Citrus Sinensis ID: 013423

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
cccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHcccccEEEEcccccccHHHHHHHHccccccEEEccccccccHHHHHHccccccccEEEccccccccHHHHHHHHccccccEEEcccccccHHHHHHHcccccccEEEccccccccHHHHHccccccccEEEccccccccHHHHHHcccccccEEEcccccccccccccccccccccccccccccHHHHccHHHccccccccEEEccccccccccHHHccccccccEEEcccccccHHHHHHHHccccccEEEccccccccHHHHcccccccccEEEccccccccHHHHHHHHHcccccEEEcccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccc
ccccccHHHHHHHHHHHHHcHHHHHHHHHHHccHccccHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHEcccccccccHHHHHHHHccHcccEEcccccccccHHHHHHHcccccccEEEccccccccHHHHHHHHccccccEEEcccccccHHHHHHHHccccccEEEcccccccHHHHHHHHccccccEEEcccccccHHHHHHHHHcccccccccccccHHHHcccccccEEEcccccccccccHHHHHHHHHHcHHcccEEccccccccHHHHHHHHccccccEEEcccccccHHHHHHHHccccccEEEcccccccHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccEEEEcccccccccccccccccccHHHccccHHHcccccccccccHHHHHHcccHHHHHHHHHccccccccccccHHHHcccc
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIElrgensvdAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTgmtclkeldlsrcvkVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLqnlsvldlgglpvtDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKmfprlsflnlawtgvtklpnissleclNLSFIQQVGAETDLVLSLTALQNLNHLERLnleqtqvsdatlfplstFKELIHLSLrnasltdvslhqlsslskltnlsirdavltnsglgsfkpprslklldlhggwllTEDAILQFCKMHPRIEVWHELSvicpsdqigsngpspsrtSLRASLVkqkqdpmpmshsfLDQRLKYSREELLELQYSSlslarpddsstqdamglr
MERERESELVRLCIEaacqsgesvqkWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIelrgensvdAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTnsglgsfkppRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLvkqkqdpmpmsHSFLDQRLKYSREELLELQysslslarpddsstqdamglr
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSllrhlirrrliFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSlklldlhggwllTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSReellelqysslslARPDDSSTQDAMGLR
********LVRLCIEAACQSG**VQKW******LERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICP***********************************************************************
*****ES*LVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSD*************LR**********MPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
*********VRLCIEAACQ***********RRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQ*************************PMSHSFLDQRLKYSREELLELQYSSLSL***************
*****ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLV*QKQDPMPMSHSFLDQRLKYSREELLELQYS*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query443 2.2.26 [Sep-21-2011]
Q8NEE6735 F-box/LRR-repeat protein yes no 0.598 0.360 0.272 6e-09
A6H779423 F-box/LRR-repeat protein yes no 0.715 0.749 0.284 2e-08
P0DJM0 800 Internalin-A OS=Listeria yes no 0.458 0.253 0.306 2e-07
Q723K6 800 Internalin-A OS=Listeria yes no 0.458 0.253 0.297 2e-07
G2K3G6 800 Internalin-A OS=Listeria yes no 0.458 0.253 0.306 3e-07
Q9UKC9423 F-box/LRR-repeat protein no no 0.713 0.747 0.271 3e-07
P34284466 Uncharacterized F-box/LRR yes no 0.661 0.628 0.267 3e-07
Q5R3Z8423 F-box/LRR-repeat protein no no 0.713 0.747 0.271 4e-07
Q8BH16423 F-box/LRR-repeat protein yes no 0.713 0.747 0.274 4e-07
Q8YA32 1778 Internalin-I OS=Listeria no no 0.584 0.145 0.229 1e-06
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 136/286 (47%), Gaps = 21/286 (7%)

Query: 89  FRYLRSLNVADCRRVTSSALWALT-GMTCLK--ELDLSRCVKVTDAGMKHLL-SISTLEK 144
           F  L++L++A CRR T   L  L  G  C K   LDLS C +++  G +++  S + +  
Sbjct: 295 FHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMH 354

Query: 145 LWLSETGLTADGI--ALLSSLQNLSVLDLGGLP-VTDLVLRSLQVLTKLEYLDLWGSQ-V 200
           L +++     D    AL+     ++ L   G P ++D   R+L    KL  +   G++ V
Sbjct: 355 LTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRALSA-CKLRKIRFEGNKRV 413

Query: 201 SNRGAAVL-KMFPRLSFLNLA-WTGVT-----KLPNISSLECLNLSFIQQVGAETDLVLS 253
           ++     + K +P LS + +A   G+T      L  +  L  LNL+   ++G +  L   
Sbjct: 414 TDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIG-DMGLKQF 472

Query: 254 LTALQNLNHLERLNLEQ-TQVSDATLFPLST-FKELIHLSLRNAS-LTDVSLHQLSSLSK 310
           L    ++  +  LNL    ++SDA++  LS     L +LSLRN   LT   +  + ++  
Sbjct: 473 LDGPASM-RIRELNLSNCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFS 531

Query: 311 LTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCK 356
           L ++ +    ++N GL      + LK L +   + +T+D I  FCK
Sbjct: 532 LVSIDLSGTDISNEGLNVLSRHKKLKELSVSECYRITDDGIQAFCK 577
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Homo sapiens (taxid: 9606)
>sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 Back     alignment and function description
>sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 Back     alignment and function description
>sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3 Back     alignment and function description
>sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description
>sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
255537779 597 protein binding protein, putative [Ricin 0.731 0.542 0.591 1e-95
297742329 588 unnamed protein product [Vitis vinifera] 0.724 0.545 0.547 4e-91
225426352 598 PREDICTED: uncharacterized protein LOC10 0.724 0.536 0.547 4e-91
449464060 586 PREDICTED: uncharacterized protein LOC10 0.803 0.607 0.508 3e-90
356513289 589 PREDICTED: uncharacterized protein LOC10 0.731 0.550 0.539 2e-87
297803756 590 hypothetical protein ARALYDRAFT_492485 [ 0.726 0.545 0.507 5e-82
186701224 600 leucine-rich repeat family protein [Arab 0.726 0.536 0.507 4e-75
218196286 601 hypothetical protein OsI_18882 [Oryza sa 0.756 0.557 0.476 2e-74
242089917 608 hypothetical protein SORBIDRAFT_09g00665 0.717 0.523 0.467 1e-73
42567079 597 leucine-rich repeat-containing protein [ 0.726 0.539 0.498 4e-73
>gi|255537779|ref|XP_002509956.1| protein binding protein, putative [Ricinus communis] gi|223549855|gb|EEF51343.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  356 bits (914), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 255/343 (74%), Gaps = 19/343 (5%)

Query: 4   ERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVF 63
           E ES+LVRLCIEAAC+S ES+ KWRRQRR+LERLP+ LAD LLR L+ RRL+FPSLLEVF
Sbjct: 2   ETESQLVRLCIEAACESRESIDKWRRQRRTLERLPSPLADILLRRLLHRRLLFPSLLEVF 61

Query: 64  KHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLS 123
           K + E ++LRGEN+VDAEWMAYLGAFRYLR LN+ADC ++TSSALW+LTGMT LKELDLS
Sbjct: 62  KQSVEVVDLRGENAVDAEWMAYLGAFRYLRYLNLADCNKITSSALWSLTGMTSLKELDLS 121

Query: 124 RCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRS 183
           R VKVTDAG++HLLSIS+LE L + ETGLTA G+ALL+SL NLSVLDLGGLPVTD+ L S
Sbjct: 122 RSVKVTDAGIRHLLSISSLEILRIPETGLTAKGVALLTSLTNLSVLDLGGLPVTDMALSS 181

Query: 184 LQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNL----- 238
           LQVLTKLEYLDLWGS +SN G AVL++FP+LSFLNL WT VT+LP++ SLE LNL     
Sbjct: 182 LQVLTKLEYLDLWGSNISNNGVAVLQLFPKLSFLNLGWTSVTRLPSMLSLEYLNLSNCTI 241

Query: 239 -SFIQQVGAE-----TDLVLSLTALQN----LNHLERLNLEQTQVSDATL---FPLSTFK 285
            S ++  G       T ++LS     N      ++E   L    VS+++L   + L   K
Sbjct: 242 ESLLEGDGDGDKAPLTKVILSGATFPNEAEAFYNIEPRFLSFLDVSNSSLQGFYFLHDMK 301

Query: 286 ELIHLSLRNASLTDVSLHQLSSL-SKLTNLSIRDAVLTNSGLG 327
            L HL L +  + D ++  ++ + + LTNL++    +T++GL 
Sbjct: 302 MLEHLDLSSTMMGDDAIEAVACIGANLTNLNLSKTRVTSAGLA 344

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742329|emb|CBI34478.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225426352|ref|XP_002266070.1| PREDICTED: uncharacterized protein LOC100261612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449464060|ref|XP_004149747.1| PREDICTED: uncharacterized protein LOC101203036 [Cucumis sativus] gi|449505065|ref|XP_004162366.1| PREDICTED: uncharacterized protein LOC101225004 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513289|ref|XP_003525346.1| PREDICTED: uncharacterized protein LOC100814174 [Glycine max] Back     alignment and taxonomy information
>gi|297803756|ref|XP_002869762.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] gi|297315598|gb|EFH46021.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186701224|gb|ACC91251.1| leucine-rich repeat family protein [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|218196286|gb|EEC78713.1| hypothetical protein OsI_18882 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242089917|ref|XP_002440791.1| hypothetical protein SORBIDRAFT_09g006650 [Sorghum bicolor] gi|241946076|gb|EES19221.1| hypothetical protein SORBIDRAFT_09g006650 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|42567079|ref|NP_194115.3| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|20466546|gb|AAM20590.1| unknown protein [Arabidopsis thaliana] gi|22136448|gb|AAM91302.1| unknown protein [Arabidopsis thaliana] gi|51971383|dbj|BAD44356.1| putative protein [Arabidopsis thaliana] gi|332659411|gb|AEE84811.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
TAIR|locus:2138131 597 AT4G23840 "AT4G23840" [Arabido 0.697 0.517 0.515 3.9e-76
TAIR|locus:2036199585 AT1G15740 [Arabidopsis thalian 0.548 0.415 0.333 3.6e-21
DICTYBASE|DDB_G0291424 902 DDB_G0291424 "Transcription fa 0.702 0.344 0.243 1.2e-11
UNIPROTKB|F1NHD2423 FBXL2 "Uncharacterized protein 0.530 0.555 0.304 2e-10
UNIPROTKB|F1PWK1422 FBXL2 "Uncharacterized protein 0.530 0.556 0.300 7.2e-10
UNIPROTKB|Q9UKC9423 FBXL2 "F-box/LRR-repeat protei 0.530 0.555 0.300 9.3e-10
UNIPROTKB|Q5R3Z8423 FBXL2 "F-box/LRR-repeat protei 0.530 0.555 0.300 9.3e-10
UNIPROTKB|A6H779423 FBXL2 "F-box/LRR-repeat protei 0.534 0.560 0.303 9.3e-10
RGD|1562243422 Fbxl2 "F-box and leucine-rich 0.530 0.556 0.304 2.6e-09
MGI|MGI:1919429423 Fbxl2 "F-box and leucine-rich 0.530 0.555 0.304 2.6e-09
TAIR|locus:2138131 AT4G23840 "AT4G23840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 767 (275.1 bits), Expect = 3.9e-76, P = 3.9e-76
 Identities = 162/314 (51%), Positives = 218/314 (69%)

Query:     6 ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSXXXXXXXXXXXFPSLLEVFKH 65
             ES LVRLC++ AC+SG++V++WR QRRSLE LP HLAD+           FPSLLE FK+
Sbjct:     2 ESPLVRLCLKEACKSGDAVERWRLQRRSLESLPPHLADALLRRLLKKRLLFPSLLEGFKY 61

Query:    66 NAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRC 125
             + E I+LRG++SV+AEWMAY+G F  L +LN++DC+R+ SS LW +TG+T L ELDLSRC
Sbjct:    62 SVENIDLRGKSSVNAEWMAYIGGFVNLITLNLSDCQRINSSTLWPITGLTSLTELDLSRC 121

Query:   126 VKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQ 185
              KVTDAGMKHL S+  L+KLW+S+TG+T  GI+LL+SL+ LS+LDLGGLPVTD  L SLQ
Sbjct:   122 FKVTDAGMKHLQSVVNLKKLWISQTGVTEVGISLLASLKKLSLLDLGGLPVTDQNLISLQ 181

Query:   186 VLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVG 245
              LTKLEYLD+WGS V+N+GA  +  F  LSFLNL+WT +T+ PNI  LECL+++    V 
Sbjct:   182 ALTKLEYLDIWGSNVTNQGAVSILKFSNLSFLNLSWTSITQTPNIPHLECLHMNTCTIV- 240

Query:   246 AETDLVLSLTALQNLNHLERLNLE-QTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQ 304
             +E     SL +L+ L  L   N   +T+    T     T+ ++   SL+N S  + ++  
Sbjct:   241 SEPKTHSSLASLKKLV-LSGANFSAETESLSFTNKSCITYLDVSKTSLKNFSFLE-TMFN 298

Query:   305 LSSLSKLTNLSIRD 318
             L  L  L++ +  D
Sbjct:   299 LEHLD-LSSTAFGD 311
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2036199 AT1G15740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291424 DDB_G0291424 "Transcription factor SKN7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score = 44.5 bits (105), Expect = 9e-05
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 15/168 (8%)

Query: 138 SISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWG 197
           SI  LE L LS   L+ +    + S  +L VLDLGG  +   +  SL  LT LE+L L  
Sbjct: 138 SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLAS 197

Query: 198 SQVSNRGAAVLKMFPRLSFLNLAWTGVT-KLPN----ISSLECLNLSFIQQVGAETDLVL 252
           +Q+  +    L     L ++ L +  ++ ++P     ++SL  L+L +    G       
Sbjct: 198 NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIP---- 253

Query: 253 SLTALQNLNHLERLNLEQTQVSDATLFPLSTF--KELIHLSLRNASLT 298
             ++L NL +L+ L L Q ++S     P S F  ++LI L L + SL+
Sbjct: 254 --SSLGNLKNLQYLFLYQNKLSGP--IPPSIFSLQKLISLDLSDNSLS 297

Length = 968
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 443
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.74
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
KOG4237498 consensus Extracellular matrix protein slit, conta 99.63
KOG4341483 consensus F-box protein containing LRR [General fu 99.62
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.29
KOG4341483 consensus F-box protein containing LRR [General fu 99.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.8
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.8
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.69
PLN03150623 hypothetical protein; Provisional 98.67
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.63
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.55
PLN03150623 hypothetical protein; Provisional 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.49
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.48
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.47
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.44
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.16
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
PRK15386426 type III secretion protein GogB; Provisional 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
PRK15386426 type III secretion protein GogB; Provisional 97.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.48
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.17
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.13
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.1
KOG4308478 consensus LRR-containing protein [Function unknown 97.07
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.97
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
KOG4308478 consensus LRR-containing protein [Function unknown 96.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.78
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.43
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.25
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.08
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.38
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.99
smart0037026 LRR Leucine-rich repeats, outliers. 86.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.09
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.3e-35  Score=312.76  Aligned_cols=347  Identities=20%  Similarity=0.166  Sum_probs=167.9

Q ss_pred             CccEEEecCCCCCCHHHHHHhcCCCCCcEEeecCCCCCChHHHHhccCCCCCcEEecCCCCCCCHHHHHHhhCCCCCcEE
Q 013423           66 NAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKL  145 (443)
Q Consensus        66 ~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~l~~~~~~~~~~l~~L~~L  145 (443)
                      +|++|++++|. +....+..++.+++|++|++++|. +....+..+.++++|++|++++| .+++..+..+..+++|++|
T Consensus       165 ~L~~L~L~~n~-l~~~~p~~~~~l~~L~~L~L~~n~-l~~~~p~~l~~l~~L~~L~L~~n-~l~~~~p~~l~~l~~L~~L  241 (968)
T PLN00113        165 SLKVLDLGGNV-LVGKIPNSLTNLTSLEFLTLASNQ-LVGQIPRELGQMKSLKWIYLGYN-NLSGEIPYEIGGLTSLNHL  241 (968)
T ss_pred             CCCEEECccCc-ccccCChhhhhCcCCCeeeccCCC-CcCcCChHHcCcCCccEEECcCC-ccCCcCChhHhcCCCCCEE
Confidence            56666666653 333444555556666666666555 43334445555555666666555 3443334455555555555


Q ss_pred             EcccccCCHHHHHHhcCCCCCCEEEecCCCCChhhHHhccCCCCccEEEecCCCCCchhhHhhcCCCCCCEEEcCCCCCC
Q 013423          146 WLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVT  225 (443)
Q Consensus       146 ~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~  225 (443)
                      ++++|.+.+..|..++++++|++|++++|.+.+..+..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.
T Consensus       242 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~  321 (968)
T PLN00113        242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT  321 (968)
T ss_pred             ECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC
Confidence            55555555444555555555555555555555444444555555555555555555455555555555555555555443


Q ss_pred             C-----CCCCCCCCEEecccccccCCchhhhhhHHHhccCCCCCEEEcCCCCC------------------------Cch
Q 013423          226 K-----LPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQV------------------------SDA  276 (443)
Q Consensus       226 ~-----l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~l------------------------~~~  276 (443)
                      +     +..+++|+.|++++|.+.+.    +|  ..+..+++|+.|++++|.+                        .+.
T Consensus       322 ~~~~~~~~~l~~L~~L~L~~n~l~~~----~p--~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~  395 (968)
T PLN00113        322 GKIPVALTSLPRLQVLQLWSNKFSGE----IP--KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGE  395 (968)
T ss_pred             CcCChhHhcCCCCCEEECcCCCCcCc----CC--hHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEeccc
Confidence            2     22344444444444444322    22  2333333333333333333                        333


Q ss_pred             hhhcccCCCCCCEEEeeCCCCChHHHHHhcCCCCCCEEEecCcccCchhhhhcCCCCCCCEEeccCCCC-----------
Q 013423          277 TLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWL-----------  345 (443)
Q Consensus       277 ~~~~l~~~~~L~~L~l~~n~i~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~l~~~~~L~~L~l~~n~~-----------  345 (443)
                      .|..+..+++|+.|++++|++++..|..+..+++|+.|++++|.+++..+..+..+++|+.|++++|+.           
T Consensus       396 ~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~  475 (968)
T PLN00113        396 IPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSK  475 (968)
T ss_pred             CCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccc
Confidence            333333344444444444444433333444444444444444444433333333333344443333331           


Q ss_pred             -----------CCHHHHHHHHHhCCCceeeeeecccCCCCCCCCCCCCCCchhhhhhh------hhhcCCCCCCChhhHH
Q 013423          346 -----------LTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASL------VKQKQDPMPMSHSFLD  408 (443)
Q Consensus       346 -----------l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~~p~~~~~l~~L------~n~l~~~~p~~~~~ld  408 (443)
                                 ++...+..+ ..++.++..       .+.+|.+.+.+|+.+..++.|      +|.+++.+|..     
T Consensus       476 ~L~~L~ls~n~l~~~~~~~~-~~l~~L~~L-------~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~-----  542 (968)
T PLN00113        476 RLENLDLSRNQFSGAVPRKL-GSLSELMQL-------KLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPAS-----  542 (968)
T ss_pred             cceEEECcCCccCCccChhh-hhhhccCEE-------ECcCCcceeeCChHHcCccCCCEEECCCCcccccCChh-----
Confidence                       111111111 111222111       133455555666655555554      55666666666     


Q ss_pred             hhhhhcHHHHHHhhcccccccCCCCCc
Q 013423          409 QRLKYSREELLELQYSSLSLARPDDSS  435 (443)
Q Consensus       409 ~~~~l~~L~~L~l~~n~~~~~~p~~~~  435 (443)
                       +..+++|+.||+++|.++|.+|....
T Consensus       543 -~~~l~~L~~L~Ls~N~l~~~~p~~l~  568 (968)
T PLN00113        543 -FSEMPVLSQLDLSQNQLSGEIPKNLG  568 (968)
T ss_pred             -HhCcccCCEEECCCCcccccCChhHh
Confidence             55677777777777777777776543

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-09
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-09
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-09
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 5e-09
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-09
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-08
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-08
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 5e-05
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 7e-05
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 120/223 (53%), Gaps = 18/223 (8%)
Query: 89  FRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLS 148
            + L +LN  +    T S + AL+G+T L++L+ S   +VTD  +K L +++TLE+L +S
Sbjct: 125 LKNLTNLNRLELSSNTISDISALSGLTSLQQLNFSSN-QVTD--LKPLANLTTLERLDIS 181
Query: 149 ETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVL 208
              ++   I++L+ L NL  L      ++D+    L +LT L+ L L G+Q+ + G   L
Sbjct: 182 SNKVS--DISVLAKLTNLESLIATNNQISDIT--PLGILTNLDELSLNGNQLKDIGT--L 235
Query: 209 KMFPRLSFLNLAWTGVTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNL 268
                L+ L+LA   ++ L  +S L  L      ++    + + +++ L  L  L  L L
Sbjct: 236 ASLTNLTDLDLANNQISNLAPLSGLTKL-----TELKLGANQISNISPLAGLTALTNLEL 290
Query: 269 EQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKL 311
            + Q+ D  + P+S  K L +L+L   +++D+S   +SSL+KL
Sbjct: 291 NENQLED--ISPISNLKNLTYLTLYFNNISDIS--PVSSLTKL 329
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-17
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-16
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-17
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-17
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-13
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 6e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-04
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
 Score = 96.3 bits (239), Expect = 2e-21
 Identities = 50/238 (21%), Positives = 103/238 (43%), Gaps = 27/238 (11%)

Query: 108 LWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLS 167
           ++         + +L +   VTD        +++++++  + + + +  +  +  L N++
Sbjct: 14  IFPDDAFAETIKDNLKKK-SVTD--AVTQNELNSIDQIIANNSDIKS--VQGIQYLPNVT 68

Query: 168 VLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKL 227
            L L G  +TD+  + L  L  L +L L  +++ +   + LK   +L  L+L   G++ +
Sbjct: 69  KLFLNGNKLTDI--KPLTNLKNLGWLFLDENKIKD--LSSLKDLKKLKSLSLEHNGISDI 124

Query: 228 PNISS---LECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTF 284
             +     LE L L   +        +  +T L  L  L+ L+LE  Q+SD  + PL+  
Sbjct: 125 NGLVHLPQLESLYLGNNK--------ITDITVLSRLTKLDTLSLEDNQISD--IVPLAGL 174

Query: 285 KELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKP---PRSLKLLD 339
            +L +L L    ++D+    L+ L  L  L +      N  +        P ++K  D
Sbjct: 175 TKLQNLYLSKNHISDLR--ALAGLKNLDVLELFSQECLNKPINHQSNLVVPNTVKNTD 230
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.62
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.51
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.25
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.18
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.95
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.93
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.93
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.9
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.81
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.99
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.3e-38  Score=326.06  Aligned_cols=346  Identities=19%  Similarity=0.194  Sum_probs=211.2

Q ss_pred             CccEEEecCCCCCCHHHHHHhcCCCCCcEEeecCCCCCC-hHHHHhccCCCCCcEEecCCCCCCCHHHHHHhhCCC-CCc
Q 013423           66 NAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVT-SSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSIS-TLE  143 (443)
Q Consensus        66 ~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~-~~~~~~l~~~~~L~~L~l~~~~~l~~~~~~~~~~l~-~L~  143 (443)
                      +|++|++++|. +....+..++.+++|++|++++|. +. ......+.++++|++|++++| .+++..+..+..++ +|+
T Consensus       295 ~L~~L~Ls~n~-l~~~~p~~~~~l~~L~~L~L~~n~-l~~~ip~~~l~~l~~L~~L~Ls~n-~l~~~~p~~l~~l~~~L~  371 (768)
T 3rgz_A          295 TLTGLDLSGNH-FYGAVPPFFGSCSLLESLALSSNN-FSGELPMDTLLKMRGLKVLDLSFN-EFSGELPESLTNLSASLL  371 (768)
T ss_dssp             TCSEEECCSSE-EEECCCGGGGGCTTCCEEECCSSE-EEEECCHHHHTTCTTCCEEECCSS-EEEECCCTTHHHHTTTCS
T ss_pred             cCCEEECcCCc-CCCccchHHhcCCCccEEECCCCc-ccCcCCHHHHhcCCCCCEEeCcCC-ccCccccHHHHhhhcCCc
Confidence            44444444442 222233344444555555555444 22 212222444455555555544 23222222333333 455


Q ss_pred             EEEcccccCCHHHHHHhcC--CCCCCEEEecCCCCChhhHHhccCCCCccEEEecCCCCCchhhHhhcCCCCCCEEEcCC
Q 013423          144 KLWLSETGLTADGIALLSS--LQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAW  221 (443)
Q Consensus       144 ~L~l~~~~~~~~~~~~l~~--l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~  221 (443)
                      +|++++|.+.+..+..+..  +++|++|++++|.+++..+..+..+++|++|++++|.+.+..|..++.+++|+.|++++
T Consensus       372 ~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~  451 (768)
T 3rgz_A          372 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL  451 (768)
T ss_dssp             EEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             EEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCC
Confidence            5555555444433333333  55666677766666655566667777777777777777666677777777777777777


Q ss_pred             CCCCC-----CCCCCCCCEEecccccccCCchhhhhhHHHhccCCCCCEEEcCCCCCCchhhhcccCCCCCCEEEeeCCC
Q 013423          222 TGVTK-----LPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNAS  296 (443)
Q Consensus       222 ~~l~~-----l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~n~  296 (443)
                      |.+.+     +..+++|+.|++++|.+.+.    +|  ..+..+++|++|++++|.+++..|.+++.+++|+.|++++|+
T Consensus       452 n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~----~p--~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~  525 (768)
T 3rgz_A          452 NMLEGEIPQELMYVKTLETLILDFNDLTGE----IP--SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNS  525 (768)
T ss_dssp             SCCCSCCCGGGGGCTTCCEEECCSSCCCSC----CC--GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC
T ss_pred             CcccCcCCHHHcCCCCceEEEecCCcccCc----CC--HHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCc
Confidence            77663     33567777777777776653    45  556677777777777777777777777777777777777777


Q ss_pred             CChHHHHHhcCCCCCCEEEecCcccCchhhhhc-----------------------------------------------
Q 013423          297 LTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSF-----------------------------------------------  329 (443)
Q Consensus       297 i~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~l-----------------------------------------------  329 (443)
                      +++.+|..+..+++|+.|++++|++++..|..+                                               
T Consensus       526 l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  605 (768)
T 3rgz_A          526 FSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN  605 (768)
T ss_dssp             CEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGG
T ss_pred             ccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhh
Confidence            776777777777777777777777664433322                                               


Q ss_pred             -----------------------CCCCCCCEEeccCCCCCCHHHHHHHHHhCCCceeeeeecccCCCCCCCCCCCCCCch
Q 013423          330 -----------------------KPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRT  386 (443)
Q Consensus       330 -----------------------~~~~~L~~L~l~~n~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~~p~~~  386 (443)
                                             ..+++|+.|++++|+ +++..+.. ...++.++.. .      +.+|.++|.+|+.|
T Consensus       606 ~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~-l~g~ip~~-l~~l~~L~~L-~------Ls~N~l~g~ip~~l  676 (768)
T 3rgz_A          606 RLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM-LSGYIPKE-IGSMPYLFIL-N------LGHNDISGSIPDEV  676 (768)
T ss_dssp             GGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSC-CBSCCCGG-GGGCTTCCEE-E------CCSSCCCSCCCGGG
T ss_pred             ccccccccccccceecccCchhhhccccccEEECcCCc-ccccCCHH-HhccccCCEE-e------CcCCccCCCCChHH
Confidence                                   123567777777776 33222222 2344444443 1      45778888888888


Q ss_pred             hhhhhh------hhhcCCCCCCChhhHHhhhhhcHHHHHHhhcccccccCCCCCc
Q 013423          387 SLRASL------VKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSS  435 (443)
Q Consensus       387 ~~l~~L------~n~l~~~~p~~~~~ld~~~~l~~L~~L~l~~n~~~~~~p~~~~  435 (443)
                      +.++.|      +|+++|.+|..      +..+++|+.||+++|+++|.||+...
T Consensus       677 ~~L~~L~~LdLs~N~l~g~ip~~------l~~l~~L~~L~ls~N~l~g~iP~~~~  725 (768)
T 3rgz_A          677 GDLRGLNILDLSSNKLDGRIPQA------MSALTMLTEIDLSNNNLSGPIPEMGQ  725 (768)
T ss_dssp             GGCTTCCEEECCSSCCEECCCGG------GGGCCCCSEEECCSSEEEEECCSSSS
T ss_pred             hCCCCCCEEECCCCcccCcCChH------HhCCCCCCEEECcCCcccccCCCchh
Confidence            777766      77777888877      66788888888888888888887543
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 443
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 50.4 bits (119), Expect = 2e-07
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 15/179 (8%)

Query: 164 QNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTG 223
            NL  L L G  + D+   +L  LT L  LDL  +Q+SN     L    +L+ L L    
Sbjct: 219 TNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQ 274

Query: 224 VTKLPNISSLECLNLSFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLST 283
           ++ +  ++ L  L    + +   E       + + NL +L  L L    +SD  + P+S+
Sbjct: 275 ISNISPLAGLTALTNLELNENQLEDI-----SPISNLKNLTYLTLYFNNISD--ISPVSS 327

Query: 284 FKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHG 342
             +L  L   N  ++DVS   L++L+ +  LS     +  S L        +  L L+ 
Sbjct: 328 LTKLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQI--SDLTPLANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.41
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.14
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.05
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.89  E-value=6e-22  Score=187.28  Aligned_cols=165  Identities=28%  Similarity=0.379  Sum_probs=92.2

Q ss_pred             CCCCCCEEEecCCCCChhhHHhccCCCCccEEEecCCCCCchhhHhhcCCCCCCEEEcCCCCCCC---CCCCCCCCEEec
Q 013423          162 SLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTK---LPNISSLECLNL  238 (443)
Q Consensus       162 ~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~~---l~~~~~L~~L~l  238 (443)
                      .+++++.++++++.+.+..+  ...+++|+++++++|.+++.  ..+..+++|+.+++++|.+.+   +..+++|+.+++
T Consensus       195 ~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l  270 (384)
T d2omza2         195 KLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKL  270 (384)
T ss_dssp             GCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCGGGTTCTTCSEEEC
T ss_pred             cccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCCcccccccCCEeec
Confidence            44566666666666655422  34556677777777766532  345666777777777776665   345666777777


Q ss_pred             ccccccCCchhhhhhHHHhccCCCCCEEEcCCCCCCchhhhcccCCCCCCEEEeeCCCCChHHHHHhcCCCCCCEEEecC
Q 013423          239 SFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRD  318 (443)
Q Consensus       239 ~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~n~i~~~~~~~l~~l~~L~~L~l~~  318 (443)
                      +++.+.+.        ..+..++.++.+++++|.+.+  +..+..+++++.|++++|++++..  .+..+++|++|++++
T Consensus       271 ~~~~l~~~--------~~~~~~~~l~~l~~~~n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~  338 (384)
T d2omza2         271 GANQISNI--------SPLAGLTALTNLELNENQLED--ISPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFAN  338 (384)
T ss_dssp             CSSCCCCC--------GGGTTCTTCSEEECCSSCCSC--CGGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCS
T ss_pred             cCcccCCC--------Ccccccccccccccccccccc--ccccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCC
Confidence            76665532        223445555555555555543  223445555555555555555432  244555555555555


Q ss_pred             cccCchhhhhcCCCCCCCEEeccCCC
Q 013423          319 AVLTNSGLGSFKPPRSLKLLDLHGGW  344 (443)
Q Consensus       319 n~i~~~~~~~l~~~~~L~~L~l~~n~  344 (443)
                      |++++..  .+..+++|++|++++|+
T Consensus       339 n~l~~l~--~l~~l~~L~~L~l~~N~  362 (384)
T d2omza2         339 NKVSDVS--SLANLTNINWLSAGHNQ  362 (384)
T ss_dssp             SCCCCCG--GGGGCTTCCEEECCSSC
T ss_pred             CCCCCCh--hHcCCCCCCEEECCCCc
Confidence            5555431  34445555555555555
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure