Citrus Sinensis ID: 013379


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
ccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHcccEEEEEEccccccccccHHccccccHHHHHHHHccEEEEEEEcccHHHHHHHHHcccccccEEEEEcccccccEEEEcccccccHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccccccEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHccccccccEEEEcccccccccccccccccHHHccccccEEEEEEc
cccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHcccccHHccccccccccccHHHHHHHHcccccHHHccccHHHHHHHHHHcccEEEEEEccccHccHHHHcHHHcccHHHHHHHHHcEEEEEEEcccHcHHEEEEEEccccccEEEEEccccccEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHcccccccccHcccccccccccccccccccEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccHHccccccccHHHccccccEEEEEEc
mdsvlsandkqsMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVgnesgaiasasrspaeeianpgpeensvtagqeigdevraplpvvrdtlyddamfyagsgaryplhepssliafrnfdeemkrpgvweseqgaastadssrdnlaslyrppfhlmfngsfekakdaasVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQvyddtsegkkvctyykldsipvvlvvdpitgqkmrswcgmvqpeslledlvpfmdggpreqhakvshkrprgssttpqqknkdkpdiENEELLQALAASMETIkdasgvsssdtdvastdkdeasatekpaypilpeepkvdrsllcrvgvrlpdgrrmqrnflrtdPIQLLWSYCYsqlegsemkpfrlthaipgatksldydskltfedsgLANAMISVTWE
mdsvlsandkqsMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTyykldsipvvLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQhakvshkrprgssttpqqknkdkpdIENEELLQALAASMETIkdasgvsssdtdvastdkdeasatekpaypilpeepkvdrslLCRVGvrlpdgrrmqrnflrtdpiqLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKdasgvsssdtdvastdkdEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
***************SFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGN***********************************VRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNF*****************************LYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPF*****************************************************************************************RSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFE***L**********
***************SFLEIAVGQTAETAVQFLQATSWKLDEAIQLFY***********************************************DTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRP**********************LYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRP************************************************************AYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
**********QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGA*********************VTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPG***************RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGP***************************DIENEELLQALAASMETI*************************KPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
*********KQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGN***********************************VRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEM*******************RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGG*****************************************************************************LPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query444 2.2.26 [Sep-21-2011]
O14048427 UBX domain-containing pro yes no 0.900 0.936 0.276 7e-37
Q5REY7489 UBX domain-containing pro yes no 0.515 0.468 0.340 9e-36
O94888489 UBX domain-containing pro yes no 0.515 0.468 0.340 9e-36
Q6P5G6467 UBX domain-containing pro yes no 0.466 0.443 0.323 3e-32
Q55BU7503 UBX domain-containing pro yes no 0.682 0.602 0.264 4e-28
Q06682500 UBX domain-containing pro yes no 0.923 0.82 0.227 1e-22
Q6GQ69445 FAS-associated factor 2-B N/A no 0.538 0.537 0.185 0.0001
>sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 Back     alignment and function desciption
 Score =  155 bits (392), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 127/460 (27%), Positives = 211/460 (45%), Gaps = 60/460 (13%)

Query: 9   DKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA 68
           D+ S+V++F  I    T E A ++L      L  AI LF+   ESG +     S  E  +
Sbjct: 4   DEASLVANFCAI-TNSTPEKAQEYLSVADGDLSTAITLFF---ESGGVTDVQSSYIEAPS 59

Query: 69  NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDD-AMFYAGSG--------ARYPLHEPSS 119
              P E           E+RAP+   R+ L D  A   AG+           +P      
Sbjct: 60  QTEPVE-----------EIRAPIAPTREVLVDPLADMSAGTSIMGNNFGFGGFPRMNRRQ 108

Query: 120 LIAFRNFDE---EMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA 176
                 FD+   ++  P     +    S + S    LA L+RPP+ ++ N S ++A+  A
Sbjct: 109 RRRMGIFDQSPSQIPFPSSNTEDSSEESDSSSRASRLAKLFRPPYDIISNLSLDEARIEA 168

Query: 177 SVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYK 236
           S Q +W+LVNLQ++  F   +LNRD W +E+V + I  +F+F Q+ DD   G +   +Y 
Sbjct: 169 SSQKRWILVNLQTSTSFECQVLNRDLWKDESVKEVIRAHFLFLQLLDDEEPGMEFKRFYP 228

Query: 237 LDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTT 296
           + S P + ++DP TG++++ W     P   +  L  F++G   ++ +    K P G+ + 
Sbjct: 229 VRSTPHIAILDPRTGERVKEWSKSFTPADFVIALNDFLEGCTLDETS--GRKNPLGAKS- 285

Query: 297 PQQKNKDKPDIENEELLQALAASM---ETIKDASGVSSS---------DTDVASTDKDEA 344
             QK  +    E+E++ +A+AAS+    +  ++ G SSS         D  V   D  E 
Sbjct: 286 --QKPVEAMS-EDEQMHKAIAASLGNGNSTTESQGESSSQQAESHGVADDTVHKIDSAEC 342

Query: 345 SATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSE 404
            A E    P            + R+ +R+P+G R  R F  TDP+  +++Y     EG++
Sbjct: 343 DAEEPSPGPN-----------VTRIQIRMPNGARFIRRFSLTDPVSKVYAYVKGVAEGAD 391

Query: 405 MKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE 444
            +PF LT        SLD     T +++G+ N  +   ++
Sbjct: 392 KQPFSLTFQRKSLWTSLDS----TIKEAGIQNTALQFEFQ 427




Involved in CDC48-dependent protein degradation through the ubiquitin/proteasome pathway.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 Back     alignment and function description
>sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 Back     alignment and function description
>sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 Back     alignment and function description
>sp|Q55BU7|UBXN7_DICDI UBX domain-containing protein 7 homolog OS=Dictyostelium discoideum GN=ubxd7 PE=4 SV=1 Back     alignment and function description
>sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 Back     alignment and function description
>sp|Q6GQ69|FAF2B_XENLA FAS-associated factor 2-B OS=Xenopus laevis GN=faf2-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
224111366444 predicted protein [Populus trichocarpa] 0.981 0.981 0.732 0.0
255561727452 UBX domain-containing protein, putative 0.993 0.975 0.720 0.0
359473684456 PREDICTED: UBX domain-containing protein 0.997 0.971 0.717 0.0
359473686447 PREDICTED: UBX domain-containing protein 0.997 0.991 0.727 0.0
356526695468 PREDICTED: UBX domain-containing protein 0.997 0.946 0.660 1e-177
356559124456 PREDICTED: UBX domain-containing protein 0.995 0.969 0.672 1e-177
356559122467 PREDICTED: UBX domain-containing protein 0.986 0.937 0.651 1e-176
356526697476 PREDICTED: UBX domain-containing protein 0.997 0.930 0.649 1e-175
357517375461 UBX domain-containing protein [Medicago 1.0 0.963 0.642 1e-170
449445306450 PREDICTED: UBX domain-containing protein 0.986 0.973 0.668 1e-168
>gi|224111366|ref|XP_002315828.1| predicted protein [Populus trichocarpa] gi|222864868|gb|EEF01999.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/452 (73%), Positives = 373/452 (82%), Gaps = 16/452 (3%)

Query: 1   MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS 60
           M+ +LS ND+QSMVSSFLEIAVGQTAETA QFLQATSWKL++AIQLFYVGNE GA+ASAS
Sbjct: 1   MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS 60

Query: 61  RSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSL 120
             P  E      E   V  G   G+EVRAPLPVVRDTLYDDAM Y  S   YP HE SSL
Sbjct: 61  HPPPTETWPEDLENEKV--GHSDGEEVRAPLPVVRDTLYDDAMLYGASRTGYPPHEASSL 118

Query: 121 IAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQD 180
           IAFRNFDEEMK PGVWES+QG+ ST D+SRDNLASLYRPPFHLMF+GSFEKAK AASVQD
Sbjct: 119 IAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAKGAASVQD 178

Query: 181 KWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSI 240
           KWLLVNLQSTKEFSSHMLNRDTWANEAV+QTISTNFIFWQVYDDTSEG+KVCTYYKLDSI
Sbjct: 179 KWLLVNLQSTKEFSSHMLNRDTWANEAVAQTISTNFIFWQVYDDTSEGQKVCTYYKLDSI 238

Query: 241 PVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQK 300
           PVVL++DPITGQKM SW GMVQPESLLEDLVPFMDGGPR+ H  +SHKR RGSS TP + 
Sbjct: 239 PVVLIIDPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRQRGSSLTPPKS 298

Query: 301 NKDKPDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEAS--------ATEKPAY 352
            +     E+EE+L+ALAASME++KD+S ++S+  D+AS DKD+AS        +T+   Y
Sbjct: 299 KE-----EDEEVLRALAASMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCSTKTLTY 353

Query: 353 PILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTH 412
           P LPEEP  D+SLLCRVG+RLPDGRR+QRNFL+TDPI+LLWS+CYSQLE +  K F L  
Sbjct: 354 PPLPEEPSGDKSLLCRVGIRLPDGRRVQRNFLKTDPIRLLWSFCYSQLEEAGTKLFCLKE 413

Query: 413 AIPGATKSLDYDSKLTFEDSGLANAMISVTWE 444
           AIPGA K LDYDS +TF +SGLAN+MISV WE
Sbjct: 414 AIPGA-KRLDYDSTMTFGESGLANSMISVAWE 444




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255561727|ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis] gi|223538911|gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359473684|ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2-like isoform 2 [Vitis vinifera] gi|297738308|emb|CBI27509.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473686|ref|XP_002274120.2| PREDICTED: UBX domain-containing protein 2-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356526695|ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356559124|ref|XP_003547851.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356559122|ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356526697|ref|XP_003531953.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|357517375|ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula] gi|358345084|ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula] gi|355502548|gb|AES83751.1| UBX domain-containing protein [Medicago truncatula] gi|355522998|gb|AET03452.1| UBX domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449445306|ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
TAIR|locus:2204497468 AT1G14570 "AT1G14570" [Arabido 0.810 0.769 0.636 4.6e-121
TAIR|locus:2202872307 AT1G59550 "AT1G59550" [Arabido 0.396 0.573 0.338 4.2e-54
ZFIN|ZDB-GENE-040704-8505 ubxn7 "UBX domain protein 7" [ 0.614 0.540 0.329 1.2e-41
UNIPROTKB|E1BTX4492 UBXN7 "Uncharacterized protein 0.540 0.487 0.351 2.5e-39
UNIPROTKB|E2R9U7489 UBXN7 "Uncharacterized protein 0.540 0.490 0.339 2.2e-38
UNIPROTKB|O94888489 UBXN7 "UBX domain-containing p 0.540 0.490 0.339 2.2e-38
UNIPROTKB|I3LQY9476 UBXN7 "Uncharacterized protein 0.540 0.504 0.339 2.2e-38
MGI|MGI:2146388467 Ubxn7 "UBX domain protein 7" [ 0.391 0.372 0.365 3e-38
UNIPROTKB|F1MUA8474 UBXN7 "Uncharacterized protein 0.540 0.506 0.335 5.7e-38
POMBASE|SPAC2C4.15c427 ubx2 "UBX domain protein Ubx2" 0.923 0.960 0.271 1.1e-37
TAIR|locus:2204497 AT1G14570 "AT1G14570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1191 (424.3 bits), Expect = 4.6e-121, P = 4.6e-121
 Identities = 240/377 (63%), Positives = 282/377 (74%)

Query:    85 DEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQG--- 141
             DEVRAPLPVVR+TLY ++M+Y          EP+SLIAFRNF EE K PG+WE ++G   
Sbjct:    92 DEVRAPLPVVRETLYGESMYYGAMRVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSS 151

Query:   142 -----AASTADSS---RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEF 193
                  +AS ++S+   RD+LASLYRPPFHLMF GSFE+AK  +S QDKWLLVNLQST EF
Sbjct:   152 ASASASASASESASAPRDSLASLYRPPFHLMFQGSFEQAKTTSSSQDKWLLVNLQSTTEF 211

Query:   194 SSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQK 253
             SSHMLNRDTWAN+AVSQTI  NFIFWQVYDDT+EG+KVCTYYKL+SIPVVLV+DP TGQ+
Sbjct:   212 SSHMLNRDTWANDAVSQTIKANFIFWQVYDDTTEGRKVCTYYKLESIPVVLVIDPTTGQR 271

Query:   254 MRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGS-STTPQQKNKDK--PDIENE 310
             MR W GMV PE+LLEDLVPFMDGGPRE  A +S KRPRGS S TP  K K+    D E E
Sbjct:   272 MRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDVAKDEEEE 331

Query:   311 ELLQALAASMETIKXXXXXXXXXXXXXXXXXXEA-SATEKPAYPILPEEPKV-DRSLLCR 368
             EL +ALAAS+E                     EA ++   P +P LPEEPK  DRSL CR
Sbjct:   332 ELQRALAASLEDNNMKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLPEEPKGGDRSLQCR 391

Query:   369 VGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMK-PFRLTHAIPGATKSLDYDSKL 427
             VG+RLP+G+R+QRNFL+TD IQLLWS+CYSQLE SE K P +LT AIPG +K+L+Y+S L
Sbjct:   392 VGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESKTLEYESNL 451

Query:   428 TFEDSGLANAMISVTWE 444
             T E SG+AN+MIS TWE
Sbjct:   452 TLEQSGVANSMISATWE 468


GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2202872 AT1G59550 "AT1G59550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-8 ubxn7 "UBX domain protein 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTX4 UBXN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9U7 UBXN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94888 UBXN7 "UBX domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQY9 UBXN7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2146388 Ubxn7 "UBX domain protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUA8 UBXN7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
POMBASE|SPAC2C4.15c ubx2 "UBX domain protein Ubx2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
cd02958114 cd02958, UAS, UAS family; UAS is a domain of unkno 8e-53
smart00594122 smart00594, UAS, UAS domain 6e-44
pfam0078978 pfam00789, UBX, UBX domain 1e-15
pfam1389981 pfam13899, Thioredoxin_7, Thioredoxin-like 7e-09
cd0176777 cd01767, UBX, UBX (ubiquitin regulatory X) domain 2e-06
smart0016677 smart00166, UBX, Domain present in ubiquitin-regul 6e-04
cd02991116 cd02991, UAS_ETEA, UAS family, ETEA subfamily; com 8e-04
>gnl|CDD|239256 cd02958, UAS, UAS family; UAS is a domain of unknown function Back     alignment and domain information
 Score =  172 bits (438), Expect = 8e-53
 Identities = 54/113 (47%), Positives = 73/113 (64%)

Query: 164 MFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYD 223
            F GSFE AK  A  + KWLLV LQS  EF S +LNRD W+NE+V + I  NFIFWQ   
Sbjct: 1   FFQGSFEDAKQEAKSEKKWLLVYLQSEDEFDSQVLNRDLWSNESVKEFIRENFIFWQCDI 60

Query: 224 DTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDG 276
           D+SEG++    YK+D  P + ++DP TG+ ++ W G + PE LL  L+ F++ 
Sbjct: 61  DSSEGQRFLQSYKVDKYPHIAIIDPRTGEVLKVWSGNITPEDLLSQLIEFLEE 113


Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), which is involved in the ubiquitin-proteosome pathway. Some members of this family are uncharacterized proteins containing only a UAS domain. Length = 114

>gnl|CDD|214737 smart00594, UAS, UAS domain Back     alignment and domain information
>gnl|CDD|216120 pfam00789, UBX, UBX domain Back     alignment and domain information
>gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like Back     alignment and domain information
>gnl|CDD|176362 cd01767, UBX, UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>gnl|CDD|197552 smart00166, UBX, Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>gnl|CDD|239289 cd02991, UAS_ETEA, UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 444
KOG1364356 consensus Predicted ubiquitin regulatory protein, 100.0
KOG1363460 consensus Predicted regulator of the ubiquitin pat 100.0
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 99.95
smart00594122 UAS UAS domain. 99.93
cd02990136 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 99.93
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.92
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 99.88
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 99.84
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 99.8
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 99.8
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 99.8
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 99.78
smart0016680 UBX Domain present in ubiquitin-regulatory protein 99.73
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 99.73
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 99.71
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 99.4
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 99.36
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 99.31
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 99.27
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 99.24
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.22
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.19
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.05
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.83
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.81
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.76
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.65
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.62
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 98.53
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 98.15
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.1
PRK10996139 thioredoxin 2; Provisional 98.09
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.07
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.06
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 98.05
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 98.05
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 97.9
COG4232569 Thiol:disulfide interchange protein [Posttranslati 97.89
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.88
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 97.86
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 97.81
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 97.78
PHA02278103 thioredoxin-like protein 97.75
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.72
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.72
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.67
cd0294793 TRX_family TRX family; composed of two groups: Gro 97.67
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 97.66
PRK09381109 trxA thioredoxin; Provisional 97.63
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 97.6
COG1331 667 Highly conserved protein containing a thioredoxin 97.57
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.54
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 97.53
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 97.52
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 97.51
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 97.42
PTZ0005198 thioredoxin; Provisional 97.4
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 97.4
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 97.37
KOG0907106 consensus Thioredoxin [Posttranslational modificat 97.36
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 97.34
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 97.28
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 97.24
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 97.24
TIGR02740271 TraF-like TraF-like protein. This protein is relat 97.23
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 97.2
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 97.19
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 97.18
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 97.16
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 97.14
PRK03147173 thiol-disulfide oxidoreductase; Provisional 97.12
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 97.11
PTZ00443224 Thioredoxin domain-containing protein; Provisional 97.11
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 97.09
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.08
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 97.05
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 97.01
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 96.98
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 96.94
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 96.93
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 96.93
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 96.8
TIGR02739256 TraF type-F conjugative transfer system pilin asse 96.76
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 96.69
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 96.68
PRK13703248 conjugal pilus assembly protein TraF; Provisional 96.64
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 96.61
cd02962152 TMX2 TMX2 family; composed of proteins similar to 96.58
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 96.56
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 96.54
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 96.54
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 96.52
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 96.49
PF13728215 TraF: F plasmid transfer operon protein 96.48
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 96.47
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 96.43
PTZ00102 477 disulphide isomerase; Provisional 96.35
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 96.28
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 96.26
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 96.26
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 96.23
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 96.17
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 96.1
PLN02309457 5'-adenylylsulfate reductase 96.01
PTZ00062204 glutaredoxin; Provisional 96.0
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 95.98
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 95.98
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 95.97
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 95.84
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 95.8
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.79
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 95.74
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 95.67
PTZ00102477 disulphide isomerase; Provisional 95.64
PTZ0004476 ubiquitin; Provisional 95.58
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 95.53
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 95.46
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 95.45
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 95.43
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 95.39
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 95.39
PRK13728181 conjugal transfer protein TrbB; Provisional 95.35
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 95.29
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 95.09
cd02967114 mauD Methylamine utilization (mau) D family; mauD 95.08
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 94.99
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 94.91
PTZ00056199 glutathione peroxidase; Provisional 94.9
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 94.85
PHA0212575 thioredoxin-like protein 94.85
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 94.81
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 94.77
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 94.65
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 94.39
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 94.3
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 94.14
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 94.06
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 94.04
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 94.0
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 93.91
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 93.88
PLN02412167 probable glutathione peroxidase 93.86
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 93.83
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 93.74
PRK15000200 peroxidase; Provisional 93.5
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 93.44
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 93.38
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 93.09
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 92.67
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 92.59
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 92.42
KOG2244 786 consensus Highly conserved protein containing a th 92.33
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 92.26
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 92.21
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 91.95
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 91.93
smart0054643 CUE Domain that may be involved in binding ubiquit 91.6
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 91.57
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 91.37
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 91.35
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 91.19
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 91.03
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 90.95
KOG4351244 consensus Uncharacterized conserved protein [Funct 90.9
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 90.78
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 90.66
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 90.54
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 90.08
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 90.05
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 90.04
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 89.71
PRK13190202 putative peroxiredoxin; Provisional 88.82
PRK06369115 nac nascent polypeptide-associated complex protein 88.72
PTZ00253199 tryparedoxin peroxidase; Provisional 88.67
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 87.54
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 87.38
PTZ00137261 2-Cys peroxiredoxin; Provisional 87.14
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 86.94
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 85.64
PRK13191215 putative peroxiredoxin; Provisional 85.44
PRK13189222 peroxiredoxin; Provisional 84.79
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 84.0
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 83.68
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 83.28
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 83.13
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 82.52
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 82.41
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 82.4
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 82.17
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 82.11
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 81.35
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 81.11
PRK10606183 btuE putative glutathione peroxidase; Provisional 80.99
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 80.97
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 80.47
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 80.25
PTZ00256183 glutathione peroxidase; Provisional 80.21
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.7e-43  Score=340.02  Aligned_cols=344  Identities=37%  Similarity=0.688  Sum_probs=243.5

Q ss_pred             cchHHHHHHhhcccccC-CCHHHHHHHHHHcCCCHHHHHHHHhcCCCCCCCCCCCCCCCccCCCCCCCCCCcccCCCCCC
Q 013379            7 ANDKQSMVSSFLEIAVG-QTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGD   85 (444)
Q Consensus         7 ~~~~~~~i~~F~~itt~-~~~~~A~~~L~~~~w~le~Av~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~   85 (444)
                      ..+...+|++||+| |+ ++.+.|++||++++|||+.||++||+..+.....++                        ..
T Consensus         3 ~~~~~~lv~~fl~I-t~~~t~e~A~q~L~~~~~~le~ai~Lffe~~~~~~~~s~------------------------~~   57 (356)
T KOG1364|consen    3 TGAQRALVSKFLAI-TVQQTVEIATQYLSAADWDLEAAINLFFEHGGFTQVYSS------------------------SS   57 (356)
T ss_pred             cchHHHHHHHHHHH-hccccHHHHHHHHHhcCCcHHHHHHHHHHhcccccccCC------------------------cc
Confidence            34456799999999 66 899999999999999999999999997654222110                        11


Q ss_pred             CCCCCCcccccccccCccccCCCCCCCCCCCCCccc-ccccchhhhcCCCcccCcCCCCCCCcchHHHHHhhcCCCccCc
Q 013379           86 EVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLI-AFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLM  164 (444)
Q Consensus        86 ~VraP~~~~~~~Lv~~~~~~~~~~~~~~~~~~~~~~-~~~~f~~e~~~~~~~~~~~~~~~~~~~~~~~l~~~f~pp~~~~  164 (444)
                      .+..|+++++++|+.+.   |.+  .  . .+.++. +-.          +|.+.    +...+...+|+++|+||+.|+
T Consensus        58 ~a~sp~~~~re~l~~~~---~~~--d--~-~~~s~~~p~~----------~~~~~----s~~~~~~srL~slfrpp~~i~  115 (356)
T KOG1364|consen   58 AAPSPIEPQREVLFDPL---GIM--D--Q-STSSILDPSE----------NQDDE----SEHASSQSRLASLFRPPTDIL  115 (356)
T ss_pred             cCCCcccccceeeeccc---ccc--c--c-CcccccCccc----------ccchh----hhhccccchhhhhcCCCcchh
Confidence            12238888899887642   100  0  0 001110 111          11111    112345678999999999999


Q ss_pred             ccCcHHHHHHHHHHcCCeEEEEEeCCCchhhHHHHhhccCChhHHHHHhcCEEEEEeecCChhHHHHHHHcCCCCCcEEE
Q 013379          165 FNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVL  244 (444)
Q Consensus       165 ~~gs~~~A~~~A~~~~K~LlVyl~~~~~~~~~~f~rdv~~~~~V~~~l~~~fV~w~~~~~s~eg~~~~~~y~~~~~P~l~  244 (444)
                      +.|+|++|+..|.++.+||||                                    ..++.||.++..+|++...|+|+
T Consensus       116 ~~gsld~ak~~a~sk~~wllV------------------------------------~~Dtseg~~~~~Fy~~~~~P~i~  159 (356)
T KOG1364|consen  116 SHGSLDAAKSTASSKQRWLLV------------------------------------LDDTSEGQPFSAFYHISSLPHIA  159 (356)
T ss_pred             hcCChhhhhhcccccceEEEE------------------------------------eeccCCCCchhhheeccCCceEE
Confidence            999999999999999999999                                    45678899999999999999999


Q ss_pred             EEeCCCCeeeEEEeCCCChHHHHHHHHhhhhcCCccccccccCCCCCCCCCCccccCCCCch-hHHHHHHHHHHHhHHHh
Q 013379          245 VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPD-IENEELLQALAASMETI  323 (444)
Q Consensus       245 ii~p~tg~~v~~~~G~~~~~~~l~~L~~~l~~~~~~~~~~l~~~r~~~~~~~~~~~~~~~~~-~qde~~~~al~~sl~~~  323 (444)
                      ||||+||+.|++|.|.+.+..|+..|..|++.+++++-+.+...|++...      +..-.. +|+.+++.++.+++-.-
T Consensus       160 iiDp~Tge~v~~ws~vi~~~~fl~~l~~Fi~~~~~d~vas~t~n~~~p~~------e~~~~ss~e~~~~elai~~sv~~~  233 (356)
T KOG1364|consen  160 IIDPITGERVKRWSGVIEPEQFLSDLNEFIDSCPHDEVASLTRNRKRPKT------EPTCLSSEEDMQMELAIKNSVVNP  233 (356)
T ss_pred             EECCchhhhhhhhccccCHHHHHHHHHHHHhcCCccccccccccccCCCC------CccccccccchhhhcccccccccC
Confidence            99999999999999999999999999999999998854444333322210      001112 46666677777666542


Q ss_pred             hcccCCCCCcccccCcch---hhhhhccCCCCCCCCCCCCC--CCCCceEEEEECCCCceEEEEeCCCCchHHHHHHHHh
Q 013379          324 KDASGVSSSDTDVASTDK---DEASATEKPAYPILPEEPKV--DRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYS  398 (444)
Q Consensus       324 ~~~~~~~ee~~~~~~~e~---~e~~~~~~~~~~~lp~EP~~--~~~~~~~i~iRlP~G~r~~rrF~~~~~l~~l~~fv~~  398 (444)
                      .-....+++- ...+++.   .++...   ..+.+..||..  +.+-+|+|+||||||+|.+|||..+++++.||.||.+
T Consensus       234 ~~~~e~e~~~-~s~~ee~e~~~e~~~~---~~~~a~~ep~~~~~~svvt~i~vR~pdG~R~qrkf~~sepv~ll~~~~~s  309 (356)
T KOG1364|consen  234 SSGTEFEGQG-ASDEEELETVLEEDLF---VFPVATVEPKGDCDRSVVTSIQVRFPDGRRKQRKFLKSEPVQLLWSFCYS  309 (356)
T ss_pred             CCcccccCCC-Ccccchhhcccccccc---ccceeeecCCCCCCccceeEEEEecCCccHHHHhhccccHHHHHHHHHHH
Confidence            2110100000 0000000   011111   12223233332  4456889999999999999999999999999999999


Q ss_pred             hcCCCCCcCeEEEcCCCCCcccCCCCcCCChhhcCCCCc--eEEEEeC
Q 013379          399 QLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANA--MISVTWE  444 (444)
Q Consensus       399 ~~~~~~~~~f~L~~~fPrr~~~l~~~~~~Tl~e~gL~~~--~v~v~~~  444 (444)
                      +.++++...|+|++.||++ ++|.++.+.||+++||.|+  .+.++|+
T Consensus       310 ~~dg~~k~~FkLv~a~P~~-k~l~~~~daT~~eaGL~nS~~~~~~e~e  356 (356)
T KOG1364|consen  310 HMDGSDKKRFKLVQAIPAS-KTLDYGADATFKEAGLANSETLLSVEWE  356 (356)
T ss_pred             hhcccccccceeeecccch-hhhhccccchHHHhccCccccccccccC
Confidence            9999999999999999976 6888889999999999998  5566663



>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>KOG4351 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
2dlx_A153 Solution Structure Of The Uas Domain Of Human Ubx D 9e-31
>pdb|2DLX|A Chain A, Solution Structure Of The Uas Domain Of Human Ubx Domain- Containing Protein 7 Length = 153 Back     alignment and structure

Iteration: 1

Score = 131 bits (329), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 58/133 (43%), Positives = 83/133 (62%), Gaps = 1/133 (0%) Query: 142 AASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRD 201 +S D LA L+RPP LM GSFE AK+ +Q+KWL++N+Q+ ++F+ LNRD Sbjct: 4 GSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRD 63 Query: 202 TWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMV 261 W+NEAV I +FIFWQVY D+ EG++ +YKL P V ++DP TGQK+ W + Sbjct: 64 VWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEW-HQL 122 Query: 262 QPESLLEDLVPFM 274 S L+ + F+ Sbjct: 123 DVSSFLDQVTGFL 135

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 1e-52
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 2e-16
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 7e-13
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 1e-09
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 2e-09
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 7e-08
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 7e-06
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 4e-05
2kuc_A130 Putative disulphide-isomerase; structural genomics 2e-04
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Back     alignment and structure
 Score =  173 bits (439), Expect = 1e-52
 Identities = 58/135 (42%), Positives = 83/135 (61%), Gaps = 1/135 (0%)

Query: 141 GAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNR 200
             +S  D     LA L+RPP  LM  GSFE AK+   +Q+KWL++N+Q+ ++F+   LNR
Sbjct: 3   SGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNR 62

Query: 201 DTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGM 260
           D W+NEAV   I  +FIFWQVY D+ EG++   +YKL   P V ++DP TGQK+  W  +
Sbjct: 63  DVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQL 122

Query: 261 VQPESLLEDLVPFMD 275
               S L+ +  F+ 
Sbjct: 123 -DVSSFLDQVTGFLG 136


>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Length = 109 Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Length = 127 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Length = 124 Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 178 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Length = 84 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Length = 109 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Length = 46 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 99.95
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.94
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 99.85
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 99.76
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 99.75
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 99.75
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 99.7
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 99.22
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 99.21
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 99.21
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 99.2
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.17
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.16
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.08
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.08
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 99.04
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 98.59
3ira_A173 Conserved protein; methanosarcina mazei,structural 98.99
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 98.89
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 98.84
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.51
2l57_A126 Uncharacterized protein; structural genomics, unkn 98.48
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 98.45
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 98.42
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 98.42
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 98.39
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 98.39
2yzu_A109 Thioredoxin; redox protein, electron transport, st 98.37
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 98.36
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 98.35
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 98.35
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 98.35
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 98.34
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 98.34
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.33
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 98.33
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 98.33
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 98.31
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 98.3
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 98.3
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 98.3
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 98.29
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.28
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 98.26
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 98.25
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 98.24
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 98.24
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 98.23
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 98.22
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 98.22
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 98.21
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 98.2
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 98.2
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 98.2
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 98.2
4euy_A105 Uncharacterized protein; structural genomics, PSI- 98.18
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 98.18
2l5l_A136 Thioredoxin; structural genomics, electron transpo 98.18
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 98.17
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 98.17
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.17
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 98.16
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 98.15
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 98.14
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 98.13
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 98.11
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 98.1
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 98.08
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 98.08
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 98.07
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.07
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 98.06
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.04
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.03
1zma_A118 Bacterocin transport accessory protein; alpha-beta 98.03
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.02
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.0
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.99
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 97.98
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.97
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 97.96
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 97.96
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 97.96
3raz_A151 Thioredoxin-related protein; structural genomics, 97.96
4evm_A138 Thioredoxin family protein; structural genomics, n 97.95
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 97.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.93
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 97.92
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 97.91
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 97.89
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.85
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.83
2qsi_A137 Putative hydrogenase expression/formation protein; 97.81
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 97.81
1mek_A120 Protein disulfide isomerase; electron transport, r 97.81
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 97.8
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 97.79
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 97.79
1wmj_A130 Thioredoxin H-type; structural genomics, program f 97.78
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 97.76
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 97.76
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 96.93
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 97.74
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 97.74
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 97.72
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 97.71
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 97.71
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 97.7
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 97.68
2l5o_A153 Putative thioredoxin; structural genomics, unknown 97.68
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 97.68
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 97.68
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 97.66
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.66
2lrn_A152 Thiol:disulfide interchange protein; structural ge 97.63
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 97.59
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 97.59
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 97.59
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 97.59
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 97.57
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.57
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 97.57
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 97.57
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 97.56
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.54
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 97.52
2lrt_A152 Uncharacterized protein; structural genomics, thio 97.52
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 97.51
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.51
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 97.47
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 97.44
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 97.42
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 97.41
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 97.4
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 97.36
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 97.36
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 97.32
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 97.32
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 97.31
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 97.31
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 97.3
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 97.28
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 97.27
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 97.27
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 97.21
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 97.21
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 97.21
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.19
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 97.18
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 97.11
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.08
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 97.08
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 97.03
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 97.03
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 97.03
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 96.96
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 96.94
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 96.92
2ywi_A196 Hypothetical conserved protein; uncharacterized co 96.92
2pjh_A80 Protein NPL4, nuclear protein localization protein 96.91
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 96.9
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.9
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 96.89
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 96.87
1wji_A63 Tudor domain containing protein 3; UBA domain, str 96.87
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 96.87
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 96.86
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 96.84
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 96.84
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 96.82
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 96.79
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 96.77
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 96.76
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 96.75
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 96.7
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 96.69
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 96.68
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 96.67
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 96.66
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 96.64
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 96.64
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 96.63
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 96.63
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 96.58
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 96.56
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 96.54
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 96.52
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 96.49
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 96.42
2l2d_A73 OTU domain-containing protein 7A; UBA fold, struct 96.42
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 96.42
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 96.38
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 96.35
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 96.32
3v6c_B91 Ubiquitin; structural genomics, structural genomic 96.32
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 96.31
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 96.3
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 96.3
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 96.29
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 96.26
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 96.25
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 96.24
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 96.24
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 96.21
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 96.14
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 96.13
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 96.12
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 96.12
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 96.1
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 96.05
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 96.02
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 95.99
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 95.99
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 95.98
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 95.95
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 95.94
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 95.93
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 95.92
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 95.87
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 95.83
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 95.83
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 95.82
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 95.77
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 95.77
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 95.75
2cwb_A108 Chimera of immunoglobulin G binding protein G and 95.74
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 95.73
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 95.71
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 95.7
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 95.68
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 95.68
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 95.65
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 95.64
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 95.59
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 95.56
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 95.51
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 95.49
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 95.48
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 95.46
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 95.46
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 95.44
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 95.39
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 95.36
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 95.36
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 95.35
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 95.32
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 95.25
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 95.23
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 95.21
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 95.2
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 95.15
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 95.15
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 95.13
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 95.1
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 95.09
2ls5_A159 Uncharacterized protein; structural genomics, unkn 94.09
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 95.02
2jsy_A167 Probable thiol peroxidase; solution structure, ant 95.01
2dna_A67 Unnamed protein product; ubiquitin associated doma 95.0
1we6_A111 Splicing factor, putative; structural genomics, ub 94.85
3me7_A170 Putative uncharacterized protein; electron transfe 94.8
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 94.78
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 94.77
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 93.78
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 94.75
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 94.71
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 94.67
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 94.66
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 94.66
3keb_A224 Probable thiol peroxidase; structural genomics, AP 94.65
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 94.6
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 94.56
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 94.53
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 94.51
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 94.47
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 94.47
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 94.46
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 94.45
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 94.44
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 94.44
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 94.42
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 94.42
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 94.41
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 94.39
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 94.31
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 94.31
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 94.27
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 94.25
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 94.24
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 94.18
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 94.16
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 94.14
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 94.05
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 93.9
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 93.77
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 93.76
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 93.75
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 93.73
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 93.73
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 93.72
3m62_B106 UV excision repair protein RAD23; armadillo-like r 93.69
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 93.68
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 93.59
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 93.58
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 93.52
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 93.48
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 93.45
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 93.45
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 93.27
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 93.27
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 93.25
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 93.25
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 93.22
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 93.21
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 93.16
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 93.03
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 92.98
1ttz_A87 Conserved hypothetical protein; structural genomic 92.86
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 92.84
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 92.83
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 92.81
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 92.8
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 92.78
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 92.73
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 92.59
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 92.58
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 92.48
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 92.26
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 92.24
1psq_A163 Probable thiol peroxidase; structural genomics, NY 92.21
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 92.2
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 92.2
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 92.1
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 92.02
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 91.93
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 91.83
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 91.69
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 91.47
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 91.38
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 91.36
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 91.34
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 91.25
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 90.5
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 91.14
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 90.77
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 90.6
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 90.47
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 90.25
4eo3_A322 Bacterioferritin comigratory protein/NADH dehydro; 90.1
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 89.82
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 89.68
2dhy_A67 CUE domain-containing protein 1; structural genomi 89.65
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 89.61
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 89.44
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 89.41
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 89.36
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 89.26
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 89.02
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 89.01
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 89.01
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 88.96
2lva_A129 Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi 88.49
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 88.77
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 88.63
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 88.62
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 88.27
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 88.18
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 87.92
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 87.7
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 87.19
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 86.87
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 86.84
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 86.63
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 86.2
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 85.74
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 85.7
2kj6_A97 Tubulin folding cofactor B; methods development, N 85.55
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 85.25
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 85.0
3pge_A 200 SUMO-modified proliferating cell nuclear antigen; 84.61
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 84.6
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 84.44
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 84.31
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 82.77
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 82.74
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 82.65
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 82.48
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 82.33
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 81.26
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 80.97
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 80.13
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 80.11
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=2.4e-28  Score=222.24  Aligned_cols=129  Identities=21%  Similarity=0.280  Sum_probs=120.2

Q ss_pred             HHHHHhhcCCCccCcccCcHHHHHHHH----HHcCCeEEEEEeCCCchhhHHHHhhccCChhHHHHHhcCEEEEEeecCC
Q 013379          150 RDNLASLYRPPFHLMFNGSFEKAKDAA----SVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDT  225 (444)
Q Consensus       150 ~~~l~~~f~pp~~~~~~gs~~~A~~~A----~~~~K~LlVyl~~~~~~~~~~f~rdv~~~~~V~~~l~~~fV~w~~~~~s  225 (444)
                      .+.|.++||++||.||+|+|++|++.|    ++++||||||||+++|++|+.||++||||+.|+++|++|||+|++++++
T Consensus        21 ~~~f~~~yg~~~p~F~~gs~~~Al~~A~~~~k~e~K~LlVyLhs~~~~~~~~f~~~~L~~~~V~~~l~~nfV~w~~dv~~  100 (178)
T 2ec4_A           21 TAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTK  100 (178)
T ss_dssp             HHHHHHHHCSCCCCCCCSCHHHHHHTTTSSCTTTCCEEEEEEECSSCSHHHHHHHHTTTCHHHHHHHHHTEEEEEEECCS
T ss_pred             HHHHHHHhCCCCCCeeeCCHHHHHHHHHhhhhhhCcEEEEEEeCCCCccHHHHHHHhcCCHHHHHHHHcCEEEEEEeCCC
Confidence            456889999999999999999999999    9999999999999999999999999999999999999999999999999


Q ss_pred             hh-------------HHHHHHH---cCCCCCcEEEEEeCCCC--eeeEEEeCCCChHHHHHHHHhhhhcCC
Q 013379          226 SE-------------GKKVCTY---YKLDSIPVVLVVDPITG--QKMRSWCGMVQPESLLEDLVPFMDGGP  278 (444)
Q Consensus       226 ~e-------------g~~~~~~---y~~~~~P~l~ii~p~tg--~~v~~~~G~~~~~~~l~~L~~~l~~~~  278 (444)
                      +|             |+.+++.   |++..||+++||+++.+  +++.++.|.+++++|++.|..+++.+.
T Consensus       101 ~e~~~~~~~~~~~~~g~~~a~~~~~~~~~~~P~l~ii~~~~~~~~vl~~~~G~~~~~~ll~~L~~~~e~~~  171 (178)
T 2ec4_A          101 DSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFT  171 (178)
T ss_dssp             HHHHHHHHHHHHHHTCHHHHHHHHHSCSTTCSEEEEECCCSSCCCEEEEECSCCCHHHHHHHHHHHHHHHH
T ss_pred             chhhhhhhhhhhhhhHHHHHHHHhhcCCCCCCeEEEEEcCCCceEEEEEEeCCCCHHHHHHHHHHHHHHhh
Confidence            99             5667765   89999999999998744  578999999999999999999999774



>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 444
d2dlxa1147 c.47.1.24 (A:1-147) UBX domain-containing protein 8e-33
d2cr5a196 d.15.1.2 (A:8-103) UBX domain-containing protein 6 7e-13
d1i42a_89 d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 1e-12
d1wj4a_124 d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human 2e-10
d1h8ca_82 d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human 3e-09
d1v92a_46 a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- 2e-08
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: UAS domain
domain: UBX domain-containing protein 7
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  119 bits (298), Expect = 8e-33
 Identities = 61/156 (39%), Positives = 89/156 (57%), Gaps = 11/156 (7%)

Query: 141 GAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNR 200
             +S  D     LA L+RPP  LM  GSFE AK+   +Q+KWL++N+Q+ ++F+   LNR
Sbjct: 3   SGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNR 62

Query: 201 DTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGM 260
           D W+NEAV   I  +FIFWQVY D+ EG++   +YKL   P V ++DP TGQK+  W   
Sbjct: 63  DVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEW-HQ 121

Query: 261 VQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTT 296
           +   S L+ +  F+            H +  G S++
Sbjct: 122 LDVSSFLDQVTGFLG----------EHGQLDGLSSS 147


>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.96
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 99.84
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.8
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 99.74
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 99.69
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 99.5
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.99
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 98.96
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 98.65
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.63
d1s3si_50 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.6
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.46
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 98.45
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.42
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.42
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 98.37
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 98.35
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 98.26
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.22
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 98.19
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.13
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.06
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 98.04
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.92
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 97.91
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 97.82
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 97.77
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 97.62
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 97.58
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 97.54
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 97.52
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 97.47
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 97.43
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 97.35
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 97.32
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 97.31
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 97.23
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 97.14
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 97.07
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.06
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 96.95
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 96.91
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.82
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 96.8
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 96.76
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 96.7
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 96.67
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 96.62
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 96.61
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 96.54
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 96.53
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 96.27
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 96.26
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 96.26
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 96.21
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 96.21
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 96.21
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 96.2
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 96.13
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 95.91
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 95.87
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 95.83
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 95.72
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 95.6
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 95.6
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 95.54
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 95.48
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 95.48
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 95.42
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 95.41
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 95.41
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 95.2
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 95.19
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 94.95
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 94.88
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 94.76
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 94.67
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 94.58
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 94.35
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 94.15
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.09
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 94.02
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 93.8
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 93.69
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 93.65
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.64
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 93.55
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 93.22
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 93.22
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 93.14
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 93.0
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 92.99
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 92.95
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 92.9
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 92.82
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 92.81
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 92.76
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 92.41
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 92.39
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 92.3
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 92.18
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 92.18
d1wjka_100 Thioredoxin-like structure containing protein C330 92.03
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 91.76
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 91.75
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 91.66
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 91.62
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 91.26
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 91.13
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 90.3
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 90.27
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 89.34
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 88.95
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 88.95
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 88.59
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 88.14
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 87.84
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 87.51
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 87.47
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 87.45
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 86.59
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 84.56
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 84.29
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 84.27
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 84.26
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 83.57
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 83.25
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 83.09
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 82.95
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 82.91
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 82.81
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: UAS domain
domain: UBX domain-containing protein 7
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=3.3e-29  Score=219.22  Aligned_cols=130  Identities=43%  Similarity=0.865  Sum_probs=123.0

Q ss_pred             chHHHHHhhcCCCccCcccCcHHHHHHHHHHcCCeEEEEEeCCCchhhHHHHhhccCChhHHHHHhcCEEEEEeecCChh
Q 013379          148 SSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVYDDTSE  227 (444)
Q Consensus       148 ~~~~~l~~~f~pp~~~~~~gs~~~A~~~A~~~~K~LlVyl~~~~~~~~~~f~rdv~~~~~V~~~l~~~fV~w~~~~~s~e  227 (444)
                      .+..+|+++|+||++++|.|+|++|++.|++++||||||+|+++|+.|+.|+++||+|+.|+++++++||+|+++.++.+
T Consensus        10 ~~~~~~a~~~~pp~~i~~~~~~~~A~~~Ak~~~K~llV~~~~~~C~~C~~m~~~v~~d~~V~~~l~~~fV~~~v~~~~~e   89 (147)
T d2dlxa1          10 KKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEE   89 (147)
T ss_dssp             CCCCCCCCTTSCCTTTSCCSCHHHHHHHHHHHTCEEEEEEECSCTTTHHHHHHHTTTCHHHHHHHHHTEEEEEEESSSHH
T ss_pred             cchHHHHHhhCCCccccccCCHHHHHHHHHHcCCcEEEEEecCCCCchHHHHHhccCCHHHHHHHhhheeEeeecccchh
Confidence            33445899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCCCcEEEEEeCCCCeeeEEEeCCCChHHHHHHHHhhhhcCC
Q 013379          228 GKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGP  278 (444)
Q Consensus       228 g~~~~~~y~~~~~P~l~ii~p~tg~~v~~~~G~~~~~~~l~~L~~~l~~~~  278 (444)
                      |..+++.|++..||+++||+|++|++++.| |.+++++|+..|..|++.+.
T Consensus        90 ~~~~~~~y~v~~~Pti~~idp~~ge~v~~~-~~~~~~~fl~~L~~fl~~~~  139 (147)
T d2dlxa1          90 GQRYIQFYKLGDFPYVSILDPRTGQKLVEW-HQLDVSSFLDQVTGFLGEHG  139 (147)
T ss_dssp             HHHHHHHHTCCSSSEEEEECTTTCCCCEEE-SSCCHHHHHHHHHHHHHHTC
T ss_pred             hhhhhhheecCceeEEEEEeCCCCeEeccc-CCCCHHHHHHHHHHHHhhCC
Confidence            999999999999999999999999998777 55899999999999999774



>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure