Citrus Sinensis ID: 013800


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MLLRSSSTPVNIGSLVSPSLSDSPNKDVEEDTNRLNSTTLSCSSPPTSQENCSSSLKGLRRASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAPSFEIYSSVEGVESEEVSLTRTVTIGEDLDGSGISSGDFSFGSKKNMGLIEEEGEYEEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWETEEDEDDSKSSDQFQQVAPIRQGAVTTANVYA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHccHHHHccHHHHHHHHcHHHHHcccccccHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHccc
ccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHccccccccHHHHHcccccccccccccccccccccccccccEEEEcccccccccccEEEEEEccccccccccccccccHcccccccccHccccHHHccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHccc
mllrssstpvnigslvspslsdspnkdveedtnrlnsttlscsspptsqencssslkglrrassdgnlkglahshsscdiEDQIRYLCAQkkssclhnkanktmlrsapsfeiyssvegveseevSLTRTVTigedldgsgissgdfsfgskknmglieeegeyeeeglngigeeierpvsppmylamglgisvpgfddagevvdlimpnfddsAEAEEYYKRMideypchplLLRNYAQLLQKKGdlyraedyynhatmadpgdgesWMQYAKLVWELHRDQHRALTYFERaalaapqdsnILAAYACFLWemeddgeddkaQEEHIqvlpiqskgdlegAEEYFSRAilanpgdgeiMSQYAKLVWELHHDHDKALCYFeravqaspadsHVLAAYACFLweteededdskssdqfqqvapirqGAVTTANVYA
mllrssstpvnigslvspslsdspnkDVEEDTNRLnsttlscsspptsqeNCSSSLKGLRRASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAPSFEiyssvegveseeVSLTRTVtigedldgsgissgdfsfgsKKNMGLIEEEGEYEEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAalaapqdsNILAAYACFLWEMEDDGEDDKAQEEHIQVlpiqskgdlEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWETEEDEDDSKSSDqfqqvapirqgaVTTANVYA
MLLRSSSTPVNIGSLVSPSLSDSPNKDVEEDTNRLNsttlscsspptsQENCSSSLKGLRRASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAPSFEIYssvegveseevsLTRTVTigedldgsgissgdfsfgsKKNMglieeegeyeeeglngigeeieRPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWeteededdskssdQFQQVAPIRQGAVTTANVYA
*****************************************************************************CDIEDQIRYLCAQKKSSCLH***************IY****************VT*************************************************PPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEM**************************GAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWE********************************
**LRSSSTPVNI*******************************************************************************************************************TRTVTIGED*************************GEYEEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWETEEDEDDSKSSDQFQQVAPIRQGAVTTANVYA
**********NIGSLVS*******************************************RASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAPSFEIYSS**********LTRTVTIGEDLDGSGISSGDFSFGSKKNMGLIEEEGEYEEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWET**************QVAPIRQGAVTTANVYA
**********************************************************LRRASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAPSFEIYSSVEGVESEEVSLTRTVTIGED****************************EEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWETEEDEDDSKSSDQFQQVAPIRQGAVTT**V**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRSSSTPVNIGSLVSPSLSDSPNKDVEEDTNRLNSTTLSCSSPPTSQENCSSSLKGLRRASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAPSFEIYSSVEGVESEEVSLTRTVTIGEDLDGSGISSGDFSFGSKKNMGLIEEEGEYEEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWETEEDEDDSKSSDQFQQVAPIRQGAVTTANVYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query436 2.2.26 [Sep-21-2011]
Q54NS3263 TPR repeat-containing pro yes no 0.373 0.619 0.225 6e-06
>sp|Q54NS3|Y5095_DICDI TPR repeat-containing protein DDB_G0285095 OS=Dictyostelium discoideum GN=DDB_G0285095 PE=4 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 73/191 (38%), Gaps = 28/191 (14%)

Query: 225 IDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQH 284
           + E P    LL  Y  LL  +G    AE+    A   D  +  +W  Y + +   +  + 
Sbjct: 80  LQEQPQDSDLLAQYGVLLSMEGKNKEAEESLRKAVEVDTDNSRAWQAYGEFLERTNNPKK 139

Query: 285 RALTYFERAALAAPQ------DSNILAAYACFLWEMEDDGEDDKAQEEHIQVLPIQSKGD 338
               Y E    AAP+      DS++L +YA F                      IQ  G+
Sbjct: 140 AKEVYGEAYKHAAPKIALDEDDSSLLLSYAIF----------------------IQKSGE 177

Query: 339 LEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAY 398
           ++ AE+ + R + +     E + +Y   + E+  D +K   Y + A    P        Y
Sbjct: 178 IDKAEKLYKRIVTSGARSSESLGRYGLFLLEVKKDVEKGGIYLKDAADIDPPSPEWCTRY 237

Query: 399 ACFLWETEEDE 409
           + +L   ++DE
Sbjct: 238 SNYLKTYKKDE 248





Dictyostelium discoideum (taxid: 44689)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
255574883502 o-linked n-acetylglucosamine transferase 0.972 0.844 0.488 1e-107
359477777492 PREDICTED: uncharacterized protein LOC10 0.972 0.861 0.472 1e-101
296083733531 unnamed protein product [Vitis vinifera] 0.972 0.798 0.404 5e-81
147859668521 hypothetical protein VITISV_026571 [Viti 0.871 0.729 0.417 7e-76
357440919376 TPR domain protein [Medicago truncatula] 0.660 0.765 0.428 5e-70
356533818368 PREDICTED: uncharacterized protein LOC10 0.681 0.807 0.430 5e-65
449432498367 PREDICTED: uncharacterized protein LOC10 0.715 0.850 0.427 9e-63
356576440285 PREDICTED: uncharacterized protein LOC10 0.516 0.789 0.456 7e-60
297848682308 hypothetical protein ARALYDRAFT_470433 [ 0.658 0.931 0.443 8e-58
21555875310 unknown [Arabidopsis thaliana] 0.676 0.951 0.451 1e-57
>gi|255574883|ref|XP_002528348.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223532216|gb|EEF34020.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  396 bits (1018), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 248/508 (48%), Positives = 311/508 (61%), Gaps = 84/508 (16%)

Query: 1   MLLRSSSTPVNIGSLVSP-SLSDSPNKDVEEDT--------NRLNSTTLSC--SSPPTSQ 49
           M+LRSSS PV  G+ +SP S SDSPN+D  +          + LN T +SC  SS P S+
Sbjct: 1   MILRSSSNPV-TGTFLSPFSSSDSPNRDFHDHNKLSSSHGFHHLNLTPISCTNSSSPISE 59

Query: 50  ENCSSSLKGLRRASSDGNLKGLAHSHSSCDIEDQIRYLCAQKKSSCLHNKANKTMLRSAP 109
            N S  L G RRA SD NL+   +  SS D +++++   +         +   TML++AP
Sbjct: 60  HNDSFRLGGFRRAWSDSNLEKFVYPSSSSDHKEELQNFTSHTPKR-FTKRNYTTMLQTAP 118

Query: 110 SFEIYS---------SVEGVESEEVSLTRTVTIGEDLDGSGISSGDFSFGSKKNMGLIEE 160
           SF I++            GVE EE  L RTVTIG+ ++G+  S+G+ SF  KK+MGLIEE
Sbjct: 119 SFSIFNVNDHELQDQEKNGVEEEERGLMRTVTIGDIIEGT--SNGELSF-EKKSMGLIEE 175

Query: 161 EGEY--------EEEGLNGIGEEIERPVSPPMYLAMGLGISVPGFDDAGEVVDL---IMP 209
           EGE         E E LN   E ++ PVSPPMYLA GLGI    F   G         +P
Sbjct: 176 EGEEEQDQEVMNEIENLNL--ENVKEPVSPPMYLASGLGIDGIDFGGGGRGGGGFDSTLP 233

Query: 210 NFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESW 269
           NFD+S + EEYYKRM+DE+PCHPL L NYAQLLQ KGDL+ AE+YY  AT+ADP DGE  
Sbjct: 234 NFDESDDLEEYYKRMVDEFPCHPLFLANYAQLLQSKGDLHGAEEYYYRATVADPEDGEIL 293

Query: 270 MQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQ 329
           M+YAKL W+LH DQ RA + FERA  AAPQDS++LAAYA FLWE++ DGE+D+ Q +HIQ
Sbjct: 294 MKYAKLEWQLHHDQDRAWSNFERAIQAAPQDSHVLAAYASFLWEIDGDGEEDRWQTKHIQ 353

Query: 330 VLP---------------------------------------------IQSKGDLEGAEE 344
           + P                                              Q+KGD+ GAEE
Sbjct: 354 LPPGLIMDVDDDAASATNKGFAVEEYYKKMVEENPSNSLVLRNYAQFLYQAKGDIRGAEE 413

Query: 345 YFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWE 404
           Y+SRA+LA+PGDGEI SQYAKLVWEL  D DKA  YFE+AVQA+P +S+VLAAYA FLWE
Sbjct: 414 YYSRALLADPGDGEIKSQYAKLVWELGRDRDKASSYFEQAVQAAPGNSNVLAAYASFLWE 473

Query: 405 TEEDEDDSKSSDQFQQVAPIRQGAVTTA 432
           TEE+E+DS  SDQFQ+V    + +VT A
Sbjct: 474 TEENEEDSTCSDQFQEVIH-HESSVTAA 500




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359477777|ref|XP_002282135.2| PREDICTED: uncharacterized protein LOC100261301 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083733|emb|CBI23722.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147859668|emb|CAN83109.1| hypothetical protein VITISV_026571 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357440919|ref|XP_003590737.1| TPR domain protein [Medicago truncatula] gi|355479785|gb|AES60988.1| TPR domain protein [Medicago truncatula] gi|388501702|gb|AFK38917.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356533818|ref|XP_003535455.1| PREDICTED: uncharacterized protein LOC100805375 [Glycine max] Back     alignment and taxonomy information
>gi|449432498|ref|XP_004134036.1| PREDICTED: uncharacterized protein LOC101202732 [Cucumis sativus] gi|449487480|ref|XP_004157647.1| PREDICTED: uncharacterized LOC101202732 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356576440|ref|XP_003556339.1| PREDICTED: uncharacterized protein LOC100783167 [Glycine max] Back     alignment and taxonomy information
>gi|297848682|ref|XP_002892222.1| hypothetical protein ARALYDRAFT_470433 [Arabidopsis lyrata subsp. lyrata] gi|297338064|gb|EFH68481.1| hypothetical protein ARALYDRAFT_470433 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21555875|gb|AAM63952.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
TAIR|locus:2197768310 TPR4 "tetratricopeptide repeat 0.504 0.709 0.473 1.3e-52
TAIR|locus:2149314290 AT5G20190 "AT5G20190" [Arabido 0.277 0.417 0.384 8.2e-26
TAIR|locus:2141030274 AT4G17940 "AT4G17940" [Arabido 0.266 0.423 0.418 8.7e-24
TAIR|locus:2127781238 AT4G32340 "AT4G32340" [Arabido 0.240 0.441 0.420 8.9e-23
TAIR|locus:2016229305 AT1G80130 [Arabidopsis thalian 0.25 0.357 0.390 1e-20
TAIR|locus:2060669536 AT2G29670 [Arabidopsis thalian 0.259 0.210 0.355 8.5e-09
TAIR|locus:2025067552 AT1G07280 "AT1G07280" [Arabido 0.238 0.188 0.392 1.2e-07
TAIR|locus:2075616515 AT3G47080 [Arabidopsis thalian 0.240 0.203 0.330 3.8e-05
UNIPROTKB|Q71ZG0222 LMOf2365_1529 "TPR domain prot 0.408 0.801 0.271 0.00097
TAIR|locus:2197768 TPR4 "tetratricopeptide repeat 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 545 (196.9 bits), Expect = 1.3e-52, P = 1.3e-52
 Identities = 108/228 (47%), Positives = 149/228 (65%)

Query:   178 RPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRN 237
             RP SPPM+LA GLGI    FD  G  +   +P +DD     +YYK M++EYP HPLLL+N
Sbjct:    85 RPPSPPMHLAAGLGIDK--FDLYGSEIKFDLPGYDDK-NCGDYYKGMLEEYPLHPLLLKN 141

Query:   238 YAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAA 297
             YA+ L+ KGDL  AE+YY+  T+ +P DG +   Y +LV +LH+D+ +A++YFERA  A+
Sbjct:   142 YAKFLEYKGDLSGAEEYYHKCTVVEPSDGVALANYGRLVMKLHQDEAKAMSYFERAVQAS 201

Query:   298 PQDSNILAAYACFLWEM--EDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPG 355
             P DS +LAAYA FLWE+  +DD EDD   ++       Q K + E       ++ L+   
Sbjct:   202 PDDSIVLAAYASFLWEINADDDDEDDDEDDDESSG---QGKDEFEADAAGKGKSSLSKTE 258

Query:   356 DGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLW 403
             DGE + +YAK  W +++DH+KAL YFE+AV+ASP DS +L  YA FLW
Sbjct:   259 DGETLCRYAKAFWSINNDHEKALFYFEKAVEASPNDSIILGEYARFLW 306


GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2149314 AT5G20190 "AT5G20190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141030 AT4G17940 "AT4G17940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127781 AT4G32340 "AT4G32340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016229 AT1G80130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060669 AT2G29670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025067 AT1G07280 "AT1G07280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075616 AT3G47080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q71ZG0 LMOf2365_1529 "TPR domain protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00020351001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (533 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-05
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 4e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 3e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.004
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
 Score = 46.9 bits (112), Expect = 3e-07
 Identities = 15/55 (27%), Positives = 28/55 (50%)

Query: 335 SKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASP 389
             GD + A E + +A+  +P + E     A    +L  D+++AL   E+A++  P
Sbjct: 15  KLGDYDEAIEAYEKALELDPDNAEAYYNLALAYLKLGKDYEEALEDLEKALELDP 69


Length = 69

>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 436
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.97
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.9
KOG0547606 consensus Translocase of outer mitochondrial membr 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.87
KOG1126638 consensus DNA-binding cell division cycle control 99.87
PRK12370553 invasion protein regulator; Provisional 99.86
PRK11189296 lipoprotein NlpI; Provisional 99.86
PRK12370553 invasion protein regulator; Provisional 99.86
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.85
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.84
KOG1125579 consensus TPR repeat-containing protein [General f 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.81
KOG2076 895 consensus RNA polymerase III transcription factor 99.81
KOG0547606 consensus Translocase of outer mitochondrial membr 99.81
PLN02789320 farnesyltranstransferase 99.81
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.8
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.79
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.79
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.78
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.78
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.78
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.76
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.76
KOG1125579 consensus TPR repeat-containing protein [General f 99.75
PLN02789320 farnesyltranstransferase 99.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.74
PRK11189296 lipoprotein NlpI; Provisional 99.73
KOG2003 840 consensus TPR repeat-containing protein [General f 99.72
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.72
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.72
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.72
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.7
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.69
PRK14574 822 hmsH outer membrane protein; Provisional 99.69
PRK15359144 type III secretion system chaperone protein SscB; 99.68
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.68
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.67
PRK15359144 type III secretion system chaperone protein SscB; 99.66
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.63
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.63
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.63
KOG1129478 consensus TPR repeat-containing protein [General f 99.62
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.61
PRK10370198 formate-dependent nitrite reductase complex subuni 99.61
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.6
PRK14574 822 hmsH outer membrane protein; Provisional 99.6
PRK10370198 formate-dependent nitrite reductase complex subuni 99.6
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.59
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.59
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.59
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.58
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.57
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.55
KOG2076 895 consensus RNA polymerase III transcription factor 99.54
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.54
KOG2003840 consensus TPR repeat-containing protein [General f 99.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.52
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.52
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.49
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.48
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.47
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.46
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG0553304 consensus TPR repeat-containing protein [General f 99.43
PLN03218 1060 maturation of RBCL 1; Provisional 99.43
PLN03218 1060 maturation of RBCL 1; Provisional 99.42
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.42
KOG0553304 consensus TPR repeat-containing protein [General f 99.42
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.41
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.41
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.39
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.39
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.39
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.38
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.37
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.36
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.35
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.31
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.31
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.3
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.3
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.29
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.29
PLN03077 857 Protein ECB2; Provisional 99.28
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.26
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.26
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.24
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.24
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.22
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.16
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.16
PLN03077 857 Protein ECB2; Provisional 99.15
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.15
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.14
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.14
PRK11906458 transcriptional regulator; Provisional 99.14
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.14
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.13
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.13
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.12
PRK04841 903 transcriptional regulator MalT; Provisional 99.12
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.11
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.1
PRK11906458 transcriptional regulator; Provisional 99.1
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.1
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.1
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.09
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.07
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.07
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.07
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.07
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.05
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.05
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.0
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.0
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.99
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.99
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.98
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.97
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.95
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.95
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.94
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.93
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.93
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.92
PRK15331165 chaperone protein SicA; Provisional 98.91
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.9
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.86
PRK04841 903 transcriptional regulator MalT; Provisional 98.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.84
PRK10803263 tol-pal system protein YbgF; Provisional 98.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.84
PRK10803263 tol-pal system protein YbgF; Provisional 98.83
PRK15331165 chaperone protein SicA; Provisional 98.82
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.8
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.78
COG4700251 Uncharacterized protein conserved in bacteria cont 98.77
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.76
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.74
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.73
PF12688120 TPR_5: Tetratrico peptide repeat 98.72
KOG4234271 consensus TPR repeat-containing protein [General f 98.69
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.68
PF12688120 TPR_5: Tetratrico peptide repeat 98.67
PF1337173 TPR_9: Tetratricopeptide repeat 98.67
KOG4234271 consensus TPR repeat-containing protein [General f 98.66
COG4700251 Uncharacterized protein conserved in bacteria cont 98.64
PF1337173 TPR_9: Tetratricopeptide repeat 98.63
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.6
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.6
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.59
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.54
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.54
KOG4555175 consensus TPR repeat-containing protein [Function 98.52
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.51
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.48
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.47
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.47
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.47
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.46
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.43
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.42
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.41
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.41
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.41
PF13512142 TPR_18: Tetratricopeptide repeat 98.38
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.37
PF13512142 TPR_18: Tetratricopeptide repeat 98.35
KOG1586288 consensus Protein required for fusion of vesicles 98.34
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.34
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.31
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.24
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.23
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.23
KOG4555175 consensus TPR repeat-containing protein [Function 98.21
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.18
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.18
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.16
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.13
KOG2471 696 consensus TPR repeat-containing protein [General f 98.13
KOG1585308 consensus Protein required for fusion of vesicles 98.08
PF1342844 TPR_14: Tetratricopeptide repeat 98.08
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.05
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.0
KOG4507 886 consensus Uncharacterized conserved protein, conta 98.0
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.97
PF1342844 TPR_14: Tetratricopeptide repeat 97.97
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.96
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.95
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.94
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.91
PF1343134 TPR_17: Tetratricopeptide repeat 97.87
KOG1586288 consensus Protein required for fusion of vesicles 97.87
PF1343134 TPR_17: Tetratricopeptide repeat 97.82
KOG1258 577 consensus mRNA processing protein [RNA processing 97.82
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.81
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.81
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.8
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.79
KOG1585308 consensus Protein required for fusion of vesicles 97.74
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.72
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.72
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.71
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.69
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.68
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.66
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.65
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.64
KOG1550552 consensus Extracellular protein SEL-1 and related 97.63
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.61
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.61
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.54
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.53
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.51
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.51
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.44
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.44
KOG2471 696 consensus TPR repeat-containing protein [General f 97.4
KOG1258577 consensus mRNA processing protein [RNA processing 97.39
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.37
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.31
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.25
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.24
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.23
KOG1550 552 consensus Extracellular protein SEL-1 and related 97.22
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.2
KOG2300 629 consensus Uncharacterized conserved protein [Funct 97.2
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.2
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.13
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.12
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.05
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.98
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.98
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.95
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.95
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.94
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.92
KOG2300629 consensus Uncharacterized conserved protein [Funct 96.87
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.87
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.83
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.78
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.77
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.73
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.7
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.69
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.62
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.61
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.54
PRK10941269 hypothetical protein; Provisional 96.5
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.5
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.46
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.43
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.42
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.38
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.28
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.28
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.27
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.25
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.23
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.21
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.1
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.05
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.05
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.02
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.98
PRK10941269 hypothetical protein; Provisional 95.94
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.94
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.87
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.84
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.82
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.79
KOG1310 758 consensus WD40 repeat protein [General function pr 95.65
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.65
COG4941415 Predicted RNA polymerase sigma factor containing a 95.64
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.63
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.63
KOG2422 665 consensus Uncharacterized conserved protein [Funct 95.52
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.51
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 95.49
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.44
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.38
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.35
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.15
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.12
COG5191 435 Uncharacterized conserved protein, contains HAT (H 95.11
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 95.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.99
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.88
KOG2422 665 consensus Uncharacterized conserved protein [Funct 94.74
KOG4814 872 consensus Uncharacterized conserved protein [Funct 94.62
KOG1310 758 consensus WD40 repeat protein [General function pr 94.58
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.52
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.47
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.44
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.32
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.31
KOG0529 421 consensus Protein geranylgeranyltransferase type I 94.3
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.27
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.22
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.22
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.14
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.07
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.96
KOG0529 421 consensus Protein geranylgeranyltransferase type I 93.93
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.91
KOG3364149 consensus Membrane protein involved in organellar 93.86
COG3629280 DnrI DNA-binding transcriptional activator of the 93.8
KOG3364149 consensus Membrane protein involved in organellar 93.72
KOG1463411 consensus 26S proteasome regulatory complex, subun 93.51
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 93.49
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.4
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.36
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.33
COG2912269 Uncharacterized conserved protein [Function unknow 93.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.97
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 92.94
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 92.81
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 92.48
COG5159 421 RPN6 26S proteasome regulatory complex component [ 92.32
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.09
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.0
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 91.93
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.89
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.13
COG2912269 Uncharacterized conserved protein [Function unknow 91.03
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.87
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 90.82
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.68
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.58
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.54
smart00299140 CLH Clathrin heavy chain repeat homology. 90.29
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 90.25
KOG2581 493 consensus 26S proteasome regulatory complex, subun 89.95
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.9
KOG4014248 consensus Uncharacterized conserved protein (conta 89.78
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.74
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.63
COG3629280 DnrI DNA-binding transcriptional activator of the 89.14
PRK12798 421 chemotaxis protein; Reviewed 89.13
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 88.79
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 88.69
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.55
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 88.27
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.09
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.09
COG4455273 ImpE Protein of avirulence locus involved in tempe 87.99
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 87.89
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.87
COG3947361 Response regulator containing CheY-like receiver a 87.86
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 87.67
KOG2581 493 consensus 26S proteasome regulatory complex, subun 87.59
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 86.8
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 86.28
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 85.54
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 85.29
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 85.21
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 84.7
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 84.35
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.03
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 83.97
KOG4014248 consensus Uncharacterized conserved protein (conta 83.73
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 83.41
COG3947361 Response regulator containing CheY-like receiver a 83.0
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 82.98
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 82.36
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 82.31
COG4455 273 ImpE Protein of avirulence locus involved in tempe 81.72
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 80.8
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.4e-32  Score=267.37  Aligned_cols=247  Identities=16%  Similarity=0.160  Sum_probs=240.6

Q ss_pred             ChHHHHHhhcCCCCCCChhhhhhHhhhhhhCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Q 013800          181 SPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATM  260 (436)
Q Consensus       181 ~a~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  260 (436)
                      .+..+|..++.+++ .+.++|+++|+++-..+.+++|+.+|.+++.+.|.++.++-++|.+|+.+|..+-|+..|+++++
T Consensus       236 ~aiq~y~eAvkldP-~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~  314 (966)
T KOG4626|consen  236 LAIQHYEEAVKLDP-NFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALE  314 (966)
T ss_pred             HHHHHHHHhhcCCC-cchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHh
Confidence            67788999999999 89999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCchHHHHHHHHHHHH----------
Q 013800          261 ADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQV----------  330 (436)
Q Consensus       261 ~~p~~~~~~~~la~~~~~~~~d~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~----------  330 (436)
                      +.|..+.++.++|..+-..|. ..+|+.+|.+++.+.|+++++.++||.++.++|.++.|..+|..++..          
T Consensus       315 ~~P~F~~Ay~NlanALkd~G~-V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nN  393 (966)
T KOG4626|consen  315 LQPNFPDAYNNLANALKDKGS-VTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNN  393 (966)
T ss_pred             cCCCchHHHhHHHHHHHhccc-hHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhh
Confidence            999999999999999998875 999999999999999999999999999999999999999999988876          


Q ss_pred             --hHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHCCCh
Q 013800          331 --LPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWETEED  408 (436)
Q Consensus       331 --~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~d~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  408 (436)
                        .+|.++|++++|+.+|+.+|++.|..++++.++|..|..+|+ .+.|+.+|.+|++++|...+++.+||.+|...|+.
T Consensus       394 La~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~-v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni  472 (966)
T KOG4626|consen  394 LASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGD-VSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNI  472 (966)
T ss_pred             HHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhh-HHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCc
Confidence              889999999999999999999999999999999999999999 99999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhCCCChhHHh
Q 013800          409 EDDSKSSDQFQQVAPIRQGAVT  430 (436)
Q Consensus       409 ~~A~~~~~~al~l~p~~~~a~~  430 (436)
                      .+|+..|+.++.+.|+|+++..
T Consensus       473 ~~AI~sY~~aLklkPDfpdA~c  494 (966)
T KOG4626|consen  473 PEAIQSYRTALKLKPDFPDAYC  494 (966)
T ss_pred             HHHHHHHHHHHccCCCCchhhh
Confidence            9999999999999999999865



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-12
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 9e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-12
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-08
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-06
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 6e-11
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 7e-11
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 6e-07
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-09
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 3e-10
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 9e-06
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 8e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 9e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 6e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 3e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 9e-05
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 4e-04
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 4e-04
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
 Score = 85.3 bits (211), Expect = 5e-18
 Identities = 30/192 (15%), Positives = 47/192 (24%), Gaps = 25/192 (13%)

Query: 213 DSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNHATMADPGDGESWMQY 272
           D        +  +   P   +     A      GD    E          PG  E+  + 
Sbjct: 4   DGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARL 63

Query: 273 AKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQVLP 332
            ++ W   R         ++A+ AAP+   I       L +                   
Sbjct: 64  GRVRWTQQRHAEA-AVLLQQASDAAPEHPGIALWLGHALEDA------------------ 104

Query: 333 IQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDH--DKALCYFERAVQASPA 390
               G  E A   ++RA    P +  I +Q       L      D        AV     
Sbjct: 105 ----GQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVG 160

Query: 391 DSHVLAAYACFL 402
                A  +   
Sbjct: 161 AVEPFAFLSEDA 172


>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.93
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.93
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.93
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.92
3u4t_A272 TPR repeat-containing protein; structural genomics 99.92
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.92
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.91
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.91
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.9
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.9
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.9
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.88
3u4t_A272 TPR repeat-containing protein; structural genomics 99.88
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.86
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.86
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.85
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.85
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.85
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.85
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.85
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.85
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.85
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.84
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.82
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.82
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.81
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.81
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.81
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.8
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.8
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.79
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.79
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.78
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.78
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.77
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.77
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.76
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.75
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.74
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.74
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.74
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.74
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.73
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.71
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.71
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.71
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.71
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.7
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.69
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.69
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.68
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.67
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.66
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.66
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.65
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.65
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.65
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.65
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.64
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.63
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.63
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.63
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.62
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.61
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.61
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.61
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.6
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.59
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.59
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.58
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.58
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.58
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.57
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.57
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.56
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.56
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.56
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.55
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.55
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.53
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.53
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.52
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.52
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.52
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.51
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.51
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.51
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.5
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.5
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.49
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.49
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.49
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.47
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.46
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.46
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.46
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.45
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.44
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.44
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.43
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.42
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.41
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.41
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.4
3k9i_A117 BH0479 protein; putative protein binding protein, 99.4
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.39
3k9i_A117 BH0479 protein; putative protein binding protein, 99.36
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.36
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.34
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.33
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.32
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.22
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.21
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.19
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.17
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.16
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.15
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.14
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.14
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.02
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.01
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.99
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.97
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.95
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.93
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.92
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.91
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.87
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.68
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.54
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.48
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.45
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.45
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.43
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.32
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.3
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.2
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.18
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.06
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.95
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.86
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.65
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.19
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.07
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.07
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.03
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.88
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.52
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.48
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.06
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.05
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.04
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.91
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.71
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.7
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.55
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.33
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.19
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 94.74
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.35
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 94.26
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 93.73
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.62
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 92.98
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.34
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 91.89
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.46
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.22
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 90.79
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 90.66
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.52
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.51
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.39
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 86.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 86.14
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.26
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 84.05
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 83.03
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=99.96  E-value=7.6e-28  Score=237.02  Aligned_cols=254  Identities=15%  Similarity=0.218  Sum_probs=218.1

Q ss_pred             CCCChHHHHHhhcCCCCCCChhhhhhHhhhhhhCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 013800          178 RPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNH  257 (436)
Q Consensus       178 ~p~~a~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~~~~  257 (436)
                      +++++...+..++.+.+ +....+..+|.++...|++++|+.+|+++++.+|++..+|..+|.++...|++++|+..|++
T Consensus       116 ~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  194 (388)
T 1w3b_A          116 DMEGAVQAYVSALQYNP-DLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEK  194 (388)
T ss_dssp             CSSHHHHHHHHHHHHCT-TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCC-CcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            45566666777777777 67778888888888888888888888888888888888888888888888889999999999


Q ss_pred             HHHhCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCchHHHHHHHHHHHH-------
Q 013800          258 ATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQV-------  330 (436)
Q Consensus       258 al~~~p~~~~~~~~la~~~~~~~~d~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~-------  330 (436)
                      +++++|++..++..+|.++...+. +++|+..|++++.++|++..++..+|.++...|++++|...+++++..       
T Consensus       195 al~~~p~~~~~~~~lg~~~~~~~~-~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~  273 (388)
T 1w3b_A          195 AVTLDPNFLDAYINLGNVLKEARI-FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDA  273 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHTTTC-TTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHH
T ss_pred             HHhcCCCcHHHHHHHHHHHHHcCC-HHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHH
Confidence            888888888888888888887764 888999999999888988888888898888999998888888877765       


Q ss_pred             -----hHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHC
Q 013800          331 -----LPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDHDKALCYFERAVQASPADSHVLAAYACFLWET  405 (436)
Q Consensus       331 -----~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~d~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~  405 (436)
                           .++...|++++|+..|+++++.+|.++.++..+|.++...|+ +++|+..|++++++.|++..++..+|.++...
T Consensus       274 ~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~-~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~  352 (388)
T 1w3b_A          274 YCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGN-IEEAVRLYRKALEVFPEFAAAHSNLASVLQQQ  352 (388)
T ss_dssp             HHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTC-HHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCC-HHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHc
Confidence                 677788999999999999999999999999999999998888 99999999999999999888999999999999


Q ss_pred             CChHHHHHHHHHHHhhCCCChhHHh-hhhh
Q 013800          406 EEDEDDSKSSDQFQQVAPIRQGAVT-TANV  434 (436)
Q Consensus       406 g~~~~A~~~~~~al~l~p~~~~a~~-~an~  434 (436)
                      |++++|+..|++++++.|++..+.. .+.+
T Consensus       353 g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~  382 (388)
T 1w3b_A          353 GKLQEALMHYKEAIRISPTFADAYSNMGNT  382 (388)
T ss_dssp             TCCHHHHHHHHHHHTTCTTCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHhhCCCCHHHHHhHHHH
Confidence            9999999999999999888877655 4443



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 436
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-09
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-11
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-08
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-04
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-07
d2onda1 308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-07
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.003
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-04
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 3e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.002
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.003
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 4e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 7e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.001
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.002
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.003
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.4 bits (176), Expect = 2e-14
 Identities = 39/210 (18%), Positives = 72/210 (34%), Gaps = 24/210 (11%)

Query: 195 PGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDY 254
           P F DA   +  ++        A   Y R +   P H ++  N A +  ++G +  A D 
Sbjct: 200 PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDT 259

Query: 255 YNHATMADPGDGESWMQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEM 314
           Y  A    P   +++   A  + E       A   +  A    P  ++ L   A    E 
Sbjct: 260 YRRAIELQPHFPDAYCNLANALKEKG-SVAEAEDCYNTALRLCPTHADSLNNLANIKREQ 318

Query: 315 EDDGEDDKAQEEHIQVLPIQSKGDLEGAEEYFSRAILANPGDGEIMSQYAKLVWELHHDH 374
                                 G++E A   + +A+   P      S  A ++ +     
Sbjct: 319 ----------------------GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQ-GKL 355

Query: 375 DKALCYFERAVQASPADSHVLAAYACFLWE 404
            +AL +++ A++ SP  +   +     L E
Sbjct: 356 QEALMHYKEAIRISPTFADAYSNMGNTLKE 385


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.91
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.84
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.72
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.71
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.66
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.66
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.66
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.65
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.64
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.64
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.57
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.57
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.5
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.5
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.47
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.47
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.47
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.44
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.44
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.43
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.42
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.09
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.06
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.04
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.03
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.02
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.98
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.84
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.75
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.21
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.17
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.15
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.97
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.54
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.47
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.84
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 92.21
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 89.2
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 89.12
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=8.2e-26  Score=217.21  Aligned_cols=255  Identities=14%  Similarity=0.106  Sum_probs=193.9

Q ss_pred             CCCChHHHHHhhcCCCCCCChhhhhhHhhhhhhCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 013800          178 RPVSPPMYLAMGLGISVPGFDDAGEVVDLIMPNFDDSAEAEEYYKRMIDEYPCHPLLLRNYAQLLQKKGDLYRAEDYYNH  257 (436)
Q Consensus       178 ~p~~a~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~~~~  257 (436)
                      +.+.|...+..++...| .+..+|..+|.++...|++++|+.+|+++++.+|+++.++..+|.++...|++++|+..+.+
T Consensus        14 ~~~~A~~~~~~~l~~~p-~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~   92 (388)
T d1w3ba_          14 DFEAAERHCMQLWRQEP-DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRH   92 (388)
T ss_dssp             CHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccccc
Confidence            44467777888888888 78888999999999999999999999999999999999999999999999999998888877


Q ss_pred             HHHhCCCC--------------------------------------------------------------------HHHH
Q 013800          258 ATMADPGD--------------------------------------------------------------------GESW  269 (436)
Q Consensus       258 al~~~p~~--------------------------------------------------------------------~~~~  269 (436)
                      ++...|..                                                                    +.++
T Consensus        93 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  172 (388)
T d1w3ba_          93 ALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAW  172 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHH
Confidence            76655533                                                                    4556


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCchHHHHHHHHHHHH------------hHHHHcC
Q 013800          270 MQYAKLVWELHRDQHRALTYFERAALAAPQDSNILAAYACFLWEMEDDGEDDKAQEEHIQV------------LPIQSKG  337 (436)
Q Consensus       270 ~~la~~~~~~~~d~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~------------~~~~~~g  337 (436)
                      ..+|.++...+ ++++|...++++++++|++..++..+|.++...|++++|...+.+....            .++...|
T Consensus       173 ~~l~~~~~~~~-~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  251 (388)
T d1w3ba_         173 SNLGCVFNAQG-EIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQG  251 (388)
T ss_dssp             HHHHHHHHTTT-CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTT
T ss_pred             HhhcccccccC-cHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCC
Confidence            66676666665 4888888888888888888888888888888888888888877765554            4555566


Q ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHH----------------------------------HHHHHhcCCHHHHHHHHHH
Q 013800          338 DLEGAEEYFSRAILANPGDGEIMSQYA----------------------------------KLVWELHHDHDKALCYFER  383 (436)
Q Consensus       338 ~~~~A~~~~~~al~~~p~~~~~~~~la----------------------------------~~~~~~g~d~~~A~~~~~~  383 (436)
                      ++++|+..|+++++++|+++.++..+|                                  .++...|+ +++|+..|++
T Consensus       252 ~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~-~~~A~~~~~~  330 (388)
T d1w3ba_         252 LIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGN-IEEAVRLYRK  330 (388)
T ss_dssp             CHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTC-HHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCC-HHHHHHHHHH
Confidence            666666666666666655555555544                                  45555566 7777777777


Q ss_pred             HHHhCCCCHHHHHHHHHHHHHCCChHHHHHHHHHHHhhCCCChhHHh-hhhhc
Q 013800          384 AVQASPADSHVLAAYACFLWETEEDEDDSKSSDQFQQVAPIRQGAVT-TANVY  435 (436)
Q Consensus       384 al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~p~~~~a~~-~an~y  435 (436)
                      +++++|+++.++..+|.++..+|++++|+..|+++++++|++..+.. .+++|
T Consensus       331 al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~  383 (388)
T d1w3ba_         331 ALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTL  383 (388)
T ss_dssp             HTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHH
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHH
Confidence            77777888888888888888888888888888888888888776654 55554



>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure