Citrus Sinensis ID: 013724


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MMRQSLSDGSLDTMARRPADPEEELRWMSQEVRESSPRTSAASGDDWRSAFDAAANGPVSLRSYSRSASNGHSRRYSDPAENGDVRSGSNSGSRRTPNREGYRYGYILHSHAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDAAADGPVKPSQLLSFCIQLS
ccccccccccHHHHHccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHccccEEccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEEEccccccccccccccccHHHHccccccccccccccccccccHHHHHHccccccccccccccccEEcc
cccccHcHHHHHHHHHccccccHHEEEEEEEEcccccccccccccccccHEEEcccccccccccEEcccccccHHccccccccccccccHHHHccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccHHHHHcccEEEccccccHHccccHHHccccccEEEccccccHcccccccccHHHHHHcccHcHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHccc
mmrqslsdgsldtmarrpadpeeELRWMSQEvressprtsaasgddwRSAFdaaangpvslrsysrsasnghsrrysdpaengdvrsgsnsgsrrtpnregyrygYILHShahfdsyegvptaipsedtrdnfTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCkrvygqivlpvfygvdpapvkwptgsygdsfLKLEERFKENSEKLQTWRNALKEKIISACniftktpnpsfsqhLNTLVVLNlrdckslkslpagiHLEFLKeldlsgcsklkrlpdissaANIEEMFLngtaieelPSSIECLYKLLHldledckslkslpsglcklkslkyltlnGCSILQRLNFDIWSILPLVLTTFIYVYKFFVetsaasgddwksafdaaadgpvkpsqLLSFCIQLS
mmrqslsdgsldtmarrpadpeeeLRWMsqevressprtsaasgddwRSAFDAAangpvslrsysrsasnghsrrysdpaengdvrsgsnsgsrrtpnrEGYRYGYILHSHAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDAAADGPVKPSQLLSFCIQLS
MMRQSLSDGSLDTMARRPADPEEELRWMSQEVRESSPRTSAASGDDWRSAFDAAANGPVSLRSYSRSASNGHSRRYSDPAENGDVRSGSNSGSRRTPNREGYRYGYILHSHAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDAAADGPVKPSQLLSFCIQLS
****************************************************************************************************GYRYGYILHSHAHFDSYEGVPTAI*******NFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDA**********LLSFCI***
**********************************************WRSAFDAAANGPVSLRSY**********************************************HAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEER****SEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAF**************SFCIQLS
***********************ELRWM****************DDWRSAFDAAANGPVSLR**********************************PNREGYRYGYILHSHAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDAAADGPVKPSQLLSFCIQLS
*******************DPEEELRWMSQEVRESSPR********WRS**********************************************************LHSHAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDAAADGPVKPSQLLSFCIQLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRQSLSDGSLDTMARRPADPEEELRWMSQEVRESSPRTSAASGDDWRSAFDAAANGPVSLRSYSRSASNGHSRRYSDPAENGDVRSGSNSGSRRTPNREGYRYGYILHSHAHFDSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFINRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLTLNGCSILQRLNFDIWSILPLVLTTFIYVYKFFVETSAASGDDWKSAFDAAADGPVKPSQLLSFCIQLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.279 0.106 0.440 6e-25
O82500 1095 Putative disease resistan no no 0.297 0.118 0.421 2e-21
Q9SZ67 1895 Probable WRKY transcripti no no 0.242 0.055 0.481 3e-20
O23530 1301 Protein SUPPRESSOR OF npr no no 0.320 0.107 0.374 8e-18
Q9C5Q9411 Protein PHLOEM PROTEIN 2- no no 0.292 0.311 0.385 5e-17
Q9FHE9354 Protein PHLOEM PROTEIN 2- no no 0.276 0.341 0.338 1e-15
Q9SE83914 Dynamin-2A OS=Arabidopsis no no 0.146 0.070 0.632 8e-14
Q9LQ55920 Dynamin-2B OS=Arabidopsis no no 0.160 0.076 0.586 5e-12
Q9FHE8392 Protein PHLOEM PROTEIN 2- no no 0.272 0.303 0.354 1e-11
Q9SYC9571 Vesicle-associated protei no no 0.308 0.236 0.292 2e-11
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  115 bits (289), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 81/127 (63%), Gaps = 5/127 (3%)

Query: 127 EDTRDNFTSHLYSALSQKSIETF-----INRGDEISQSLVDAIEASAISLIIFSEGYASS 181
           EDTR  FTSHLY  L+ K I+TF     +  G  I   L  AIE S  ++++FSE YA+S
Sbjct: 21  EDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATS 80

Query: 182 RWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQT 241
           RW  ++LVKI++CK  + Q V+P+FY VDP+ V+    S+  +F + E ++K++ E +Q 
Sbjct: 81  RWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQR 140

Query: 242 WRNALKE 248
           WR AL E
Sbjct: 141 WRIALNE 147




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9C5Q9|P2A05_ARATH Protein PHLOEM PROTEIN 2-LIKE A5 OS=Arabidopsis thaliana GN=PP2A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9FHE9|P2A08_ARATH Protein PHLOEM PROTEIN 2-LIKE A8 OS=Arabidopsis thaliana GN=PP2A8 PE=2 SV=1 Back     alignment and function description
>sp|Q9SE83|DRP2A_ARATH Dynamin-2A OS=Arabidopsis thaliana GN=DRP2A PE=1 SV=2 Back     alignment and function description
>sp|Q9LQ55|DRP2B_ARATH Dynamin-2B OS=Arabidopsis thaliana GN=DRP2B PE=1 SV=2 Back     alignment and function description
>sp|Q9FHE8|P2A06_ARATH Protein PHLOEM PROTEIN 2-LIKE A6 OS=Arabidopsis thaliana GN=PP2A6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYC9|VAP14_ARATH Vesicle-associated protein 1-4 OS=Arabidopsis thaliana GN=PVA14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
223452607409 resistance protein [Glycine max] 0.567 0.606 0.370 2e-37
255564976 944 TMV resistance protein N, putative [Rici 0.295 0.136 0.563 2e-33
351722793299 TIR-NBS-LRR type disease resistance prot 0.299 0.438 0.521 2e-32
357486483242 TMV resistance protein N [Medicago trunc 0.304 0.549 0.479 3e-32
255561496 876 TMV resistance protein N, putative [Rici 0.279 0.139 0.579 4e-32
147780473435 hypothetical protein VITISV_034310 [Viti 0.441 0.443 0.431 4e-32
449477815320 PREDICTED: putative disease resistance p 0.292 0.4 0.521 5e-32
357486467200 TMV resistance protein N [Medicago trunc 0.320 0.7 0.466 1e-31
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.288 0.085 0.552 5e-31
359496034 1132 PREDICTED: TMV resistance protein N-like 0.279 0.107 0.543 7e-31
>gi|223452607|gb|ACM89630.1| resistance protein [Glycine max] Back     alignment and taxonomy information
 Score =  163 bits (412), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 166/310 (53%), Gaps = 62/310 (20%)

Query: 127 EDTRDNFTSHLYSALSQKSIETF-----INRGDEISQSLVDAIEASAISLIIFSEGYASS 181
           +DTR  FT +L+++L ++ I+ +     + RG  IS  L++AIE S  +LII S  YASS
Sbjct: 24  DDTRKGFTHNLFASLERRGIKAYRDDHDLERGKVISVELIEAIEESMFALIILSSNYASS 83

Query: 182 RWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQT 241
            W  D+L KIL+CK+     V P+F GVDP+ V+   GS+  +F   EE+F+E  +K++T
Sbjct: 84  TWCLDELQKILECKKE----VFPIFLGVDPSDVRHQRGSFAKAFRDHEEKFREEKKKVET 139

Query: 242 WRNALKEKIISACNIFTKTPNPSFSQ------------------------------HLNT 271
           WR+AL+E + S     +K  NP F Q                              +L +
Sbjct: 140 WRHALRE-VASYSGWDSKDKNPYFGQIFKFLLEKLKCIDLSFSKNLKQSPDFDAAPNLES 198

Query: 272 LV---------------------VLNLRDCKSLKSLPAGIHLEFLKELDLSGCSKLKRLP 310
           LV                     ++NL DCK LK+LP+ + +  LK L+LSGCS+ K LP
Sbjct: 199 LVLEGCTSLTEVHPSLVRHKKLAMMNLEDCKRLKTLPSNMEMSSLKYLNLSGCSEFKYLP 258

Query: 311 DIS-SAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCKLKSLKYLT 369
           +   S   +  + L  T I +LPSS+ CL  L HL+L++CK+L  LP    KLKSLK+L 
Sbjct: 259 EFGESMEQLSLLILKETPITKLPSSLGCLVGLAHLNLKNCKNLVCLPDTFHKLKSLKFLD 318

Query: 370 LNGCSILQRL 379
           + GCS L  L
Sbjct: 319 VRGCSKLCSL 328




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351722793|ref|NP_001237768.1| TIR-NBS-LRR type disease resistance protein [Glycine max] gi|223452578|gb|ACM89616.1| TIR-NBS-LRR type disease resistance protein [Glycine max] Back     alignment and taxonomy information
>gi|357486483|ref|XP_003613529.1| TMV resistance protein N [Medicago truncatula] gi|355514864|gb|AES96487.1| TMV resistance protein N [Medicago truncatula] gi|388497304|gb|AFK36718.1| unknown [Medicago truncatula] gi|388511843|gb|AFK43983.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147780473|emb|CAN66817.1| hypothetical protein VITISV_034310 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449477815|ref|XP_004155131.1| PREDICTED: putative disease resistance protein At4g11170-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357486467|ref|XP_003613521.1| TMV resistance protein N [Medicago truncatula] gi|355514856|gb|AES96479.1| TMV resistance protein N [Medicago truncatula] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496034|ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.409 0.156 0.379 1.7e-37
TAIR|locus:2151491 1123 AT5G46450 [Arabidopsis thalian 0.270 0.105 0.408 1.3e-36
TAIR|locus:2162439 1008 AT5G22690 [Arabidopsis thalian 0.295 0.127 0.367 1.8e-34
TAIR|locus:2151466 1353 VICTL "VARIATION IN COMPOUND T 0.292 0.094 0.397 3.3e-34
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.297 0.100 0.432 5.2e-34
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.256 0.088 0.486 2.3e-33
TAIR|locus:2151506 1127 RPS6 "RESISTANT TO P. SYRINGAE 0.297 0.115 0.372 4.6e-33
TAIR|locus:2130270 1449 RPP5 "RECOGNITION OF PERONOSPO 0.299 0.090 0.420 7.3e-33
TAIR|locus:2098145 1240 AT3G44630 [Arabidopsis thalian 0.272 0.095 0.392 2.3e-32
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.267 0.109 0.439 3e-32
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 1.7e-37, Sum P(2) = 1.7e-37
 Identities = 74/195 (37%), Positives = 111/195 (56%)

Query:   116 SYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETF-----INRGDEISQSLVDAIEASAIS 170
             SY+ V  +   EDTR  FTSHLY  L+ K I+TF     +  G  I   L  AIE S  +
Sbjct:    11 SYD-VFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA 69

Query:   171 LIIFSEGYASSRWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEE 230
             +++FSE YA+SRW  ++LVKI++CK  + Q V+P+FY VDP+ V+    S+  +F + E 
Sbjct:    70 IVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHET 129

Query:   231 RFKENSEKLQTWRNALKE--KIISACNIFTKTPNPSFSQHLNTLVVLNLRDCK-SLKSLP 287
             ++K++ E +Q WR AL E   +  +C+   KT      Q ++ +   + + CK SL  L 
Sbjct:   130 KYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQI---SSKLCKISLSYLQ 186

Query:   288 --AGI--HLEFLKEL 298
                GI  HLE ++ L
Sbjct:   187 NIVGIDTHLEKIESL 201


GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130270 RPP5 "RECOGNITION OF PERONOSPORA PARASITICA 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00038336001
SubName- Full=Chromosome undetermined scaffold_92, whole genome shotgun sequence; (411 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
pfam01582135 pfam01582, TIR, TIR domain 3e-29
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 5e-25
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-24
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-23
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-16
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-15
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
 Score =  110 bits (278), Expect = 3e-29
 Identities = 49/130 (37%), Positives = 79/130 (60%), Gaps = 7/130 (5%)

Query: 125 PSEDTRDNFTSHLYSALSQKSIETFIN-----RGDEISQSLVDAIEASAISLIIFSEGYA 179
             +D RD F SHL   L +K I+  I+      G+ I ++L +AIE S  +++IFS  YA
Sbjct: 6   SGKDDRDTFVSHLLKELEEKGIKLCIDDRDELPGESILENLFEAIEKSRRAIVIFSSNYA 65

Query: 180 SSRWFFDKLVKILQCKRVYG--QIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSE 237
           SS W  D+LV+I++C    G  +++LP+FY VDP+ V+  +G +G +FLK  +   +  +
Sbjct: 66  SSEWCLDELVEIVKCALEGGGKKVILPIFYKVDPSDVRPQSGKFGKAFLKTLKWSGDKED 125

Query: 238 KLQTWRNALK 247
           K++ W+ AL 
Sbjct: 126 KIRFWKKALY 135


The Toll/interleukin-1 receptor (TIR) homology domain is an intracellular signalling domain found in MyD88, interleukin 1 receptor and the Toll receptor. It contains three highly-conserved regions, and mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. TIR-like motifs are also found in plant proteins thought to be involved in resistance to disease. When activated, TIR domains recruit cytoplasmic adaptor proteins MyD88 and TOLLIP (Toll interacting protein). In turn, these associate with various kinases to set off signalling cascades. Length = 135

>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN03194187 putative disease resistance protein; Provisional 100.0
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.72
smart00255140 TIR Toll - interleukin 1 - resistance. 99.62
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.54
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.34
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.23
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.06
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.03
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PLN03150623 hypothetical protein; Provisional 98.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.92
PLN03150623 hypothetical protein; Provisional 98.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.72
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.61
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.58
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.56
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.4
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.3
PRK15386 426 type III secretion protein GogB; Provisional 98.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.27
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.23
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.22
PRK15386 426 type III secretion protein GogB; Provisional 98.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.98
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.96
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.74
KOG3678832 consensus SARM protein (with sterile alpha and arm 97.71
KOG4341483 consensus F-box protein containing LRR [General fu 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.49
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.49
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.46
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.39
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.2
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.14
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.0
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.96
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.87
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.71
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 96.67
KOG4341483 consensus F-box protein containing LRR [General fu 96.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.66
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.54
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.74
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.19
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.02
PF10137125 TIR-like: Predicted nucleotide-binding protein con 90.7
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.16
smart0037026 LRR Leucine-rich repeats, outliers. 90.16
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.84
smart0037026 LRR Leucine-rich repeats, outliers. 83.48
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.48
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 83.14
KOG0473 326 consensus Leucine-rich repeat protein [Function un 82.92
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=3.1e-37  Score=351.51  Aligned_cols=131  Identities=36%  Similarity=0.669  Sum_probs=122.1

Q ss_pred             CCCceeeccCCCcccCchHHHHHHHHhcCCceEEe----cCCCchHHHHHHHHHhcceEEEEecCccccccccHhhHHhh
Q 013724          116 SYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFI----NRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLVKI  191 (437)
Q Consensus       116 ~~~dvf~sf~g~d~r~~f~~~l~~~L~~~g~~~~~----~~g~~i~~~l~~~i~~S~~~i~i~S~~~~sS~Wcl~EL~~i  191 (437)
                      ++||||+||||+|||++|++|||+||.++||.+|+    ++|+.|.++|++||++||++|||||++||+|.|||+||++|
T Consensus        11 ~~~~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~~~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya~s~wcl~el~~i   90 (1153)
T PLN03210         11 WVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIERSQSLDPELKQAIRDSRIAVVVFSKNYASSSWCLNELLEI   90 (1153)
T ss_pred             CCCcEEeeCCCcccccCHHHHHHHHHHHCCCeEEccCCccCCCcccHHHHHHHHhCeEEEEEecCCcccchHHHHHHHHH
Confidence            48899999999999999999999999999999999    89999999999999999999999999999999999999999


Q ss_pred             hhhccccCeEEEeeeecCCCCCCCCCCCccCCchhhhhhhhhcChHHHHHHHHhhhh
Q 013724          192 LQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKE  248 (437)
Q Consensus       192 l~c~~~~~~~vlPiFy~VdpS~Vr~q~gsf~~af~~le~~~~~~~e~l~~W~~aL~~  248 (437)
                      ++|+++.+++|+||||+|||++||+|+|.|+++|.+++...  ..+.+++|+.||++
T Consensus        91 ~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~--~~~~~~~w~~al~~  145 (1153)
T PLN03210         91 VRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNK--TEDEKIQWKQALTD  145 (1153)
T ss_pred             HHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhccc--chhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999877543  45667788776643



syringae 6; Provisional

>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
3jrn_A176 Crystal Structure Of Tir Domain From Arabidopsis Th 4e-19
3ozi_A204 Crystal Structure Of The Tir Domain From The Flax D 2e-16
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
>pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 Back     alignment and structure

Iteration: 1

Score = 92.8 bits (229), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 50/124 (40%), Positives = 69/124 (55%), Gaps = 7/124 (5%) Query: 128 DTRDNFTSHLYSALSQKSIETF-----INRGDEISQSLVDAIEASAISLIIFSEGYASSR 182 DTR NF S LY L ++SI TF + G S L IE S ++++ SE YA+S Sbjct: 19 DTRHNFISFLYKELVRRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVVVVSENYAASS 78 Query: 183 WFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTW 242 W D+LV I+ ++ V+P+FYGV+P V+W TG + F K R E+ EK+ W Sbjct: 79 WCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHASR--EDPEKVLKW 136 Query: 243 RNAL 246 R AL Sbjct: 137 RQAL 140
>pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 3e-59
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 6e-56
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 2e-45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-07
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 Back     alignment and structure
 Score =  190 bits (485), Expect = 3e-59
 Identities = 49/135 (36%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query: 127 EDTRDNFTSHLYSALSQKSIETFI-----NRGDEISQSLVDAIEASAISLIIFSEGYASS 181
            DTR NF S LY  L ++SI TF        G   S  L   IE S  ++++ SE YA+S
Sbjct: 18  HDTRHNFISFLYKELVRRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVVVVSENYAAS 77

Query: 182 RWFFDKLVKILQCKRVYGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQT 241
            W  D+LV I+  ++     V+P+FYGV+P  V+W TG   + F K   R   + EK+  
Sbjct: 78  SWCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHASRE--DPEKVLK 135

Query: 242 WRNALKEKIISACNI 256
           WR AL         +
Sbjct: 136 WRQALTN----FAQL 146


>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 100.0
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 100.0
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.93
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.76
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.75
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.75
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.74
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.73
2js7_A160 Myeloid differentiation primary response protein M 99.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.6
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.57
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.57
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.55
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.55
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.55
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.53
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.53
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.53
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.52
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.52
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.52
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.51
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.5
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.5
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.49
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.49
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.49
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.49
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.49
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.49
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.48
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.47
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.47
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.47
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.46
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.46
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.46
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.45
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.45
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.44
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.44
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.44
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.44
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.44
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.44
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.43
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.42
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.41
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.4
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.4
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.4
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.4
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.38
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.38
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.37
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.36
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.36
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.35
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.34
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.34
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.0
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.96
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.94
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.91
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.83
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.8
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.79
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.67
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.64
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.6
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.38
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.87
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.0
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.89
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.36
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.73
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 94.63
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 94.1
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.8
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
Probab=100.00  E-value=6.6e-39  Score=291.09  Aligned_cols=137  Identities=36%  Similarity=0.624  Sum_probs=127.1

Q ss_pred             CCCCceeeccCCCcccCchHHHHHHHHhcCCceEEe-----cCCCchHHHHHHHHHhcceEEEEecCccccccccHhhHH
Q 013724          115 DSYEGVPTAIPSEDTRDNFTSHLYSALSQKSIETFI-----NRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKLV  189 (437)
Q Consensus       115 ~~~~dvf~sf~g~d~r~~f~~~l~~~L~~~g~~~~~-----~~g~~i~~~l~~~i~~S~~~i~i~S~~~~sS~Wcl~EL~  189 (437)
                      .++|||||||||+|+|++|++||+++|+++||++|+     ++|+.|.++|++||++||++|+|||++|++|.||++||+
T Consensus        33 ~~~yDVFISfrg~D~r~~Fv~~L~~aL~~~GI~~f~D~~el~~G~~I~~~l~~aIe~Sri~IvV~S~nYa~S~WCl~EL~  112 (204)
T 3ozi_A           33 SVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELA  112 (204)
T ss_dssp             -CCCCEEEEECHHHHTTTHHHHHHHHHHHTTCCEEEEETTTCCGGGTTTTHHHHHHHCSEEEEEECTTGGGCHHHHHHHH
T ss_pred             CcCCeEEEeccccCCCHHHHHHHHHHHHHCCCcEEEeCCccCCCCchHHHHHHHHHhCcEeeEEEEcccccCcHHHHHHH
Confidence            458899999999999999999999999999999999     689999999999999999999999999999999999999


Q ss_pred             hhhhhccc-cCeEEEeeeecCCCCCCCCCCCccCCchhhhhhhhhcChHHHHHHHHhhhhh-hccc
Q 013724          190 KILQCKRV-YGQIVLPVFYGVDPAPVKWPTGSYGDSFLKLEERFKENSEKLQTWRNALKEK-IISA  253 (437)
Q Consensus       190 ~il~c~~~-~~~~vlPiFy~VdpS~Vr~q~gsf~~af~~le~~~~~~~e~l~~W~~aL~~L-~Ls~  253 (437)
                      +|++|.+. +++.|+||||+|+|++||+|+|.||++|.+++..+  ..+++++|+.+|++. +|++
T Consensus       113 ~I~e~~~~~~~~~ViPIFY~VdPs~Vr~q~g~fg~af~~~~~~~--~~~~v~~Wr~AL~~va~lsG  176 (204)
T 3ozi_A          113 EIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKF--DGQTIQNWKDALKKVGDLKG  176 (204)
T ss_dssp             HHHHHHHHCTTSEECCEEESSCHHHHHHTCTTHHHHHHHHTTTS--CHHHHHHHHHHHHHHHTSCB
T ss_pred             HHHHHHHhcCCeeeEEEEeecCHHHHHhccccHHHHHHHHHHhh--CHHHHHHHHHHHHHHhccCc
Confidence            99999864 68999999999999999999999999999999876  457899999999984 4444



>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 51.2 bits (121), Expect = 1e-07
 Identities = 23/131 (17%), Positives = 44/131 (33%), Gaps = 9/131 (6%)

Query: 242 WRNALKEKIISACNIFTKTPNPSFSQHLNTLVVLNLRDCKSLKSLPAGIHLEFLKELDLS 301
               L E  + A  I   +P    +   N  +  N  +           +L+ L  L L 
Sbjct: 261 GLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI-----SPISNLKNLTYLTLY 315

Query: 302 GCSKLKRLPDISSAANIEEMFLNGTAIEELPSSIECLYKLLHLDLEDCKSLKSLPSGLCK 361
               +  +  +SS   ++ +F     + ++ S +  L  +  L     + +  L   L  
Sbjct: 316 FN-NISDISPVSSLTKLQRLFFANNKVSDVSS-LANLTNINWLSAGHNQ-ISDLTP-LAN 371

Query: 362 LKSLKYLTLNG 372
           L  +  L LN 
Sbjct: 372 LTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.48
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.43
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.43
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.4
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.33
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.31
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.27
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.26
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.2
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.19
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.16
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.16
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.86
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.71
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.55
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.42
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.84
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.74
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.98
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Toll/Interleukin receptor TIR domain
family: Toll/Interleukin receptor TIR domain
domain: Toll-like receptor 1, TLR1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49  E-value=1.1e-14  Score=126.83  Aligned_cols=94  Identities=14%  Similarity=0.210  Sum_probs=83.4

Q ss_pred             CCCCceeeccCCCcccCchH-HHHHHHHhcCCceEEe-----cCCCchHHHHHHHHHhcceEEEEecCccccccccHhhH
Q 013724          115 DSYEGVPTAIPSEDTRDNFT-SHLYSALSQKSIETFI-----NRGDEISQSLVDAIEASAISLIIFSEGYASSRWFFDKL  188 (437)
Q Consensus       115 ~~~~dvf~sf~g~d~r~~f~-~~l~~~L~~~g~~~~~-----~~g~~i~~~l~~~i~~S~~~i~i~S~~~~sS~Wcl~EL  188 (437)
                      .++|||||||+++|.  .|+ ..|...|+..|+++|+     ..|+.+.++|.++|++|+..|+|+|++|..|.||..|+
T Consensus        10 ~~~yDvFisys~~D~--~~v~~~L~~~Le~~g~~v~~d~~d~~~G~~~~~~i~~~i~~s~~~i~vlS~~~~~s~w~~~E~   87 (161)
T d1fyva_          10 NLQFHAFISYSGHDS--FWVKNELLPNLEKEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYEL   87 (161)
T ss_dssp             CCCEEEEEECCGGGH--HHHHHTHHHHHHTTTCCEECTTTTCCTTSCHHHHHHHHHHHEEEEEEEESHHHHHHTSHHHHH
T ss_pred             CCeeEEEEecChhHH--HHHHHHHHHHHHhCCCcceEeccccccccccHHHHHHHHHhCCEEEEEecCccccChHHHHHH
Confidence            468999999999998  455 6799999999999999     57999999999999999999999999999999999999


Q ss_pred             Hhhhhhc-cccCeEEEeeeecCC
Q 013724          189 VKILQCK-RVYGQIVLPVFYGVD  210 (437)
Q Consensus       189 ~~il~c~-~~~~~~vlPiFy~Vd  210 (437)
                      ...+... ..+...++||+++--
T Consensus        88 ~~a~~~~~~~~~~~lIpV~l~~~  110 (161)
T d1fyva_          88 YFAHHNLFHEGSNSLILILLEPI  110 (161)
T ss_dssp             HTTSCCCSCSSCSSEEEEESSCC
T ss_pred             HHHHHHHHHcCCCceeEEEEecC
Confidence            9888765 345568999998643



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure