: 391 VRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIIL 440
           V+IL P+R +D+LRD+  A+ +++PYVV F GVNGVGKSTNLAK+   +L
Sbjct: 392 VQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLL 441

Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
Mus musculus (taxid: 10090)

>sp\|Q9U5L1\|SRPR_DROME Signal recognition particle receptor subunit alpha homolog OS=Drosophila melanogaster GN=Gtp-bp PE=1 SV=2	Back alignment and function description

>sp\|Q3MHE8\|SRPR_BOVIN Signal recognition particle receptor subunit alpha OS=Bos taurus GN=SRPR PE=2 SV=1	Back alignment and function description

>sp\|P06625\|SRPR_CANFA Signal recognition particle receptor subunit alpha OS=Canis familiaris GN=SRPR PE=2 SV=2	Back alignment and function description

>sp\|P08240\|SRPR_HUMAN Signal recognition particle receptor subunit alpha OS=Homo sapiens GN=SRPR PE=1 SV=2	Back alignment and function description

>sp\|Q54ZR7\|SRPR_DICDI Signal recognition particle receptor subunit alpha OS=Dictyostelium discoideum GN=srpr PE=3 SV=1	Back alignment and function description

>sp\|P32916\|SRPR_YEAST Signal recognition particle receptor subunit alpha homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP101 PE=1 SV=2	Back alignment and function description

>sp\|O43032\|SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp101 PE=3 SV=1	Back alignment and function description

>sp\|P27414\|FTSY_SULAC Signal recognition particle receptor FtsY OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ftsY PE=3 SV=1	Back alignment and function description

>sp\|Q57739\|FTSY_METJA Signal recognition particle receptor FtsY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ftsY PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		444
449453958		617	PREDICTED: signal recognition particle r	0.979	0.705	0.807	0.0
224091775		624	predicted protein [Populus trichocarpa]	0.984	0.700	0.784	1e-179
255577019		618	signal recognition particle receptor alp	0.977	0.702	0.803	1e-176
225445848		616	PREDICTED: signal recognition particle r	0.977	0.704	0.795	1e-176
297798906		633	signal recognition particle receptor alp	0.972	0.682	0.746	1e-167
15234792		634	signal recognition particle receptor sub	0.972	0.681	0.742	1e-165
356517002		623	PREDICTED: signal recognition particle r	0.977	0.696	0.716	1e-158
357480047		631	Signal recognition particle receptor sub	0.945	0.665	0.691	1e-146
356562565		626	PREDICTED: signal recognition particle r	0.972	0.690	0.666	1e-142
414864259		516	TPA: hypothetical protein ZEAMMB73_08856	0.963	0.829	0.635	1e-140

>gi\|449453958\|ref\|XP_004144723.1\| PREDICTED: signal recognition particle receptor subunit alpha homolog [Cucumis sativus]	Back alignment and taxonomy information

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/441 (80%), Positives = 387/441 (87%), Gaps = 6/441 (1%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           MLEQLLIFTRGGLILWTCKELGNAL+GSPIDTLIRSCLLEERSG AS+NYD+ GAAYTLK
Sbjct: 1   MLEQLLIFTRGGLILWTCKELGNALRGSPIDTLIRSCLLEERSGAASYNYDAPGAAYTLK 60

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEA 120
           WTFHNELGLVFVAVYQRILHLLYVDDLLAM+KQ FSEIYDPKR  Y DFDE FRQLR EA
Sbjct: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMVKQGFSEIYDPKRMVYDDFDETFRQLRMEA 120

Query: 121 EARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLEN 180
           EAR  ELKK+KQV KP+NN +KQG Q QK GF  G N+       DDGD++  +G KLEN
Sbjct: 121 EARTNELKKTKQVGKPLNNARKQG-QDQKTGF--GENKKSNSGLADDGDAERTKGHKLEN 177

Query: 181 GHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDP 240
           G+SN GN  + ES++T V NGKENTSSN+GAFDV+KLQKLR+KGGKKTD V +KGS  +P
Sbjct: 178 GYSN-GN-HVIESKLTAVVNGKENTSSNVGAFDVNKLQKLRSKGGKKTDPVANKGSKEEP 235

Query: 241 KKKITKKNRVWDDSPPESKLDFTDPAGGNG-SNIEVEAADHGESMMDKEEVFSSDSESEE 299
           KKK+TKKNRVWD+ P E+KLDFTDP G NG +NI+V AAD G+SMMDKEEVFSSDSE EE
Sbjct: 236 KKKVTKKNRVWDEKPTEAKLDFTDPVGENGDNNIDVLAADQGQSMMDKEEVFSSDSEDEE 295

Query: 300 DEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKL 359
           DEE  K +KPDAKK GWFSSMFQSI+GKA+LDKADLEPALKALKDRLMTKNVAEEIAEKL
Sbjct: 296 DEEGDKGSKPDAKKKGWFSSMFQSISGKASLDKADLEPALKALKDRLMTKNVAEEIAEKL 355

Query: 360 CESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVV 419
           CESVAASLEGKKLASFTRISS VQAAMEEALVRILTPRRSIDILRDVHAAKEQ+KPYVVV
Sbjct: 356 CESVAASLEGKKLASFTRISSTVQAAMEEALVRILTPRRSIDILRDVHAAKEQKKPYVVV 415

Query: 420 FVGVNGVGKSTNLAKVKLIIL 440
           FVGVNGVGKSTNLAKV   +L
Sbjct: 416 FVGVNGVGKSTNLAKVAYWLL 436

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224091775\|ref\|XP_002309350.1\| predicted protein [Populus trichocarpa] gi\|222855326\|gb\|EEE92873.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255577019\|ref\|XP_002529394.1\| signal recognition particle receptor alpha subunit, putative [Ricinus communis] gi\|223531142\|gb\|EEF32990.1\| signal recognition particle receptor alpha subunit, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225445848\|ref\|XP_002278056.1\| PREDICTED: signal recognition particle receptor subunit alpha [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297798906\|ref\|XP_002867337.1\| signal recognition particle receptor alpha subunit family protein [Arabidopsis lyrata subsp. lyrata] gi\|297313173\|gb\|EFH43596.1\| signal recognition particle receptor alpha subunit family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|15234792|ref|NP_194789.1| signal recognition particle receptor subunit alpha [Arabidopsis thaliana] gi|7269961|emb|CAB79778.1| signal recognition particle receptor-like protein [Arabidopsis thaliana] gi|18086492|gb|AAL57699.1| AT4g30600/F17I23_60 [Arabidopsis thaliana] gi|22137194|gb|AAM91442.1| AT4g30600/F17I23_60 [Arabidopsis thaliana] gi|332660385|gb|AEE85785.1| signal recognition particle receptor subunit alpha [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356517002\|ref\|XP_003527179.1\| PREDICTED: signal recognition particle receptor subunit alpha-like [Glycine max]	Back alignment and taxonomy information

>gi\|357480047\|ref\|XP_003610309.1\| Signal recognition particle receptor subunit alpha [Medicago truncatula] gi\|355511364\|gb\|AES92506.1\| Signal recognition particle receptor subunit alpha [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356562565\|ref\|XP_003549540.1\| PREDICTED: signal recognition particle receptor subunit alpha-like [Glycine max]	Back alignment and taxonomy information

>gi\|414864259\|tpg\|DAA42816.1\| TPA: hypothetical protein ZEAMMB73_088569 [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		444
TAIR\|locus:2118701		634	AT4G30600 [Arabidopsis thalian	0.975	0.682	0.628	7.9e-133
DICTYBASE\|DDB_G0277377		615	srpR "signal recognition parti	0.547	0.395	0.313	4.5e-49
FB\|FBgn0010391		614	Gtp-bp "GTP-binding protein" [	0.513	0.371	0.376	1.2e-46
UNIPROTKB\|F1NXV4		644	SRPR "Uncharacterized protein"	0.592	0.408	0.327	1.6e-45
MGI\|MGI:1914648		636	Srpr "signal recognition parti	0.596	0.416	0.313	2.7e-43
RGD\|1311504		636	Srpr "signal recognition parti	0.596	0.416	0.310	2.1e-42
UNIPROTKB\|F1MNJ2		598	SRPR "Signal recognition parti	0.594	0.441	0.303	3.1e-41
UNIPROTKB\|Q3MHE8		639	SRPR "Signal recognition parti	0.594	0.413	0.303	4.4e-41
UNIPROTKB\|F1S754		638	SRPR "Uncharacterized protein"	0.594	0.413	0.288	2e-40
UNIPROTKB\|P08240		638	SRPR "Signal recognition parti	0.592	0.412	0.294	4.3e-40

TAIR\|locus:2118701 AT4G30600 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1302 (463.4 bits), Expect = 7.9e-133, P = 7.9e-133
 Identities = 283/450 (62%), Positives = 319/450 (70%)

Query:     1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
             MLEQLLIFTRGGLILWTCKE+GNALKGSPIDTLIRSCLLEERSG  SFNYD+ GAAYTLK
Sbjct:     1 MLEQLLIFTRGGLILWTCKEIGNALKGSPIDTLIRSCLLEERSGAVSFNYDAPGAAYTLK 60

Query:    61 WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQXXXXX 120
             WTFHN+LGLVFVAVYQRILHLLYVDDLL+M+KQSFSE+YDPKR  Y DFDE FRQ     
Sbjct:    61 WTFHNDLGLVFVAVYQRILHLLYVDDLLSMVKQSFSEVYDPKRMAYDDFDETFRQLRIEA 120

Query:   121 XXXXXXXXXSKQVTKPMNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRGR--KL 178
                      +KQV KP+ +                                  + +   L
Sbjct:   121 EARAEELRKTKQVGKPVTSVKKQGQVSKPGLEGGNKRVSSEGGSKKDDGDGGNKAKVSTL 180

Query:   179 ENGHSNVGNVEIEE-SRVTG-VANGKENTSSNIGAFDVSKLQKLRNKG--GK----KTDT 230
              NGHSN GN ++E+ S+ T  +ANGKENTSSN+ A D+SKLQKLR+KG  G+    KTD+
Sbjct:   181 TNGHSN-GNHQMEDDSQETNDLANGKENTSSNV-AVDLSKLQKLRSKGVRGRGGVRKTDS 238

Query:   231 VVSKGSN-PDPKKKITKKNRVWDDSPP-ESKLDFTDPAGGNGSN--IEVEAADHGESMMD 286
             + +K S   +P KK TKKNRVWDD+ P +SKLDFTD    NG+N  +++ AAD GESMMD
Sbjct:   239 IGNKSSKVAEPAKKATKKNRVWDDAAPKQSKLDFTDSIDENGNNDHVDIVAADQGESMMD 298

Query:   287 KXXXXXXXXXXXXXXXXGKHNKP-DAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDR 345
             K                G   KP  AKK GWFSS+FQSI GKANL++ DL PALKALK+R
Sbjct:   299 KEEVFSSDSESEDDDEPGSDEKPAQAKKKGWFSSVFQSITGKANLERTDLGPALKALKER 358

Query:   346 LMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRD 405
             LMTKNVAEEIAEKLCESV ASLEGKKL+SFTRISS VQAAME+ALVRILTPRRSIDILRD
Sbjct:   359 LMTKNVAEEIAEKLCESVEASLEGKKLSSFTRISSTVQAAMEDALVRILTPRRSIDILRD 418

Query:   406 VHAAKEQRKPYXXXXXXXXXXXKSTNLAKV 435
             VHAAKEQRKPY           KSTNLAKV
Sbjct:   419 VHAAKEQRKPYVVVFVGVNGVGKSTNLAKV 448

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003924 "GTPase activity" evidence=IEA

GO:0005047 "signal recognition particle binding" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA;ISS

GO:0005622 "intracellular" evidence=IEA

GO:0005786 "signal recognition particle, endoplasmic reticulum targeting" evidence=ISS

GO:0006184 "GTP catabolic process" evidence=IEA

GO:0006605 "protein targeting" evidence=ISS

GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA

GO:0006886 "intracellular protein transport" evidence=IEA

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0005783 "endoplasmic reticulum" evidence=IDA

GO:0006623 "protein targeting to vacuole" evidence=RCA

GO:0006944 "cellular membrane fusion" evidence=RCA

GO:0016192 "vesicle-mediated transport" evidence=RCA

GO:0048193 "Golgi vesicle transport" evidence=RCA

DICTYBASE\|DDB_G0277377 srpR "signal recognition particle receptor alpha subunit" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

FB\|FBgn0010391 Gtp-bp "GTP-binding protein" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NXV4 SRPR "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1914648 Srpr "signal recognition particle receptor ('docking protein')" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1311504 Srpr "signal recognition particle receptor ('docking protein')" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MNJ2 SRPR "Signal recognition particle receptor subunit alpha" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3MHE8 SRPR "Signal recognition particle receptor subunit alpha" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S754 SRPR "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|P08240 SRPR "Signal recognition particle receptor subunit alpha" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		444
pfam04086		272	pfam04086, SRP-alpha_N, Signal recognition particl	2e-53
PRK14974		336	PRK14974, PRK14974, cell division protein FtsY; Pr	2e-19
COG0552		340	COG0552, FtsY, Signal recognition particle GTPase	7e-18
PRK10416		318	PRK10416, PRK10416, signal recognition particle-do	5e-10
TIGR00064		272	TIGR00064, ftsY, signal recognition particle-docki	2e-09
smart00963		77	smart00963, SRP54_N, SRP54-type protein, helical b	1e-06
smart00962		197	smart00962, SRP54, SRP54-type protein, GTPase doma	1e-04
TIGR03499		283	TIGR03499, FlhF, flagellar biosynthetic protein Fl	5e-04
pfam02881		77	pfam02881, SRP54_N, SRP54-type protein, helical bu	5e-04
COG0541		451	COG0541, Ffh, Signal recognition particle GTPase [	0.001
cd03115		173	cd03115, SRP, The signal recognition particle (SRP	0.003

>gnl\|CDD\|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal	Back alignment and domain information

 Score =  179 bits (456), Expect = 2e-53
 Identities = 76/289 (26%), Positives = 106/289 (36%), Gaps = 32/289 (11%)

Query: 27  GSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDD 86
            SP+++LIR   LEERSG  SF  DS    YTLKW   NE GLVFV VYQ+ILHL Y+D 
Sbjct: 1   TSPVNSLIRDVFLEERSGNPSFKKDS----YTLKWKLDNEFGLVFVVVYQKILHLSYIDK 56

Query: 87  LLAMMKQSFSEIYDPKRTDYS-------DFDEMFRQLRKEAEARAEELKKSKQVTKPMNN 139
           LL  ++  F ++Y  +            +FDE F Q  +E E  +++  KS +  +    
Sbjct: 57  LLDDVRTIFRDLYKNQLRQEKARTTYDEEFDEYFDQQLRELEKESKKQAKSPKAMRTFEE 116

Query: 140 LKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVA 199
            KK      K   +    R               +        S              + 
Sbjct: 117 SKK-----SKKTVDSMIERKPKEPGLKRKQRKKAQESATSPESSPSSTPNSSRPSTPHLL 171

Query: 200 NGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPE-- 257
             KE  S         K  KL +      +      + P   KK  KK R WD    E  
Sbjct: 172 KAKEGPS-----RRAKKAAKLSSTASSGDEKSPKSKAAP---KKAGKKMRKWDLDGDEDD 223

Query: 258 -SKLDFTDPA-----GGNGSNIEVEAADHGESMMDKEEVFSSDSESEED 300
            + LD++ P           ++E    +       K +    D   E  
Sbjct: 224 DAVLDYSAPDANDENADAPEDVEEVDQESWGRGTMKGDFVLLDLGDEVH 272

SRP is a complex of six distinct polypeptides and a 7S RNA that is essential for transferring nascent polypeptide chains that are destined for export from the cell to the translocation apparatus of the endoplasmic reticulum (ER) membrane. SRP binds hydrophobic signal sequences as they emerge from the ribosome, and arrests translation. Length = 272

>gnl\|CDD\|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional	Back alignment and domain information

>gnl\|CDD\|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|236686 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>gnl\|CDD\|232804 TIGR00064, ftsY, signal recognition particle-docking protein FtsY	Back alignment and domain information

>gnl\|CDD\|214941 smart00963, SRP54_N, SRP54-type protein, helical bundle domain	Back alignment and domain information

>gnl\|CDD\|214940 smart00962, SRP54, SRP54-type protein, GTPase domain	Back alignment and domain information

>gnl\|CDD\|234232 TIGR03499, FlhF, flagellar biosynthetic protein FlhF	Back alignment and domain information

>gnl\|CDD\|217266 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain	Back alignment and domain information

>gnl\|CDD\|223615 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|239389 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		444
KOG0781		587	consensus Signal recognition particle receptor, al	100.0
PF04086		279	SRP-alpha_N: Signal recognition particle, alpha su	100.0
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	99.83
PRK14974		336	cell division protein FtsY; Provisional	99.75
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	99.73
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	99.73
PRK10867		433	signal recognition particle protein; Provisional	99.7
TIGR00959		428	ffh signal recognition particle protein. This mode	99.68
PRK00771		437	signal recognition particle protein Srp54; Provisi	99.67
KOG0780		483	consensus Signal recognition particle, subunit Srp	99.65
PRK10416		318	signal recognition particle-docking protein FtsY;	99.59
TIGR00064		272	ftsY signal recognition particle-docking protein F	99.46
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	99.34
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	99.34
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	99.29
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	99.25
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	99.19
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	99.16
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	99.12
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	98.98
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	98.9
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	98.87
PRK12337		475	2-phosphoglycerate kinase; Provisional	98.82
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	98.61
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	98.55
PRK04220		301	2-phosphoglycerate kinase; Provisional	98.42
PF02881		75	SRP54_N: SRP54-type protein, helical bundle domain	98.4
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	98.19
PF09201		148	SRX: SRX; InterPro: IPR015284 The signal recogniti	97.54
COG2074		299	2-phosphoglycerate kinase [Carbohydrate transport	97.14
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	96.98
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	96.87
COG4586		325	ABC-type uncharacterized transport system, ATPase	96.67
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	96.23
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	96.23
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	96.22
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	96.16
PLN02796		347	D-glycerate 3-kinase	96.12
COG4240		300	Predicted kinase [General function prediction only	96.05
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	96.02
PF13555		62	AAA_29: P-loop containing region of AAA domain	96.01
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	96.01
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	95.87
PRK10865		857	protein disaggregation chaperone; Provisional	95.86
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	95.86
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	95.86
PRK09435		332	membrane ATPase/protein kinase; Provisional	95.85
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	95.82
PRK13536		340	nodulation factor exporter subunit NodI; Provision	95.74
PLN03210		1153	Resistant to P. syringae 6; Provisional	95.72
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	95.7
PRK13537		306	nodulation ABC transporter NodI; Provisional	95.7
PRK06526		254	transposase; Provisional	95.65
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	95.64
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	95.6
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	95.56
PRK05439		311	pantothenate kinase; Provisional	95.54
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	95.54
CHL00095		821	clpC Clp protease ATP binding subunit	95.47
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	95.44
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	95.4
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	95.4
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	95.36
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	95.34
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	95.32
PLN02200		234	adenylate kinase family protein	95.29
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	95.27
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	95.22
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	95.2
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	95.16
PF13245		76	AAA_19: Part of AAA domain	95.14
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	95.14
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	95.11
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	95.03
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	95.03
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	94.98
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	94.97
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	94.95
cd03234		226	ABCG_White The White subfamily represents ABC tran	94.92
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	94.9
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	94.9
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	94.9
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	94.89
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	94.88
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	94.87
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	94.87
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	94.85
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	94.84
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	94.83
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	94.81
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	94.81
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	94.77
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	94.77
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	94.74
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	94.73
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	94.73
CHL00181		287	cbbX CbbX; Provisional	94.68
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	94.68
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	94.68
PRK13546		264	teichoic acids export protein ATP-binding subunit;	94.67
PLN02165		334	adenylate isopentenyltransferase	94.66
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	94.64
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	94.64
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	94.63
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	94.62
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	94.61
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	94.59
PRK13764		602	ATPase; Provisional	94.54
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	94.54
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	94.54
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	94.52
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	94.51
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	94.48
cd03216		163	ABC_Carb_Monos_I This family represents the domain	94.47
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	94.45
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	94.44
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	94.4
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	94.39
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	94.39
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	94.35
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	94.35
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	94.3
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	94.29
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	94.28
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	94.25
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	94.24
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	94.23
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	94.23
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	94.21
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	94.2
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	94.2
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	94.2
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	94.19
COG1072		283	CoaA Panthothenate kinase [Coenzyme metabolism]	94.16
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	94.16
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	94.15
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	94.13
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	94.13
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	94.12
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	94.12
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	94.1
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	94.1
PRK04195		482	replication factor C large subunit; Provisional	94.08
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	94.07
PRK15064		530	ABC transporter ATP-binding protein; Provisional	94.06
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	94.06
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	94.06
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	94.05
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	94.04
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	94.03
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	94.02
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	94.0
KOG0066		807	consensus eIF2-interacting protein ABC50 (ABC supe	93.99
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	93.98
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	93.98
PRK09183		259	transposase/IS protein; Provisional	93.97
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	93.95
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	93.94
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	93.94
KOG2878		282	consensus Predicted kinase [General function predi	93.92
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	93.91
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	93.9
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	93.9
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	93.88
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	93.88
PLN03046		460	D-glycerate 3-kinase; Provisional	93.87
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	93.85
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	93.85
PLN02318		656	phosphoribulokinase/uridine kinase	93.85
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	93.84
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	93.84
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	93.82
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	93.81
PRK13409		590	putative ATPase RIL; Provisional	93.81
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	93.8
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	93.78
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	93.75
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	93.75
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	93.74
PRK10938		490	putative molybdenum transport ATP-binding protein	93.73
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	93.72
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	93.72
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	93.68
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	93.68
PRK12402		337	replication factor C small subunit 2; Reviewed	93.67
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	93.66
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	93.64
KOG0859		217	consensus Synaptobrevin/VAMP-like protein [Intrace	93.62
PRK06921		266	hypothetical protein; Provisional	93.61
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	93.6
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	93.58
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	93.57
PRK15455		644	PrkA family serine protein kinase; Provisional	93.56
PRK10436		462	hypothetical protein; Provisional	93.55
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	93.54
PRK13851		344	type IV secretion system protein VirB11; Provision	93.54
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	93.54
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	93.52
TIGR02533		486	type_II_gspE general secretory pathway protein E.	93.51
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	93.51
PRK10261		623	glutathione transporter ATP-binding protein; Provi	93.51
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	93.49
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	93.47
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	93.44
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	93.44
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	93.43
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	93.42
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	93.42
PRK11147		635	ABC transporter ATPase component; Reviewed	93.35
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	93.3
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	93.28
PLN03073		718	ABC transporter F family; Provisional	93.28
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	93.24
PRK00098		298	GTPase RsgA; Reviewed	93.2
COG3910		233	Predicted ATPase [General function prediction only	93.18
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	93.18
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	93.16
PRK13833		323	conjugal transfer protein TrbB; Provisional	93.16
PRK06851		367	hypothetical protein; Provisional	93.16
COG5008		375	PilU Tfp pilus assembly protein, ATPase PilU [Cell	93.14
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	93.13
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	93.1
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	93.0
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	92.97
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	92.96
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	92.94
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	92.94
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	92.88
COG0488		530	Uup ATPase components of ABC transporters with dup	92.81
PLN03025		319	replication factor C subunit; Provisional	92.79
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	92.7
PRK13342		413	recombination factor protein RarA; Reviewed	92.7
PRK12377		248	putative replication protein; Provisional	92.7
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	92.65
PLN03073		718	ABC transporter F family; Provisional	92.64
PRK07952		244	DNA replication protein DnaC; Validated	92.62
TIGR03018		207	pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t	92.59
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	92.5
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	92.49
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	92.47
cd02033		329	BchX Chlorophyllide reductase converts chlorophyll	92.46
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	92.42
PRK00411		394	cdc6 cell division control protein 6; Reviewed	92.35
PRK00440		319	rfc replication factor C small subunit; Reviewed	92.34
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	92.3
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	92.3
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	92.26
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	92.22
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	92.22
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	92.18
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	92.16
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	92.16
PF05272		198	VirE: Virulence-associated protein E; InterPro: IP	92.09
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	92.08
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	92.04
PRK08903		227	DnaA regulatory inactivator Hda; Validated	92.01
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	92.0
TIGR03238		504	dnd_assoc_3 dnd system-associated protein 3. cereu	91.91
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	91.89
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	91.86
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	91.86
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	91.86
PRK06835		329	DNA replication protein DnaC; Validated	91.82
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	91.8
PRK10261		623	glutathione transporter ATP-binding protein; Provi	91.71
PLN02674		244	adenylate kinase	91.7
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	91.61
PRK08099		399	bifunctional DNA-binding transcriptional repressor	91.58
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	91.56
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	91.54
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	91.46
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	91.44
COG1484		254	DnaC DNA replication protein [DNA replication, rec	91.42
PLN02348		395	phosphoribulokinase	91.41
PRK13409		590	putative ATPase RIL; Provisional	91.34
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	91.33
COG1084		346	Predicted GTPase [General function prediction only	91.33
PTZ00202		550	tuzin; Provisional	91.31
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	91.24
PTZ00035		337	Rad51 protein; Provisional	91.24
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	91.16
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	91.11
PRK08181		269	transposase; Validated	91.11
PRK10522		547	multidrug transporter membrane component/ATP-bindi	91.04
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	91.04
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	91.01
KOG0927		614	consensus Predicted transporter (ABC superfamily)	90.93
PHA02544		316	44 clamp loader, small subunit; Provisional	90.89
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	90.85
PRK08084		235	DNA replication initiation factor; Provisional	90.85
TIGR02236		310	recomb_radA DNA repair and recombination protein R	90.83
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	90.79
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	90.71
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	90.69
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	90.62
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	90.62
PRK06893		229	DNA replication initiation factor; Validated	90.61
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	90.61
COG4181		228	Predicted ABC-type transport system involved in ly	90.59
TIGR01526		325	nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr	90.53
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	90.45
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	90.44
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	90.38
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	90.37
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	90.34
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	90.31
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	90.31
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	90.24
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	90.24
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	90.23
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	90.19
PRK13477		512	bifunctional pantoate ligase/cytidylate kinase; Pr	90.16
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	90.15
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	90.12
PRK13341		725	recombination factor protein RarA/unknown domain f	90.11
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	90.02
PLN03140		1470	ABC transporter G family member; Provisional	90.01
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	89.99
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	89.99
PLN03211		659	ABC transporter G-25; Provisional	89.99
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	89.94
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	89.84
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	89.83
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	89.82
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	89.79
PRK08939		306	primosomal protein DnaI; Reviewed	89.69
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	89.68
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	89.67
PRK09112		351	DNA polymerase III subunit delta'; Validated	89.64
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	89.63
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	89.63
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	89.59
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	89.52
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	89.49
PRK03992		389	proteasome-activating nucleotidase; Provisional	89.36
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	89.34
COG4674		249	Uncharacterized ABC-type transport system, ATPase	89.33
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	89.27
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	89.21
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	89.18
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	89.17
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	89.13
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	89.08
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	89.08
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	88.92
PRK08727		233	hypothetical protein; Validated	88.9
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	88.84
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	88.79
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	88.76
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	88.54
TIGR00376		637	DNA helicase, putative. The gene product may repre	88.52
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	88.5
TIGR00665		434	DnaB replicative DNA helicase. This model describe	88.49
CHL00195		489	ycf46 Ycf46; Provisional	88.4
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	88.32
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	88.3
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	88.27
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	88.16
PRK01889		356	GTPase RsgA; Reviewed	88.13
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	88.08
TIGR00767		415	rho transcription termination factor Rho. Members	88.08
PRK08116		268	hypothetical protein; Validated	88.07
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	88.07
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	88.04
CHL00095		821	clpC Clp protease ATP binding subunit	88.02
PLN02772		398	guanylate kinase	87.92
PRK07196		434	fliI flagellum-specific ATP synthase; Validated	87.88
PRK12289		352	GTPase RsgA; Reviewed	87.87
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	87.87
COG1341		398	Predicted GTPase or GTP-binding protein [General f	87.85
COG4987		573	CydC ABC-type transport system involved in cytochr	87.79
PRK10535		648	macrolide transporter ATP-binding /permease protei	87.7
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	87.66
PRK12288		347	GTPase RsgA; Reviewed	87.64
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	87.59
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	87.5
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	87.39
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	87.37
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	87.35
PRK05642		234	DNA replication initiation factor; Validated	87.33
KOG0979		1072	consensus Structural maintenance of chromosome pro	87.31
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	87.3
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	87.27
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	87.1
PF01217		141	Clat_adaptor_s: Clathrin adaptor complex small cha	87.07
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	87.0
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	87.0
PHA02244		383	ATPase-like protein	86.85
PRK10865		857	protein disaggregation chaperone; Provisional	86.77
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	86.75
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	86.74
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	86.73
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	86.73
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	86.72
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	86.66
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	86.66
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	86.65
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	86.61
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	86.56
TIGR00955		617	3a01204 The Eye Pigment Precursor Transporter (EPP	86.51
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	86.36
COG3451		796	VirB4 Type IV secretory pathway, VirB4 components	86.28
PRK14088		440	dnaA chromosomal replication initiation protein; P	86.22
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	86.16
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	86.04
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	86.0
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	85.94
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	85.91
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	85.86
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	85.83
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	85.83
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	85.73
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	85.71
PRK07471		365	DNA polymerase III subunit delta'; Validated	85.66
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	85.62
COG2256		436	MGS1 ATPase related to the helicase subunit of the	85.58
PRK00683		418	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.53
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	85.5
COG1855		604	ATPase (PilT family) [General function prediction	85.28
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	85.27
COG1162		301	Predicted GTPases [General function prediction onl	85.24
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	85.06
PRK07940		394	DNA polymerase III subunit delta'; Validated	85.03
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	85.02
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	85.0
TIGR01087		433	murD UDP-N-acetylmuramoylalanine--D-glutamate liga	84.99
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	84.89
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	84.89
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.89
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	84.82
PRK04301		317	radA DNA repair and recombination protein RadA; Va	84.81
PRK01390		460	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.8
COG1127		263	Ttg2A ABC-type transport system involved in resist	84.79
PRK03806		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.67
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	84.65
CHL00176		638	ftsH cell division protein; Validated	84.6
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	84.59
PRK12608		380	transcription termination factor Rho; Provisional	84.58
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	84.5
PLN03140		1470	ABC transporter G family member; Provisional	84.47
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	84.45
cd01127		410	TrwB Bacterial conjugation protein TrwB, ATP bindi	84.41
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	84.37
COG5545		517	Predicted P-loop ATPase and inactivated derivative	84.33
PRK04663		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.32
PRK00421		461	murC UDP-N-acetylmuramate--L-alanine ligase; Provi	84.2
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	84.13
PTZ00243		1560	ABC transporter; Provisional	84.13
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.1
KOG0056		790	consensus Heavy metal exporter HMT1, ABC superfami	84.05
TIGR01143		417	murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-a	84.04
PLN03232		1495	ABC transporter C family member; Provisional	84.0
PRK03803		448	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.95
KOG0057		591	consensus Mitochondrial Fe/S cluster exporter, ABC	83.88
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	83.87
PRK12422		445	chromosomal replication initiation protein; Provis	83.86
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.85
TIGR01081		448	mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl	83.72
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	83.7
PRK14093		479	UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminop	83.59
PRK04690		468	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.56
COG4988		559	CydD ABC-type transport system involved in cytochr	83.56
PRK00149		450	dnaA chromosomal replication initiation protein; R	83.52
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.52
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	83.51
PLN03130		1622	ABC transporter C family member; Provisional	83.44
PRK01368		454	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.39
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	83.36
PRK03815		401	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.28
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	83.24
PRK10875		615	recD exonuclease V subunit alpha; Provisional	83.22
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.11
PRK09376		416	rho transcription termination factor Rho; Provisio	83.04
PRK06620		214	hypothetical protein; Validated	82.98
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	82.98
TIGR01082		448	murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a	82.97
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	82.87
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	82.84
COG4598		256	HisP ABC-type histidine transport system, ATPase c	82.65
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	82.63
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	82.56
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	82.55
TIGR03744		893	traC_PFL_4706 conjugative transfer ATPase, PFL_470	82.53
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	82.49
KOG0062		582	consensus ATPase component of ABC transporters wit	82.49
PRK11054		684	helD DNA helicase IV; Provisional	82.38
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	82.36
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	82.24
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	82.09
PRK09563		287	rbgA GTPase YlqF; Reviewed	82.07
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	81.98
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	81.9
KOG2355		291	consensus Predicted ABC-type transport, ATPase com	81.89
TIGR00929		785	VirB4_CagE type IV secretion/conjugal transfer ATP	81.85
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	81.83
PRK10536		262	hypothetical protein; Provisional	81.82
COG0714		329	MoxR-like ATPases [General function prediction onl	81.78
PRK08972		444	fliI flagellum-specific ATP synthase; Validated	81.75
cd01136		326	ATPase_flagellum-secretory_path_III Flagellum-spec	81.72
PRK14022		481	UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine l	81.71

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Probab=100.00  E-value=1.1e-76  Score=604.16  Aligned_cols=394  Identities=41%  Similarity=0.655  Sum_probs=279.0

Q ss_pred             CcceEEEeecCcEEEEeecccCCCCCCCcHHHHHHHhHhhcccCCCceeeccCCCceeeEEEEecccceEEEEEeccccc
Q 013364            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (444)
Q Consensus         1 MLD~f~IftkgGiVLWs~~~~~~~~~~~pin~LI~~vllEeR~~~~~~~~~~~~d~y~lkw~~~Ne~~LVFVvvYQ~iL~   80 (444)
                      |||+|.||||||+|||.|+-.+..+.+ |||+||++||||||++..+|.+    +.|||+|+++|+++||||||||+|++
T Consensus         1 Mld~faIFtkgG~vLw~~~~~~~~~~~-~in~lI~~~ll~er~~~~~~~~----~~yTlk~q~~N~~~lvfvvvfqki~~   75 (587)
T KOG0781|consen    1 MLDQFAIFTKGGLVLWCYQEVGDNLKG-PINALIRSVLLSERGGVNSFTF----EAYTLKYQLDNQYSLVFVVVFQKILT   75 (587)
T ss_pred             CcceeeeecCCcEEEEEecccchhccc-hHHHHHHHHHHHhhcCcccCch----hheeEeeeecCCccEEEEEEEeccch
Confidence            999999999999999987766656666 9999999999999999999999    99999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCCCC--CCcchHHHHHHHHHHHHHHHHHH---hhhhhccccccccccccCcccCCCCCCC
Q 013364           81 LLYVDDLLAMMKQSFSEIYDPKRT--DYSDFDEMFRQLRKEAEARAEEL---KKSKQVTKPMNNLKKQGGQLQKGGFERG  155 (444)
Q Consensus        81 L~yvD~LL~~vk~~F~~~y~~~~~--~~~~Fd~~F~~~l~~~e~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (444)
                      |.|+|+||++++..|+..|.+...  .+-+|.+.|..+|+.........   .+.+..++.++++++....         
T Consensus        76 L~yv~~ll~~v~~~f~e~~~~~~~~~l~~n~~~~~~e~lk~rq~~ne~t~~k~~~pi~~~~~~~~~K~~~~---------  146 (587)
T KOG0781|consen   76 LTYVDKLLNDVLNLFREKYDTQSALSLLNNTFDFQEELLKLRQVANEATEYKIRAPITMKKSEDLEKAKDP---------  146 (587)
T ss_pred             hhhHHHHHHHHHHHHHHHhccchHHHhhhhhHHHHHHHHHHhhcccccchhhhcccchhhhhhcchhhhhh---------
Confidence            999999999999999999987432  34466666666666554322111   1111122223333322211         


Q ss_pred             CCCCCCCCCCCCCCCCc-ccCcccCCCCCCCCcccccccccccccCCCCCCCCccchhhhHHHHHhhhcCCCCcccccCC
Q 013364          156 SNRSGGGSANDDGDSDN-MRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSK  234 (444)
Q Consensus       156 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~k~~~k~~~~~~~~~~~  234 (444)
                          .....+.++.... ....++.++..+.+                     +.     ..++++-+..+++.   +..
T Consensus       147 ----v~~~~e~~~d~s~kk~~nt~kng~~~~~---------------------h~-----~~~kk~~~~tkkKg---~~s  193 (587)
T KOG0781|consen  147 ----VRSPIETNGDKSAKKKKNTKKNGAKKEG---------------------HD-----EEFKKKHRETKKKG---NKS  193 (587)
T ss_pred             ----hccccccccccchhcccccccCCCcccc---------------------hh-----hhhhhhhccccccc---ccC
Confidence                0011111111100 00000111111110                     01     11122211111111   112


Q ss_pred             CCCCCCCccccccCccCCCCC--CCCCcccCCCCCCCCCch-hhhhhhcCCCccccccccC---CCCcchhhhhhccCCC
Q 013364          235 GSNPDPKKKITKKNRVWDDSP--PESKLDFTDPAGGNGSNI-EVEAADHGESMMDKEEVFS---SDSESEEDEEVGKHNK  308 (444)
Q Consensus       235 ~~~~~~~~k~~K~~R~Wd~~~--~~~~LD~S~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~---s~~e~~~~~~~~~~~~  308 (444)
                      ++.+.|++|.+|++|+||+.+  +...||||++..+++.+. +.+...++.++.+-.+..+   ++++++++.+ ..+..
T Consensus       194 ~~~~~p~kKGkk~~RvWdd~g~~d~~~ld~sss~sn~e~a~~e~vn~~~~~s~~~~~~~l~~~~~d~~~s~~~~-~~~~~  272 (587)
T KOG0781|consen  194 TKVDAPKKKGKKAPRVWDDAGCEDEKVLDYSSSTSNGENALSETVNLDQGESMGGQLQDLDKDSSDDEGSADNS-TDPAA  272 (587)
T ss_pred             CCCCCchhhcccccchhhhccchhhcccccCCccccccchhHHHhhhhhhcccccccccccccccccccccccc-cchhh
Confidence            233455566667799999865  778999999885554332 2333334444433211111   1111111111 11223


Q ss_pred             CCccccchHHHHHHHccCCccCChhchHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHhcccccccccchhHHHHHHHHH
Q 013364          309 PDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEE  388 (444)
Q Consensus       309 ~~~~~~~~~~~~~~~l~g~k~l~~edl~~~l~~l~~~Li~kdVa~~ia~~l~~~v~~~l~g~k~~~~~~~~~~v~~~l~~  388 (444)
                      ..++.++||+ ||++|+|++.|.++||.|+|++|++|||.+|||.++|++||++|..+|+|+++++|+++..+|+++|++
T Consensus       273 ~~k~~g~aFg-~fkglvG~K~L~eeDL~pvL~kM~ehLitKNVA~eiA~~LcEsV~a~Legkkv~sfs~V~~Tvk~Al~d  351 (587)
T KOG0781|consen  273 TKKTVGGAFG-LFKGLVGSKSLSEEDLNPVLDKMTEHLITKNVAAEIAEKLCESVAASLEGKKVGSFSTVESTVKEALRD  351 (587)
T ss_pred             hhcchhhHHH-HHHhhcccccccHhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHhhhcccccchHHHHHHHHHHHH
Confidence            4455677886 999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCCCcchhhHhHHHhhhcCCCeEEEEEeeCCCChhhHHHHHHHHHHHhc
Q 013364          389 ALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVKLIILIDF  443 (444)
Q Consensus       389 ~L~~iL~p~~~~d~l~~i~~~~~~~~p~vI~fVGvNGVGKTTTlAKLA~~l~~~~  443 (444)
                      +|++||+|.+++|+||+|..++.+++||||+||||||||||||||||||||++|.
T Consensus       352 aLvQILTP~~sVDlLRdI~sar~~krPYVi~fvGVNGVGKSTNLAKIayWLlqNk  406 (587)
T KOG0781|consen  352 ALVQILTPQRSVDLLRDIMSARRRKRPYVISFVGVNGVGKSTNLAKIAYWLLQNK  406 (587)
T ss_pred             HHHHHcCCCchhhHHHHHHHHHhcCCCeEEEEEeecCccccchHHHHHHHHHhCC
Confidence            9999999999999999999999999999999999999999999999999999984

>PF04086 SRP-alpha_N: Signal recognition particle, alpha subunit, N-terminal; InterPro: IPR007222 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PF02881 SRP54_N: SRP54-type protein, helical bundle domain; InterPro: IPR013822 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF09201 SRX: SRX; InterPro: IPR015284 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>KOG2878 consensus Predicted kinase [General function prediction only]	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0859 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PRK07196 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>PF01217 Clat_adaptor_s: Clathrin adaptor complex small chain; InterPro: IPR022775 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>COG5545 Predicted P-loop ATPase and inactivated derivatives [General function prediction only]	Back alignment and domain information

>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>PRK14093 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase; Provisional	Back alignment and domain information

>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription]	Back alignment and domain information

>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK08972 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein	Back alignment and domain information

>PRK14022 UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		444
2fh5_A		185	The Structure Of The Mammalian Srp Receptor Length		4e-14
3dmd_B		328	Structures And Conformations In Solution Of The Sig		1e-05
3dm9_B		328	Structures And Conformations In Solution Of The Sig		1e-05

>pdb|2FH5|A Chain A, The Structure Of The Mammalian Srp Receptor Length = 185

Back alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 40/99 (40%), Positives = 62/99 (62%), Gaps = 5/99 (5%) Query: 1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60 M++ IF++GGL+LW + + ++ G P++ LIRS LL+ER G SF ++ A TLK Sbjct: 10 MVDFFTIFSKGGLVLWCFQGVSDSCTG-PVNALIRSVLLQERGGNNSFTHE----ALTLK 64 Query: 61 WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIY 99 + N+ LVFV +Q+IL L YVD L+ + + F + Y Sbjct: 65 YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKY 103

PyMOL of 2fh5

>pdb|3DMD|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328

Back alignment and structure

>pdb|3DM9|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		444
2fh5_A		185	Signal recognition particle receptor alpha subunit	3e-42
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	2e-24
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	1e-11
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	3e-10
2og2_A		359	Putative signal recognition particle receptor; nuc	4e-10
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	7e-09
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	6e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-06
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	5e-06
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	7e-06

>2fh5_A Signal recognition particle receptor alpha subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Homo sapiens} SCOP: d.110.4.4 PDB: 2go5_1 Length = 185	Back alignment and structure

 Score =  146 bits (370), Expect = 3e-42
 Identities = 50/184 (27%), Positives = 84/184 (45%), Gaps = 17/184 (9%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           M++   IF++GGL+LW  + + ++    P++ LIRS LL+ER G  SF +++     TLK
Sbjct: 10  MVDFFTIFSKGGLVLWCFQGVSDS-CTGPVNALIRSVLLQERGGNNSFTHEA----LTLK 64

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYS---------DFDE 111
           +   N+  LVFV  +Q+IL L YVD L+  + + F + Y  +    S         DF  
Sbjct: 65  YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQN 124

Query: 112 MFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSD 171
            F +L +EAE  ++    +       +   K+     +   E    +    + N      
Sbjct: 125 DFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPV---RSMIETRGEKPKEKAKNSKKKGA 181

Query: 172 NMRG 175
              G
Sbjct: 182 KKEG 185

PyMOL of 2fh5

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Length = 328	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Length = 296	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Length = 359	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Length = 302	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Length = 320	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Length = 304	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Length = 306	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		444
2fh5_A		185	Signal recognition particle receptor alpha subunit	100.0
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	99.7
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	99.62
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	99.62
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	99.62
2xxa_A		433	Signal recognition particle protein; protein trans	99.61
2og2_A		359	Putative signal recognition particle receptor; nuc	99.57
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	99.56
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	99.55
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	99.54
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	99.5
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	99.49
2vx8_A		169	Nucleoporin-like protein RIP, vesicle-associated m	99.47
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	99.47
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	99.47
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	99.44
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	99.37
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	99.35
1nrj_A		158	Signal recognition particle receptor alpha subunit	98.1
4afi_A		173	AP-3 complex subunit delta-1, vesicle-associated p	97.3
2e87_A		357	Hypothetical protein PH1320; GTP-binding, GTPase,	97.18
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	96.99
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	96.95
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	96.89
3izq_1		611	HBS1P, elongation factor 1 alpha-like protein; NO-	96.76
2ewv_A		372	Twitching motility protein PILT; pilus retraction	96.7
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	96.59
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	96.55
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	96.54
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	96.42
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	96.39
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	96.25
2gza_A		361	Type IV secretion system protein VIRB11; ATPase, h	96.21
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	96.16
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	96.15
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	96.14
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	96.12
1p9r_A		418	General secretion pathway protein E; bacterial typ	96.06
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	96.01
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	95.95
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	95.89
2pt7_A		330	CAG-ALFA; ATPase, protein-protein complex, type IV	95.88
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	95.87
2hf9_A		226	Probable hydrogenase nickel incorporation protein	95.83
2ged_A		193	SR-beta, signal recognition particle receptor beta	95.82
1g6h_A		257	High-affinity branched-chain amino acid transport	95.82
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	95.8
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	95.8
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	95.77
1f2t_A		149	RAD50 ABC-ATPase; DNA double-strand break repair,	95.77
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	95.76
3bos_A		242	Putative DNA replication factor; P-loop containing	95.76
2oap_1		511	GSPE-2, type II secretion system protein; hexameri	95.74
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	95.73
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	95.72
4b93_A		189	Vesicle-associated membrane protein 7; endocytosis	95.71
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	95.71
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	95.7
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	95.68
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	95.67
1b0u_A		262	Histidine permease; ABC transporter, transport pro	95.59
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	95.57
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	95.53
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	95.52
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	95.51
1ji0_A		240	ABC transporter; ATP binding protein, structural g	95.51
1tq4_A		413	IIGP1, interferon-inducible GTPase; interferon gam	95.5
2ghi_A		260	Transport protein; multidrug resistance protein, M	95.5
2nut_C		196	Vesicle-trafficking protein SEC22B; human copii SE	95.45
1sgw_A		214	Putative ABC transporter; structural genomics, P p	95.37
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	95.35
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	95.34
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	95.33
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	95.33
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	95.31
2chg_A		226	Replication factor C small subunit; DNA-binding pr	95.3
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	95.3
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	95.25
2obl_A		347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	95.21
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	95.2
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	95.19
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	95.18
2qag_B		427	Septin-6, protein NEDD5; cell cycle, cell division	95.08
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	95.08
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	95.07
3cr8_A		552	Sulfate adenylyltranferase, adenylylsulfate kinase	95.05
3tui_C		366	Methionine import ATP-binding protein METN; ABC-tr	95.0
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	94.94
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	94.94
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	94.87
1z47_A		355	CYSA, putative ABC-transporter ATP-binding protein	94.85
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	94.84
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	94.8
2npi_A		460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	94.8
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	94.79
3a8t_A		339	Adenylate isopentenyltransferase; rossmann fold pr	94.76
3gd7_A		390	Fusion complex of cystic fibrosis transmembrane co	94.72
2yv5_A		302	YJEQ protein; hydrolase, GTPase, permutation, stru	94.68
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	94.66
1v43_A		372	Sugar-binding transport ATP-binding protein; ATPas	94.66
2rcn_A		358	Probable GTPase ENGC; YJEQ, circularly permuted, G	94.53
2axn_A		520	6-phosphofructo-2-kinase/fructose-2,6- biphosphata	94.45
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	94.38
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	94.38
1oxx_K		353	GLCV, glucose, ABC transporter, ATP binding protei	94.33
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	94.33
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	94.32
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	94.26
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	94.24
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	94.23
1lw7_A		365	Transcriptional regulator NADR; NMN, NMN adenylyl	94.22
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	94.12
2dpy_A		438	FLII, flagellum-specific ATP synthase; beta barrel	94.11
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	94.07
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	94.05
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	94.02
3b5x_A		582	Lipid A export ATP-binding/permease protein MSBA;	94.0
1t9h_A		307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	93.94
1u0l_A		301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	93.88
1h65_A		270	Chloroplast outer envelope protein OEP34; GTPase,	93.87
1bif_A		469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	93.87
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	93.72
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	93.59
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	93.58
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	93.54
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	93.52
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	93.49
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	93.44
2r6a_A		454	DNAB helicase, replicative helicase; replication,	93.43
2qgz_A		308	Helicase loader, putative primosome component; str	93.36
3end_A		307	Light-independent protochlorophyllide reductase ir	93.35
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	93.32
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	93.24
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	93.19
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	93.14
4aby_A		415	DNA repair protein RECN; hydrolase, double strand	93.12
1tue_A		212	Replication protein E1; helicase, replication, E1E	93.05
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	93.02
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	92.98
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	92.95
3b60_A		582	Lipid A export ATP-binding/permease protein MSBA;	92.91
2qag_C		418	Septin-7; cell cycle, cell division, GTP-binding,	92.9
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	92.87
2chq_A		319	Replication factor C small subunit; DNA-binding pr	92.77
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	92.74
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	92.72
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	92.67
3pvs_A		447	Replication-associated recombination protein A; ma	92.66
2yl4_A		595	ATP-binding cassette SUB-family B member 10, mitoc	92.57
3qf4_B		598	Uncharacterized ABC transporter ATP-binding prote	92.56
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	92.48
1g41_A		444	Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep	92.46
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	92.44
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	92.42
3def_A		262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	92.31
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	92.25
2qmh_A		205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	92.2
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	92.17
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	92.15
2j1l_A		214	RHO-related GTP-binding protein RHOD; GTPase, memb	92.1
4a82_A		578	Cystic fibrosis transmembrane conductance regulat;	92.05
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	91.92
3bfv_A		271	CAPA1, CAPB2, membrane protein CAPA1, protein tyro	91.83
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	91.8
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	91.8
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	91.79
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	91.75
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	91.73
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	91.7
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	91.64
3cio_A		299	ETK, tyrosine-protein kinase ETK; WZC, escherichia	91.63
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	91.63
3qf4_A		587	ABC transporter, ATP-binding protein; multidrug tr	91.62
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	91.61
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	91.56
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	91.52
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	91.41
3la6_A		286	Tyrosine-protein kinase WZC; P-loop protein, nucle	91.38
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	91.07
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	90.97
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	90.97
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	90.96
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	90.75
3fkq_A		373	NTRC-like two-domain protein; RER070207001320, str	90.75
3ice_A		422	Transcription termination factor RHO; transcriptio	90.68
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	90.65
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	90.6
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	90.59
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	90.54
2vgl_S		142	AP-2 complex subunit sigma-1; cytoplasmic vesicle,	90.47
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	90.45
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	90.45
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	90.44
1mky_A		439	Probable GTP-binding protein ENGA; GTPase, DER, KH	90.42
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	90.36
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	90.34
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	90.33
1wb9_A		800	DNA mismatch repair protein MUTS; DNA-binding, ATP	90.21
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	90.2
1ewq_A		765	DNA mismatch repair protein MUTS; multiple domains	90.11
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	90.06
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	90.03
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	89.97
2oze_A		298	ORF delta'; para, walker type atpases, DNA segrega	89.86
2qag_A		361	Septin-2, protein NEDD5; cell cycle, cell division	89.83
2qtf_A		364	Protein HFLX, GTP-binding protein; beta-alpha-barr	89.75
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	89.65
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	89.62
2g3y_A		211	GTP-binding protein GEM; small GTPase, GDP, inacti	89.6
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	89.56
1w63_Q		158	Adapter-related protein complex 1 sigma 1A subunit	89.49
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	89.46
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	89.45
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	89.37
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	89.36
3szr_A		608	Interferon-induced GTP-binding protein MX1; interf	89.32
1udx_A		416	The GTP-binding protein OBG; TGS domain, riken str	89.27
3fwy_A		314	Light-independent protochlorophyllide reductase I	89.12
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	89.06
1x6v_B		630	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	88.83
3thx_A		934	DNA mismatch repair protein MSH2; ABC family ATPas	88.57
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	88.52
1u0j_A		267	DNA replication protein; AAA+ protein, P-loop atpa	88.46
3thx_B		918	DNA mismatch repair protein MSH3; ABC family ATPas	88.42
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	88.34
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	88.26
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	88.22
3ez2_A		398	Plasmid partition protein A; type IA, DNA binding,	88.08
1e9r_A		437	Conjugal transfer protein TRWB; coupling protein,	88.06
2r44_A		331	Uncharacterized protein; putative ATPase, structur	87.93
3cnl_A		262	YLQF, putative uncharacterized protein; circular p	87.75
1puj_A		282	YLQF, conserved hypothetical protein YLQF; structu	87.26
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	87.22
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	86.83
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	86.79
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	86.75
4ad8_A		517	DNA repair protein RECN; DNA binding protein, ATPa	86.7
3l0i_B		199	RAS-related protein RAB-1A; GEF-GDF-RAB complex, G	86.46
1u94_A		356	RECA protein, recombinase A; homologous recombinat	86.41
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	86.23
3eag_A		326	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME	86.23
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	86.15
1m8p_A		573	Sulfate adenylyltransferase; rossmann fold, phosph	86.06
3co5_A		143	Putative two-component system transcriptional RES	86.03
2gks_A		546	Bifunctional SAT/APS kinase; transferase, sulfuryl	85.93
2o8b_B		1022	DNA mismatch repair protein MSH6; DNA damage respo	85.85
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	85.82
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	85.78
1sky_E		473	F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp	85.75
3ez9_A		403	Para; DNA binding, winged-HTH, partition, biosynth	85.41
1of1_A		376	Thymidine kinase; transferase, antiviral drug, enz	85.24
1w63_M		423	Adaptor-related protein complex 1, MU 1 subunit; e	85.2
2wkq_A		332	NPH1-1, RAS-related C3 botulinum toxin substrate 1	85.07
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	85.06
3o47_A		329	ADP-ribosylation factor GTPase-activating protein	85.04
3t34_A		360	Dynamin-related protein 1A, linker, dynamin-relat	84.09
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	83.94
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	83.69
3geh_A		462	MNME, tRNA modification GTPase MNME; G protein, U3	83.45
3lk7_A		451	UDP-N-acetylmuramoylalanine--D-glutamate ligase; a	83.3
2vgl_M		435	AP-2 complex subunit MU-1; cytoplasmic vesicle, al	83.27
2z43_A		324	DNA repair and recombination protein RADA; archaea	83.15
3bw6_A		144	Synaptobrevin homolog YKT6; YKT6P, farnesylation,	83.14
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	83.02
1g8f_A		511	Sulfate adenylyltransferase; alpha-beta protein, b	82.67
1w78_A		422	FOLC bifunctional protein; DHFS, dihydrofolate syn	82.56
1p3d_A		475	UDP-N-acetylmuramate--alanine ligase; alpha/beta p	82.42
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	82.41
1xp8_A		366	RECA protein, recombinase A; recombination, radior	82.3
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	82.2
1e8c_A		498	UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami	82.09
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	81.97
2hjg_A		436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	81.93
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	81.88
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	81.85
1jbw_A		428	Folylpolyglutamate synthase; FPGS folate AMPPCP te	81.83
1gg4_A		452	UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diamino	81.82
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	81.74
2f00_A		491	UDP-N-acetylmuramate--L-alanine ligase; amide bond	81.57
2x5o_A		439	UDP-N-acetylmuramoylalanine--D-glutamate ligase; A	81.56
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	81.38
3hn7_A		524	UDP-N-acetylmuramate-L-alanine ligase; ATP-binding	81.24
4hv4_A		494	UDP-N-acetylmuramate--L-alanine ligase; MURC, yers	81.08
2am1_A		454	SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl	80.91
2wtz_A		535	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di	80.89
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	80.38
1o5z_A		442	Folylpolyglutamate synthase/dihydrofolate synthas;	80.19
3tjz_C		153	Coatomer subunit zeta-1; protein trafficking, golg	80.12
1j6u_A		469	UDP-N-acetylmuramate-alanine ligase MURC; structur	80.05

>2fh5_A Signal recognition particle receptor alpha subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Homo sapiens} SCOP: d.110.4.4 PDB: 2go5_1	Back alignment and structure

Probab=100.00  E-value=4.3e-46  Score=344.37  Aligned_cols=138  Identities=35%  Similarity=0.559  Sum_probs=103.6

Q ss_pred             CcceEEEeecCcEEEEeecccCCCCCCCcHHHHHHHhHhhcccCCCceeeccCCCceeeEEEEecccceEEEEEeccccc
Q 013364            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (444)
Q Consensus         1 MLD~f~IftkgGiVLWs~~~~~~~~~~~pin~LI~~vllEeR~~~~~~~~~~~~d~y~lkw~~~Ne~~LVFVvvYQ~iL~   80 (444)
                      |.|+|+|||||||||||++ +.++++++|||+||++||||||+++++|.+    |+|+|||+|+||||||||||||+|||
T Consensus        10 ~~D~~~IfTkGGvVLWs~~-~~~~~~~~~IN~LIr~VlLEER~~~~~y~~----d~ytlkW~l~NEl~LVFVvVYQ~iL~   84 (185)
T 2fh5_A           10 MVDFFTIFSKGGLVLWCFQ-GVSDSCTGPVNALIRSVLLQERGGNNSFTH----EALTLKYKLDNQFELVFVVGFQKILT   84 (185)
T ss_dssp             SCSEEEEEETTSBEEEEEB-TTTBSCCCHHHHHHHHTGGGC-------CC----CCCEEEEEEETTTTEEEEEEESCGGG
T ss_pred             ceeEEEEEeCCeEEEEeec-CCcccccchHHHHHHHhhhccccCCCceeE----cCeEEEEEEeccCCEEEEEEEccccc
Confidence            9999999999999999753 445689999999999999999999999999    99999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCCCC---------CCcchHHHHHHHHHHHHHHHHHHhhhhhccccccccccccC
Q 013364           81 LLYVDDLLAMMKQSFSEIYDPKRT---------DYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGG  145 (444)
Q Consensus        81 L~yvD~LL~~vk~~F~~~y~~~~~---------~~~~Fd~~F~~~l~~~e~~~~~~~~~~~~~~~~~~~~~~~~  145 (444)
                      |+|||+||++|+++|+++|++.+.         .+++||++|+++|+++|+.++..+  +..|++|+++.++++
T Consensus        85 L~YiD~LL~~v~~~Fv~~Y~~~L~~~~~~~~~~~~~~Fd~~F~~~l~~~e~~~~~~~--~k~mr~fees~ks~k  156 (185)
T 2fh5_A           85 LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRA--PTTMKKFEDSEKAKK  156 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHSSSTHHHHSCCCCCHHHHHHHHHHHHHHTC--------------------
T ss_pred             chHHHHHHHHHHHHHHHHHHHHhhcccccccccccCchhHHHHHHHHHHHHHHHhhh--HHhhccHhhhhhhhh
Confidence            999999999999999999976521         345899999999999998875433  345899998887643

PyMOL of 2fh5

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>2vx8_A Nucleoporin-like protein RIP, vesicle-associated membrane protein 7; endocytosis,exocytosis, endocytosis, exocytosis, acetylation, coiled coil; 2.2A {Homo sapiens} PDB: 2dmw_A	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>1nrj_A Signal recognition particle receptor alpha subunit homolog; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: d.110.4.4	Back alignment and structure

>4afi_A AP-3 complex subunit delta-1, vesicle-associated protein 7; endocytosis, exocytosis, clathrin adaptor, chimera, fusion P; 2.80A {Homo sapiens}	Back alignment and structure

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}	Back alignment and structure

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}	Back alignment and structure

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}	Back alignment and structure

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*	Back alignment and structure

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V	Back alignment and structure

>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A*	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}	Back alignment and structure

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*	Back alignment and structure

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A	Back alignment and structure

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E*	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}	Back alignment and structure

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A*	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli}	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli}	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale}	Back alignment and structure

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2vgl_S AP-2 complex subunit sigma-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Mus musculus} SCOP: i.23.1.1 PDB: 2jkt_I 2jkr_I* 2xa7_S	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A*	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A*	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes}	Back alignment and structure

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>1w63_Q Adapter-related protein complex 1 sigma 1A subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B	Back alignment and structure

>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A*	Back alignment and structure

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A	Back alignment and structure

>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B*	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A	Back alignment and structure

>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A*	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A*	Back alignment and structure

>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans}	Back alignment and structure

>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens}	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58}	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus}	Back alignment and structure

>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B*	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11	Back alignment and structure

>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A	Back alignment and structure

>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1	Back alignment and structure

>1w63_M Adaptor-related protein complex 1, MU 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A*	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}	Back alignment and structure

>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A*	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP}	Back alignment and structure

>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae}	Back alignment and structure

>2vgl_M AP-2 complex subunit MU-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2jkr_M 2jkt_M 2bp5_M* 2xa7_M	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>3bw6_A Synaptobrevin homolog YKT6; YKT6P, farnesylation, vacuole fusion, snare, coiled coil, lipoprotein, membrane, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 1h8m_A 1iou_A	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A*	Back alignment and structure

>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A*	Back alignment and structure

>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A*	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A	Back alignment and structure

>1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli}	Back alignment and structure

>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A*	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A*	Back alignment and structure

>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4}	Back alignment and structure

>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A	Back alignment and structure

>2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D-A alanine ligase, MURF protein; HET: 1LG; 2.50A {Streptococcus pneumoniae} PDB: 2am2_A*	Back alignment and structure

>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A*	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthas; TM0166, structural genomics, JC protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2	Back alignment and structure

>3tjz_C Coatomer subunit zeta-1; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} PDB: 2hf6_A	Back alignment and structure

>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		444
d2fh5a1		129	d.110.4.4 (A:1-129) Signal recognition particle re	2e-45
d1j8yf2		211	c.37.1.10 (F:87-297) GTPase domain of the signal s	1e-05
d2qy9a2		211	c.37.1.10 (A:285-495) GTPase domain of the signal	2e-05
d1vmaa2		213	c.37.1.10 (A:82-294) GTPase domain of the signal r	3e-05
d1okkd2		207	c.37.1.10 (D:97-303) GTPase domain of the signal r	6e-05
d1ls1a2		207	c.37.1.10 (A:89-295) GTPase domain of the signal s	3e-04

>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 129	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: SNARE-like
family: SRP alpha N-terminal domain-like
domain: Signal recognition particle receptor alpha subunit, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  151 bits (384), Expect = 2e-45
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 14/134 (10%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           M++   IF++GGL+LW  + + ++    P++ LIRS LL+ER G  SF +++     TLK
Sbjct: 1   MVDFFTIFSKGGLVLWCFQGVSDS-CTGPVNALIRSVLLQERGGNNSFTHEA----LTLK 55

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYS---------DFDE 111
           +   N+  LVFV  +Q+IL L YVD L+  + + F + Y  +    S         DF  
Sbjct: 56  YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQN 115

Query: 112 MFRQLRKEAEARAE 125
            F +L +EAE  ++
Sbjct: 116 DFLRLLREAEESSK 129

PyMOL of d2fh5a1

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		444
d2fh5a1		129	Signal recognition particle receptor alpha subunit	100.0
d1ls1a1		88	Signal sequence recognition protein Ffh {Thermus a	98.86
d1j8yf1		84	Signal sequence recognition protein Ffh {Archaeon	98.8
d1wgwa_		99	Signal recognition particle 54 kDa protein, SRP54	98.78
d2qy9a1		84	Signal recognition particle receptor, FtsY {Escher	98.55
d1nrja_		155	Srx domain of the signal recognition particle rece	97.58
d1okkd1		58	Signal recognition particle receptor, FtsY {Thermu	97.58
d1vmaa1		81	Signal recognition particle receptor, FtsY {Thermo	97.51
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	97.46
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	96.87
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	96.86
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	96.82
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	96.35
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	96.14
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	96.05
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	96.02
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	96.0
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	95.96
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	95.92
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	95.84
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	95.77
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	95.63
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	95.48
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	95.35
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	95.28
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	95.25
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	95.23
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	95.2
d2vglm2		141	Mu2 adaptin (clathrin coat assembly protein AP50)	95.18
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	95.1
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	95.08
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	95.05
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	94.98
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	94.98
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	94.89
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	94.84
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	94.6
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	94.48
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	94.33
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	94.19
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	94.08
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	94.05
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	93.61
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	93.61
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	93.53
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	93.21
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	92.67
d2vgls_		142	Sigma2 adaptin (clathrin coat assembly protein AP1	91.44
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	91.38
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	90.96
d1ifqa_		127	Sec22b {Mouse (Mus musculus) [TaxId: 10090]}	90.69
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	90.43
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	90.14
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	89.34
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	89.29
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	89.21
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	89.16
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	89.14
d1t9ha2		231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	88.51
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	88.17
d1h65a_		257	Chloroplast protein translocon GTPase Toc34 {Garde	86.96
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	86.17
d1o5za2		296	Folylpolyglutamate synthetase {Thermotoga maritima	86.07
d2gc6a2		296	Folylpolyglutamate synthetase {Lactobacillus casei	84.81
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	84.0
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	83.27
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	83.13
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	82.43

>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: SNARE-like
family: SRP alpha N-terminal domain-like
domain: Signal recognition particle receptor alpha subunit, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.8e-45  Score=319.15  Aligned_cols=119  Identities=39%  Similarity=0.643  Sum_probs=102.8

Q ss_pred             CcceEEEeecCcEEEEeecccCCCCCCCcHHHHHHHhHhhcccCCCceeeccCCCceeeEEEEecccceEEEEEeccccc
Q 013364            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (444)
Q Consensus         1 MLD~f~IftkgGiVLWs~~~~~~~~~~~pin~LI~~vllEeR~~~~~~~~~~~~d~y~lkw~~~Ne~~LVFVvvYQ~iL~   80 (444)
                      |||+|+|||||||||||+. +.++.+++|||+||++||||||+++++|.|    |+|+|||+++||+|||||||||+|||
T Consensus         1 MiD~f~IftkGGiVLW~~~-~~~~~~~~~IN~LI~~vlLEER~~~~~~~~----d~y~lkw~~~Ne~~lvfV~vYQ~il~   75 (129)
T d2fh5a1           1 MVDFFTIFSKGGLVLWCFQ-GVSDSCTGPVNALIRSVLLQERGGNNSFTH----EALTLKYKLDNQFELVFVVGFQKILT   75 (129)
T ss_dssp             SCSEEEEEETTSBEEEEEB-TTTBSCCCHHHHHHHHTGGGC-------CC----CCCEEEEEEETTTTEEEEEEESCGGG
T ss_pred             CccEEEEEeCCeEEEEeec-CCCcccchhHHHHHHHhheecccCCCceeE----CCEEEEEEEeccCCEEEEEEEhhhhc
Confidence            9999999999999999654 445889999999999999999999999999    99999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCCC---------CCCcchHHHHHHHHHHHHHHH
Q 013364           81 LLYVDDLLAMMKQSFSEIYDPKR---------TDYSDFDEMFRQLRKEAEARA  124 (444)
Q Consensus        81 L~yvD~LL~~vk~~F~~~y~~~~---------~~~~~Fd~~F~~~l~~~e~~~  124 (444)
                      |+|||+||++|+++|+++|++..         ..+++||++|+++|+++|+++
T Consensus        76 l~yvd~lL~~i~~~F~~~y~~~l~~~~~~~~~~~~~~Fd~~F~~~l~~~e~~~  128 (129)
T d2fh5a1          76 LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESS  128 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHSSSTHHHHSCCCCCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcccccccccccccchHHHHHHHHHHHHHhc
Confidence            99999999999999999998743         135589999999999999764

PyMOL of d2fh5a1

>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2qy9a1 a.24.13.1 (A:201-284) Signal recognition particle receptor, FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ifqa_ d.110.4.1 (A:) Sec22b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure