Citrus Sinensis ID: 014228

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MASRRLLSSLLRSSVRRSPSKSSLSNSSVFSPAATRRASPYGHLLSRVSEYATSAAATAPPAQTPKSDVKKGGGGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQVRMDTSGLMYL
cHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccEEEEEccEEEEEccccccccccEEEEEccccEEEEEEEEcccccEEEEEEcccccccccccEEEEccccEEEcccccccccEEEEcccccccccccccccccccccccccccccccccEEEEEccEEEEEcccccccccEEEEccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHccccccccccccEEEEEEccccccccccHHHHccHHHHHHHHccccccEEEEEEEcEEccccccHHHHHHHcccccccccccccHHHHcHHHHHHcccccccEEEEEEEEEccccccccccccccccccccEEEcccccccccccccc
cHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccEEEEEEEccEEEEEEccccccccEEEEEcccccccEEEEEEEEEccEEEEEEcccccccEcccEEEEEEEEcEEEEcHHHcccEEcccccEccccccccccEEEEcccccccHHHccccccEEccccHHHHHHccEEcccEEEEEEcccccHHHHHHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccccccHHHccccHHHHHHHHHccccccccccEEEEEEEEcHHHccccHHHHHHHHHccEEEEEcHHHHccccccccc
MASRRLLSSLLRSsvrrspsksslsnssvfspaatrraspyghlLSRVSEYatsaaatappaqtpksdvkkggggkitdeftgkgaiGQVCQVIGAVVdvrfdeglppilTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGqrvlntgspitvpvgrVTLGRIMNvigepidekgdlktehylpihreapafvEQATEQQILVTGIKVVdllapyqrggkiglfggagvgKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIklgdkqadsKCALVYgqmneppgararvgltgltvaehfrdaegqdVLLFIDNIFRFTQANSEVSALLgripsavgyqptlatdlgglqeritttkkgsitsvqaiyvpaddltdpapattfahlDATTVLSRQVRmdtsglmyl
masrrllssllrssvrrspsksslsnssvfspaatrraspYGHLLSRVSEYATsaaatappaqtpksdvkkgggGKITdeftgkgaigQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVrgqrvlntgspitvpvgrvTLGRIMNVIgepidekgdLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQmneppgaraRVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERItttkkgsitsVQAIYVPADDLTDPAPATTfahldattvlsrqvrmdtsglmyl
MAsrrllssllrssvrrspsksslsnssVFSPAATRRASPYGHLLSRVSEYatsaaatappaqtpKSDVKKGGGGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQVRMDTSGLMYL
*****************************************************************************TDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVL**************
****************************************************************************************QVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQVRMDTSGLMYL
************************************RASPYGHLLSRVSEYA*********************GGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQVRMDTSGLMYL
*************************************ASPYGHLLSRVSEYATSAAAT*****************KITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQVRMDTSGLMYL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRRLLSSLLRSSVRRSPSKSSLSNSSVFSPAATRRASPYGHLLSRVSEYATSAAATAPPAQTPKSDVKKGGGGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQVRMDTSGLMYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query428 2.2.26 [Sep-21-2011]
P17614 560 ATP synthase subunit beta N/A no 0.969 0.741 0.848 0.0
Q01859 552 ATP synthase subunit beta yes no 0.960 0.744 0.847 0.0
P19023 553 ATP synthase subunit beta N/A no 0.964 0.746 0.856 0.0
P29685 562 ATP synthase subunit beta N/A no 0.885 0.674 0.912 0.0
Q9C5A9 559 ATP synthase subunit beta yes no 0.906 0.694 0.815 0.0
P37399 547 ATP synthase subunit beta N/A no 0.939 0.734 0.783 0.0
P83484 556 ATP synthase subunit beta yes no 0.908 0.699 0.810 0.0
P83483 556 ATP synthase subunit beta yes no 0.908 0.699 0.810 0.0
P38482 574 ATP synthase subunit beta N/A no 0.773 0.576 0.854 1e-164
P10719 529 ATP synthase subunit beta yes no 0.773 0.625 0.834 1e-159
>sp|P17614|ATPBM_NICPL ATP synthase subunit beta, mitochondrial OS=Nicotiana plumbaginifolia GN=ATPB PE=1 SV=1 Back     alignment and function desciption
 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/423 (84%), Positives = 382/423 (90%), Gaps = 8/423 (1%)

Query: 1   MASRRLLSSLLRSSVRRSPS--KSSLSNS-SVFSPAATRRASPYGHLLSRVSEYATSAAA 57
           MASRRLL+SLLR S +R       SL NS    +  A+ RASP G LL+R  +YATSAAA
Sbjct: 1   MASRRLLASLLRQSAQRGGGLISRSLGNSIPKSASRASSRASPKGFLLNRAVQYATSAAA 60

Query: 58  TAPPAQTPKSDVKKGG--GGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEV 115
              PA  P +  K G    GKITDEFTG G+IG+VCQVIGAVVDVRFDEGLPPILTALEV
Sbjct: 61  ---PASQPSTPPKSGSEPSGKITDEFTGAGSIGKVCQVIGAVVDVRFDEGLPPILTALEV 117

Query: 116 VDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVI 175
           +D+ +RLVLEVAQH+GE +VRTIAMDGTEGLVRGQRVLNTGSPITVPVGR TLGRI+NVI
Sbjct: 118 LDNQIRLVLEVAQHLGENMVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRATLGRIINVI 177

Query: 176 GEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGA 235
           GE IDE+G + T+H+LPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGA
Sbjct: 178 GEAIDERGPITTDHFLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGA 237

Query: 236 GVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCA 295
           GVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLG+KQ++SKCA
Sbjct: 238 GVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGEKQSESKCA 297

Query: 296 LVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIP 355
           LVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIP
Sbjct: 298 LVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIP 357

Query: 356 SAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLS 415
           SAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLS
Sbjct: 358 SAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLS 417

Query: 416 RQV 418
           RQ+
Sbjct: 418 RQI 420
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Nicotiana plumbaginifolia (taxid: 4092)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 4
>sp|Q01859|ATPBM_ORYSJ ATP synthase subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=ATPB PE=1 SV=2 Back     alignment and function description
>sp|P19023|ATPBM_MAIZE ATP synthase subunit beta, mitochondrial OS=Zea mays GN=ATPB PE=2 SV=1 Back     alignment and function description
>sp|P29685|ATPBM_HEVBR ATP synthase subunit beta, mitochondrial OS=Hevea brasiliensis GN=ATPB PE=2 SV=1 Back     alignment and function description
>sp|Q9C5A9|ATPBO_ARATH ATP synthase subunit beta-3, mitochondrial OS=Arabidopsis thaliana GN=At5g08680 PE=2 SV=1 Back     alignment and function description
>sp|P37399|ATPBM_DAUCA ATP synthase subunit beta, mitochondrial OS=Daucus carota GN=ATPB PE=3 SV=1 Back     alignment and function description
>sp|P83484|ATPBN_ARATH ATP synthase subunit beta-2, mitochondrial OS=Arabidopsis thaliana GN=At5g08690 PE=1 SV=1 Back     alignment and function description
>sp|P83483|ATPBM_ARATH ATP synthase subunit beta-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08670 PE=1 SV=1 Back     alignment and function description
>sp|P38482|ATPBM_CHLRE ATP synthase subunit beta, mitochondrial OS=Chlamydomonas reinhardtii GN=ATP2 PE=1 SV=1 Back     alignment and function description
>sp|P10719|ATPB_RAT ATP synthase subunit beta, mitochondrial OS=Rattus norvegicus GN=Atp5b PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
242129046 557 ATP synthase beta subunit 1 [Gossypium h 0.974 0.748 0.880 0.0
356575611 559 PREDICTED: ATP synthase subunit beta, mi 0.974 0.745 0.863 0.0
3676296 556 mitochondrial ATPase beta subunit [Nicot 0.967 0.744 0.852 0.0
255582911 561 ATP synthase beta subunit, putative [Ric 0.929 0.709 0.900 0.0
3893824 553 ATPase beta subunit [Nicotiana sylvestri 0.957 0.741 0.845 0.0
3893822 555 ATPase beta subunit [Nicotiana sylvestri 0.964 0.744 0.847 0.0
356536246 559 PREDICTED: ATP synthase subunit beta, mi 0.974 0.745 0.863 0.0
357444609 1127 ATP synthase subunit beta [Medicago trun 0.976 0.370 0.871 0.0
218188864 625 hypothetical protein OsI_03305 [Oryza sa 0.971 0.665 0.852 0.0
115439241 557 Os01g0685800 [Oryza sativa Japonica Grou 0.971 0.746 0.852 0.0
>gi|242129046|gb|ACS83602.1| ATP synthase beta subunit 1 [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/418 (88%), Positives = 385/418 (92%), Gaps = 1/418 (0%)

Query: 1   MASRRLLSSLLRSSVRRSPSKSSLSNSSVFSPAATRRASPYGHLLSRVSEYATSAAATAP 60
           MASRRLLSS LRS+ RRS SKS      + SP+ TRR  P  + LSR +EY+TSAAA A 
Sbjct: 1   MASRRLLSSFLRSTSRRSLSKSPSPTPRLPSPSPTRRPFPCPYFLSRDAEYSTSAAAAAS 60

Query: 61  PAQTPKSDVKKGGGGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSV 120
                    KKGG GKITDEFTG GAIGQVCQVIGAVVDVRFDEGLPPILTALEV+DHS+
Sbjct: 61  APSQ-PPPAKKGGKGKITDEFTGAGAIGQVCQVIGAVVDVRFDEGLPPILTALEVMDHSI 119

Query: 121 RLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPID 180
           RLVLEVAQH+GE +VRTIAMDGTEGLVRGQ VLNTGSPITVPVGR TLGRI+NVIGEPID
Sbjct: 120 RLVLEVAQHLGENMVRTIAMDGTEGLVRGQPVLNTGSPITVPVGRATLGRIINVIGEPID 179

Query: 181 EKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT 240
           EKG+LKT+H+LPIHREAPAFV+QATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT
Sbjct: 180 EKGELKTDHFLPIHREAPAFVDQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT 239

Query: 241 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQ 300
           VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLG+KQADSKCALVYGQ
Sbjct: 240 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGEKQADSKCALVYGQ 299

Query: 301 MNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGY 360
           MNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGY
Sbjct: 300 MNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGY 359

Query: 361 QPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQV 418
           QPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQ+
Sbjct: 360 QPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQI 417

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356575611|ref|XP_003555932.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|3676296|gb|AAD03392.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris] Back     alignment and taxonomy information
>gi|255582911|ref|XP_002532227.1| ATP synthase beta subunit, putative [Ricinus communis] gi|223528084|gb|EEF30158.1| ATP synthase beta subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|3893824|gb|AAD03394.1| ATPase beta subunit [Nicotiana sylvestris] Back     alignment and taxonomy information
>gi|3893822|gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris] Back     alignment and taxonomy information
>gi|356536246|ref|XP_003536650.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357444609|ref|XP_003592582.1| ATP synthase subunit beta [Medicago truncatula] gi|355481630|gb|AES62833.1| ATP synthase subunit beta [Medicago truncatula] Back     alignment and taxonomy information
>gi|218188864|gb|EEC71291.1| hypothetical protein OsI_03305 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115439241|ref|NP_001043900.1| Os01g0685800 [Oryza sativa Japonica Group] gi|113533431|dbj|BAF05814.1| Os01g0685800 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
UNIPROTKB|Q01859 552 ATPB "ATP synthase subunit bet 0.890 0.690 0.884 8.3e-177
TAIR|locus:505006590 556 AT5G08690 [Arabidopsis thalian 0.897 0.690 0.810 2.1e-164
TAIR|locus:504956338 559 AT5G08680 [Arabidopsis thalian 0.901 0.690 0.806 9e-164
RGD|621368 529 Atp5b "ATP synthase, H+ transp 0.773 0.625 0.834 4.2e-143
UNIPROTKB|G3V6D3 529 Atp5b "ATP synthase subunit be 0.773 0.625 0.834 4.2e-143
UNIPROTKB|P06576 529 ATP5B "ATP synthase subunit be 0.773 0.625 0.831 1.1e-142
MGI|MGI:107801 529 Atp5b "ATP synthase, H+ transp 0.773 0.625 0.831 1.1e-142
UNIPROTKB|F1PDB4 527 ATP5B "ATP synthase subunit be 0.773 0.628 0.831 3.7e-142
UNIPROTKB|P00829 528 ATP5B "ATP synthase subunit be 0.768 0.623 0.833 7.8e-142
UNIPROTKB|F1SLA0 528 ATP5B "ATP synthase subunit be 0.773 0.626 0.828 7.8e-142
UNIPROTKB|Q01859 ATPB "ATP synthase subunit beta, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 1717 (609.5 bits), Expect = 8.3e-177, P = 8.3e-177
 Identities = 338/382 (88%), Positives = 353/382 (92%)

Query:    37 RASPYGHLLSRVSEYXXXXXXXXXXXXXXKSDVKKGGGGKITDEFTGKGAIGQVCQVIGA 96
             R SP G+L +R + Y               +  K  GGGKITDEFTG GA+GQVCQVIGA
Sbjct:    32 RPSPSGYLFNRAAAYATAAAAKEAAPPAPATG-KATGGGKITDEFTGAGAVGQVCQVIGA 90

Query:    97 VVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTG 156
             VVDVRFDEGLPPILTALEV+DH++RLVLEVAQH+GE +VRTIAMDGTEGLVRGQRVLNTG
Sbjct:    91 VVDVRFDEGLPPILTALEVLDHNIRLVLEVAQHLGENMVRTIAMDGTEGLVRGQRVLNTG 150

Query:   157 SPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKV 216
             SPITVPVGR TLGRIMNVIGEPIDEKGD+ T H+LPIHREAPAFVEQATEQQILVTGIKV
Sbjct:   151 SPITVPVGRATLGRIMNVIGEPIDEKGDITTNHFLPIHREAPAFVEQATEQQILVTGIKV 210

Query:   217 VDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE 276
             VDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE
Sbjct:   211 VDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE 270

Query:   277 MIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDN 336
             MIESGVIKLGDKQ++SKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDN
Sbjct:   271 MIESGVIKLGDKQSESKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDN 330

Query:   337 IFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDL 396
             IFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDL
Sbjct:   331 IFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDL 390

Query:   397 TDPAPATTFAHLDATTVLSRQV 418
             TDPAPATTFAHLDATTVLSRQ+
Sbjct:   391 TDPAPATTFAHLDATTVLSRQI 412
GO:0005524 "ATP binding" evidence=ISS
GO:0015986 "ATP synthesis coupled proton transport" evidence=IEP;ISS
TAIR|locus:505006590 AT5G08690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956338 AT5G08680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|621368 Atp5b "ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6D3 Atp5b "ATP synthase subunit beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P06576 ATP5B "ATP synthase subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107801 Atp5b "ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDB4 ATP5B "ATP synthase subunit beta" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P00829 ATP5B "ATP synthase subunit beta, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLA0 ATP5B "ATP synthase subunit beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0C100ATPB_HYPNA3, ., 6, ., 3, ., 1, 40.76730.76630.6905yesno
A9WWS2ATPB_BRUSI3, ., 6, ., 3, ., 1, 40.79450.76630.6295yesno
P19023ATPBM_MAIZE3, ., 6, ., 3, ., 1, 40.85640.96490.7468N/Ano
P10719ATPB_RAT3, ., 6, ., 3, ., 1, 40.83480.77330.6257yesno
Q2J3I4ATPB_RHOP23, ., 6, ., 3, ., 1, 40.78540.76860.6911yesno
P37399ATPBM_DAUCA3, ., 6, ., 3, ., 1, 40.78300.93920.7349N/Ano
C3M9S1ATPB_RHISN3, ., 6, ., 3, ., 1, 40.80590.77570.6574yesno
P17614ATPBM_NICPL3, ., 6, ., 3, ., 1, 40.84860.96960.7410N/Ano
P00829ATPB_BOVIN3, ., 6, ., 3, ., 1, 40.83380.76860.6231yesno
Q3SVJ1ATPB_NITWN3, ., 6, ., 3, ., 1, 40.77440.78270.7037yesno
Q4FP38ATPB_PELUB3, ., 6, ., 3, ., 1, 40.80360.76860.6970yesno
Q25117ATPB_HEMPU3, ., 6, ., 3, ., 1, 40.80960.76860.6290N/Ano
Q92LK8ATPB_RHIME3, ., 6, ., 3, ., 1, 40.81190.77570.6587yesno
Q01859ATPBM_ORYSJ3, ., 6, ., 3, ., 1, 40.84720.96020.7445yesno
Q05825ATPB_DROME3, ., 6, ., 3, ., 1, 40.82170.76860.6514yesno
Q6NDD2ATPB_RHOPA3, ., 6, ., 3, ., 1, 40.79150.76860.6911yesno
A3PIB9ATPB1_RHOS13, ., 6, ., 3, ., 1, 40.79450.77100.6947yesno
B6JD09ATPB_OLICO3, ., 6, ., 3, ., 1, 40.78910.77100.6932yesno
Q07UZ5ATPB_RHOP53, ., 6, ., 3, ., 1, 40.78850.76860.6911yesno
Q13DP2ATPB_RHOPS3, ., 6, ., 3, ., 1, 40.78850.76860.6911yesno
A6UDM1ATPB_SINMW3, ., 6, ., 3, ., 1, 40.80890.77570.6522yesno
P83483ATPBM_ARATH3, ., 6, ., 3, ., 1, 40.81010.90880.6996yesno
P46561ATPB_CAEEL3, ., 6, ., 3, ., 1, 40.79000.79670.6338yesno
Q21CY7ATPB_RHOPB3, ., 6, ., 3, ., 1, 40.78540.76860.6911yesno
P05038ATPB_RHORU3, ., 6, ., 3, ., 1, 40.77080.77570.7004yesno
Q11DD5ATPB_MESSB3, ., 6, ., 3, ., 1, 40.78040.78270.6454yesno
P83484ATPBN_ARATH3, ., 6, ., 3, ., 1, 40.81010.90880.6996yesno
Q9C5A9ATPBO_ARATH3, ., 6, ., 3, ., 1, 40.81560.90650.6940yesno
Q8YJ35ATPB_BRUME3, ., 6, ., 3, ., 1, 40.79450.76630.6295yesno
A5VSE1ATPB_BRUO23, ., 6, ., 3, ., 1, 40.79450.76630.6295yesno
Q3J431ATPB1_RHOS43, ., 6, ., 3, ., 1, 40.79450.77100.6947yesno
P72247ATPB_RHOCA3, ., 6, ., 3, ., 1, 40.78240.77100.6991yesno
Q5ZLC5ATPB_CHICK3, ., 6, ., 3, ., 1, 40.82770.76860.6172yesno
Q8UC76ATPB_AGRT53, ., 6, ., 3, ., 1, 40.76190.79900.7066yesno
P00830ATPB_YEAST3, ., 6, ., 3, ., 1, 40.78010.76630.6418yesno
P56480ATPB_MOUSE3, ., 6, ., 3, ., 1, 40.83180.77330.6257yesno
Q9PTY0ATPB_CYPCA3, ., 6, ., 3, ., 1, 40.82470.76860.6351N/Ano
A1UR49ATPB_BARBK3, ., 6, ., 3, ., 1, 40.71420.82940.6610yesno
Q2RV18ATPB_RHORT3, ., 6, ., 3, ., 1, 40.77080.77570.7004yesno
P06576ATPB_HUMAN3, ., 6, ., 3, ., 1, 40.83180.77330.6257yesno
P22068ATPB_SCHPO3, ., 6, ., 3, ., 1, 40.78440.76630.6247yesno
P49376ATPB_KLULA3, ., 6, ., 3, ., 1, 40.78010.76630.6495yesno
P23704ATPB_NEUCR3, ., 6, ., 3, ., 1, 40.77400.76630.6319N/Ano
Q8FYR5ATPB_BRUSU3, ., 6, ., 3, ., 1, 40.79450.76630.6295yesno
A7HT52ATPB_PARL13, ., 6, ., 3, ., 1, 40.77740.77570.6945yesno
A7IH31ATPB_XANP23, ., 6, ., 3, ., 1, 40.77970.77330.6924yesno
P29685ATPBM_HEVBR3, ., 6, ., 3, ., 1, 40.91290.88550.6743N/Ano
A4WUM7ATPB_RHOS53, ., 6, ., 3, ., 1, 40.77640.77100.6947yesno
A6WXX1ATPB_OCHA43, ., 6, ., 3, ., 1, 40.78200.77570.6421yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3.140.991
3rd Layer3.6.30.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
LOC_Os01g49190.1
ATP synthase, putative, expressed; Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity) (557 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
4348305
ATP synthase gamma chain, putative, expressed; Produces ATP from ADP in the presence of a proto [...] (324 aa)
• ••••• 0.878
4343366
ATP synthase gamma chain, putative, expressed; Produces ATP from ADP in the presence of a proto [...] (358 aa)
• • • • 0.870
4336245
4-nitrophenylphosphatase, putative, expressed (365 aa)
      • 0.742
4342714
NAD dependent epimerase/dehydratase family protein, putative, expressed (392 aa)
      • 0.669
4329578
peroxiredoxin, putative, expressed; May be an antioxidant enzyme particularly in the developing [...] (261 aa)
      • 0.663
4341660
ATP synthase F1, delta subunit family protein, putative, expressed (225 aa)
•  •• • 0.589
LOC_Os03g48471.1
ATP synthase subunit alpha, putative (190 aa)
  •     0.463
4330737
ATP synthase F1, delta subunit family protein, putative, expressed (243 aa)
•     • 0.453
3950678
ATP synthase F0 subunit 1; Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Comple [...] (509 aa)
• • • ••0.440
LOC_Os09g08910.1
ATP synthase, putative, expressed; Produces ATP from ADP in the presence of a proton gradient a [...] (509 aa)
• • • ••0.437

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
PRK09280 463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 0.0
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 0.0
TIGR01039 461 TIGR01039, atpD, ATP synthase, F1 beta subunit 0.0
CHL00060 494 CHL00060, atpB, ATP synthase CF1 beta subunit 0.0
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subu 0.0
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 0.0
TIGR03305 449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 1e-134
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 5e-70
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III sec 3e-53
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flag 1e-47
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export A 6e-46
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-45
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export A 5e-44
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion appara 2e-43
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export A 3e-43
PRK06936439 PRK06936, PRK06936, type III secretion system ATPa 2e-38
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; V 6e-38
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; V 1e-37
PRK06820440 PRK06820, PRK06820, type III secretion system ATPa 1e-35
PRK06315442 PRK06315, PRK06315, type III secretion system ATPa 4e-34
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; V 8e-32
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; V 1e-31
PRK09099441 PRK09099, PRK09099, type III secretion system ATPa 4e-31
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; V 4e-31
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; V 6e-31
PRK07594433 PRK07594, PRK07594, type III secretion system ATPa 6e-30
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; V 4e-29
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 1e-28
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 1e-26
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; V 3e-26
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 2e-25
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 2e-25
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 5e-25
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 1e-23
PRK05922434 PRK05922, PRK05922, type III secretion system ATPa 5e-23
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 3e-22
TIGR03324 497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 5e-21
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 1e-20
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 2e-20
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 2e-19
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; V 2e-19
TIGR01043 578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, 2e-19
COG1155 588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su 8e-18
TIGR01042 591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A 6e-17
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catal 7e-17
PRK02118 436 PRK02118, PRK02118, V-type ATP synthase subunit B; 6e-16
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta 6e-16
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 1e-15
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 5e-15
pfam1142148 pfam11421, Synthase_beta, ATP synthase F1 beta sub 1e-13
PTZ00185 574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisio 2e-12
PRK14698 1017 PRK14698, PRK14698, V-type ATP synthase subunit A; 1e-11
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 5e-11
PRK04192 586 PRK04192, PRK04192, V-type ATP synthase subunit A; 2e-09
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
PRK14698 1017 PRK14698, PRK14698, V-type ATP synthase subunit A; 4e-04
PRK12608380 PRK12608, PRK12608, transcription termination fact 0.004
cd01128249 cd01128, rho_factor, Transcription termination fac 0.004
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information 
 Score =  687 bits (1776), Expect = 0.0
 Identities = 250/336 (74%), Positives = 282/336 (83%), Gaps = 10/336 (2%)

Query: 85  GAIGQVCQVIGAVVDVRFDEG-LPPILTALEVVD-HSVRLVLEVAQHMGEGVVRTIAMDG 142
              G++ QVIG VVDV F  G LP I  ALEV      +LVLEVAQH+G+GVVRTIAM  
Sbjct: 1   MNTGKIVQVIGPVVDVEFPRGELPKIYNALEVEKGDGKKLVLEVAQHLGDGVVRTIAMGS 60

Query: 143 TEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVE 202
           T+GLVRG  V++TG+PI+VPVG+ TLGRI NV+GEPIDEKG +  E   PIHR+AP+F E
Sbjct: 61  TDGLVRGMEVIDTGAPISVPVGKATLGRIFNVLGEPIDEKGPIGAEERWPIHRKAPSFEE 120

Query: 203 QATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAG 262
            +T+ +IL TGIKV+DLLAPY +GGKIGLFGGAGVGKTVLI ELINN+AK HGG+SVFAG
Sbjct: 121 LSTKTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGYSVFAG 180

Query: 263 VGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHF 322
           VGERTREGNDLY EM ESGV+         K ALV+GQMNEPPGAR RV LTGLT+AE+F
Sbjct: 181 VGERTREGNDLYHEMKESGVLD--------KTALVFGQMNEPPGARLRVALTGLTMAEYF 232

Query: 323 RDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGS 382
           RD EGQDVLLFIDNIFRFTQA SEVSALLGR+PSAVGYQPTLAT++G LQERIT+TKKGS
Sbjct: 233 RDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGS 292

Query: 383 ITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQV 418
           ITSVQA+YVPADDLTDPAPATTFAHLDATTVLSRQ+
Sbjct: 293 ITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQI 328

Length = 463
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|204648 pfam11421, Synthase_beta, ATP synthase F1 beta subunit Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|237150 PRK12608, PRK12608, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|238548 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 428
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 100.0
KOG1350 521 consensus F0F1-type ATP synthase, beta subunit [En 100.0
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 100.0
CHL00060 494 atpB ATP synthase CF1 beta subunit 100.0
PTZ00185 574 ATPase alpha subunit; Provisional 100.0
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 100.0
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 100.0
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 100.0
PRK02118 436 V-type ATP synthase subunit B; Provisional 100.0
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 100.0
PRK04196 460 V-type ATP synthase subunit B; Provisional 100.0
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 100.0
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 100.0
CHL00059 485 atpA ATP synthase CF1 alpha subunit 100.0
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 100.0
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
PRK08972444 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 100.0
PRK08927442 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 100.0
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 100.0
PRK04192 586 V-type ATP synthase subunit A; Provisional 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 100.0
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 100.0
PRK06820440 type III secretion system ATPase; Validated 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07594433 type III secretion system ATPase SsaN; Validated 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
PRK08472434 fliI flagellum-specific ATP synthase; Validated 100.0
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 100.0
PRK08149428 ATP synthase SpaL; Validated 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 100.0
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07721438 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 100.0
PRK14698 1017 V-type ATP synthase subunit A; Provisional 100.0
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 100.0
COG1155 588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 100.0
PRK12608380 transcription termination factor Rho; Provisional 100.0
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 100.0
KOG1352 618 consensus Vacuolar H+-ATPase V1 sector, subunit A 100.0
KOG1351 489 consensus Vacuolar H+-ATPase V1 sector, subunit B 100.0
PRK09376416 rho transcription termination factor Rho; Provisio 100.0
PRK12678672 transcription termination factor Rho; Provisional 100.0
TIGR00767415 rho transcription termination factor Rho. Members 100.0
cd01128249 rho_factor Transcription termination factor rho is 100.0
COG1158422 Rho Transcription termination factor [Transcriptio 100.0
KOG1353340 consensus F0F1-type ATP synthase, alpha subunit [E 99.96
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.8
KOG2028 554 consensus ATPase related to the helicase subunit o 99.63
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.38
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.2
PRK13341 725 recombination factor protein RarA/unknown domain f 98.96
PRK13342 413 recombination factor protein RarA; Reviewed 98.95
PF0287469 ATP-synt_ab_N: ATP synthase alpha/beta family, bet 98.67
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 98.53
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.5
PF1142149 Synthase_beta: ATP synthase F1 beta subunit; Inter 98.47
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.44
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.41
smart00382148 AAA ATPases associated with a variety of cellular 98.38
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.33
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 98.33
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.29
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.26
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.26
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 98.24
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.23
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.23
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.21
PLN03025319 replication factor C subunit; Provisional 98.21
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.2
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.12
cd01394218 radB RadB. The archaeal protein radB shares simila 98.11
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.1
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.08
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.07
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.06
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.04
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.04
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.03
PF00004132 AAA: ATPase family associated with various cellula 98.02
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.0
PRK08084235 DNA replication initiation factor; Provisional 97.99
PRK06893229 DNA replication initiation factor; Validated 97.97
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.96
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.92
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.91
PRK06067234 flagellar accessory protein FlaH; Validated 97.9
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.89
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.88
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.85
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.8
PRK09302509 circadian clock protein KaiC; Reviewed 97.8
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.8
PRK12402337 replication factor C small subunit 2; Reviewed 97.76
PRK08181269 transposase; Validated 97.75
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.74
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.71
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.7
PHA02544316 44 clamp loader, small subunit; Provisional 97.68
PRK09302 509 circadian clock protein KaiC; Reviewed 97.68
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.68
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.67
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.66
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.65
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.65
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.65
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.63
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.63
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.62
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.59
PRK10865 857 protein disaggregation chaperone; Provisional 97.57
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.56
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.55
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.55
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.55
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.54
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.54
PRK00440319 rfc replication factor C small subunit; Reviewed 97.5
PRK06526254 transposase; Provisional 97.5
PRK09354 349 recA recombinase A; Provisional 97.48
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.48
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.48
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.47
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.46
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.45
PRK00149450 dnaA chromosomal replication initiation protein; R 97.44
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.44
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.43
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 97.43
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.43
PF13173128 AAA_14: AAA domain 97.43
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.42
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.41
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 97.41
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.4
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.38
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.38
PRK04328249 hypothetical protein; Provisional 97.36
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.35
PRK12377248 putative replication protein; Provisional 97.35
PRK08727233 hypothetical protein; Validated 97.33
PRK09183259 transposase/IS protein; Provisional 97.31
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.3
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.3
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.29
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.29
PRK06921266 hypothetical protein; Provisional 97.29
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.25
PRK14087 450 dnaA chromosomal replication initiation protein; P 97.24
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.2
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.19
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.17
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.14
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.14
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.14
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.12
PRK04195 482 replication factor C large subunit; Provisional 97.1
PF05729166 NACHT: NACHT domain 97.1
PRK05564313 DNA polymerase III subunit delta'; Validated 97.1
PRK05973237 replicative DNA helicase; Provisional 97.09
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.09
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.09
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.09
PRK14086617 dnaA chromosomal replication initiation protein; P 97.08
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.06
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.05
PRK08118167 topology modulation protein; Reviewed 97.04
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.01
PRK09112 351 DNA polymerase III subunit delta'; Validated 96.99
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 96.99
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 96.99
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.96
PRK11823 446 DNA repair protein RadA; Provisional 96.95
CHL00181287 cbbX CbbX; Provisional 96.95
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.94
PTZ00035337 Rad51 protein; Provisional 96.93
PRK05642234 DNA replication initiation factor; Validated 96.92
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.9
PRK08939306 primosomal protein DnaI; Reviewed 96.87
PRK07471 365 DNA polymerase III subunit delta'; Validated 96.84
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 96.83
PHA00729226 NTP-binding motif containing protein 96.83
PLN03186342 DNA repair protein RAD51 homolog; Provisional 96.83
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.82
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.82
PRK03992389 proteasome-activating nucleotidase; Provisional 96.81
PRK12422 445 chromosomal replication initiation protein; Provis 96.8
CHL00095 821 clpC Clp protease ATP binding subunit 96.8
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.78
COG0593 408 DnaA ATPase involved in DNA replication initiation 96.76
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.76
PRK08058329 DNA polymerase III subunit delta'; Validated 96.74
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.73
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 96.7
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 96.67
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.67
PRK05707 328 DNA polymerase III subunit delta'; Validated 96.66
PRK07952244 DNA replication protein DnaC; Validated 96.64
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.63
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.61
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 96.57
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.55
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.54
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 96.51
PF00154322 RecA: recA bacterial DNA recombination protein; In 96.5
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.49
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.46
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.45
CHL00195489 ycf46 Ycf46; Provisional 96.43
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.43
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.4
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 96.38
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.37
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.37
PRK08116268 hypothetical protein; Validated 96.36
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.34
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 96.34
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 96.32
CHL00176 638 ftsH cell division protein; Validated 96.31
PRK06835329 DNA replication protein DnaC; Validated 96.28
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.28
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.25
PRK13531 498 regulatory ATPase RavA; Provisional 96.24
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.21
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.2
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.19
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 96.09
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.07
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.04
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.04
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 96.03
cd03115173 SRP The signal recognition particle (SRP) mediates 96.02
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.02
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.0
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.98
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.96
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 95.95
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.94
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.92
PRK14974336 cell division protein FtsY; Provisional 95.92
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.9
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 95.88
PTZ00112 1164 origin recognition complex 1 protein; Provisional 95.88
PRK06871325 DNA polymerase III subunit delta'; Validated 95.77
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 95.7
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.69
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.66
PRK07261171 topology modulation protein; Provisional 95.65
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.63
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.62
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.53
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.51
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.5
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 95.5
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.49
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 95.47
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.46
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 95.45
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 95.45
TIGR00665434 DnaB replicative DNA helicase. This model describe 95.45
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 95.43
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.4
PRK00889175 adenylylsulfate kinase; Provisional 95.39
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.35
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 95.34
PRK10416318 signal recognition particle-docking protein FtsY; 95.31
PRK07993 334 DNA polymerase III subunit delta'; Validated 95.29
KOG1969 877 consensus DNA replication checkpoint protein CHL12 95.26
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 95.25
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.25
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 95.21
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.2
PRK08699 325 DNA polymerase III subunit delta'; Validated 95.19
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.18
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 95.18
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 95.17
PRK06620214 hypothetical protein; Validated 95.17
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 95.13
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 95.13
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 95.11
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.11
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.1
PRK14530215 adenylate kinase; Provisional 95.08
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.08
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.06
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 95.05
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 95.04
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 95.03
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 95.03
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 95.03
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 95.02
TIGR00064272 ftsY signal recognition particle-docking protein F 95.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.97
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.97
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.97
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 94.97
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.96
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.95
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.94
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.94
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.92
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.92
PRK14531183 adenylate kinase; Provisional 94.92
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 94.9
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 94.9
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.88
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.87
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.87
PRK04841 903 transcriptional regulator MalT; Provisional 94.86
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 94.86
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.86
PRK05748448 replicative DNA helicase; Provisional 94.86
COG4619223 ABC-type uncharacterized transport system, ATPase 94.84
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.84
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.83
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.82
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 94.82
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.81
PRK09087226 hypothetical protein; Validated 94.81
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.81
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 94.81
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.78
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 94.77
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.76
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.76
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.75
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.75
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.75
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 94.73
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 94.73
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.71
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 94.7
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.7
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 94.69
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 94.69
PRK00131175 aroK shikimate kinase; Reviewed 94.69
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.69
PRK05541176 adenylylsulfate kinase; Provisional 94.69
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 94.66
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.65
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.65
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.65
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.64
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 94.64
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 94.64
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.63
PRK07399314 DNA polymerase III subunit delta'; Validated 94.6
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.58
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 94.58
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.58
cd03246173 ABCC_Protease_Secretion This family represents the 94.57
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.56
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 94.55
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.54
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.53
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.53
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 94.51
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.5
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.5
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 94.5
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 94.5
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 94.49
PRK03839180 putative kinase; Provisional 94.49
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.49
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 94.49
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.48
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.48
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 94.47
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.47
PRK03846198 adenylylsulfate kinase; Provisional 94.46
PF1324576 AAA_19: Part of AAA domain 94.45
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 94.45
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.45
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 94.45
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.44
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 94.42
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 94.41
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.4
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.4
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.4
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 94.39
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.39
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 94.39
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 94.38
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 94.37
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 94.37
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 94.36
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.36
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.35
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 94.34
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 94.34
PRK10908222 cell division protein FtsE; Provisional 94.34
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 94.34
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 94.34
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 94.33
PRK08769319 DNA polymerase III subunit delta'; Validated 94.33
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 94.32
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 94.32
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 94.32
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.32
PRK14532188 adenylate kinase; Provisional 94.32
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 94.31
PRK14242253 phosphate transporter ATP-binding protein; Provisi 94.31
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 94.3
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 94.29
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 94.29
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 94.29
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 94.27
COG4525259 TauB ABC-type taurine transport system, ATPase com 94.27
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 94.26
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.26
PRK06217183 hypothetical protein; Validated 94.23
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 94.23
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 94.22
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.22
PRK14241258 phosphate transporter ATP-binding protein; Provisi 94.21
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 94.21
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 94.2
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 94.19
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 94.19
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.19
PRK14240250 phosphate transporter ATP-binding protein; Provisi 94.19
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 94.17
PTZ00088229 adenylate kinase 1; Provisional 94.16
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.15
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 94.15
PRK00300205 gmk guanylate kinase; Provisional 94.14
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 94.14
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 94.13
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.13
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 94.12
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.12
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 94.12
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 94.11
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 94.11
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 94.11
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 94.11
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 94.1
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 94.1
PRK10253265 iron-enterobactin transporter ATP-binding protein; 94.09
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.09
PRK14239252 phosphate transporter ATP-binding protein; Provisi 94.09
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 94.08
PRK08233182 hypothetical protein; Provisional 94.08
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 94.08
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.08
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 94.06
PF07726131 AAA_3: ATPase family associated with various cellu 94.06
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 94.06
PRK14237267 phosphate transporter ATP-binding protein; Provisi 94.05
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 94.04
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 94.04
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 94.04
COG4988559 CydD ABC-type transport system involved in cytochr 94.03
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.03
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 94.02
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 94.01
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 94.01
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 94.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.99
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 93.99
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 93.98
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 93.98
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 93.98
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 93.98
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 93.98
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 93.98
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 93.96
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 93.96
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 93.95
PRK02496184 adk adenylate kinase; Provisional 93.95
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 93.94
COG1127263 Ttg2A ABC-type transport system involved in resist 93.94
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 93.93
cd03234226 ABCG_White The White subfamily represents ABC tran 93.92
PHA02542473 41 41 helicase; Provisional 93.92
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.92
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.91
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 93.91
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.91
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 93.9
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 93.89
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=9e-94  Score=711.06  Aligned_cols=328  Identities=77%  Similarity=1.143  Sum_probs=317.2

Q ss_pred             ceeeEEEEECCEEEEEeCC--CCchhhhceEEeeccc-eeEEEEeeecCCceEEEEEecCccCCcCCCEEEecCCCcccc
Q 014228           86 AIGQVCQVIGAVVDVRFDE--GLPPILTALEVVDHSV-RLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVP  162 (428)
Q Consensus        86 ~~G~V~~V~G~vv~v~f~~--glp~i~~~l~v~~~~~-~~~~EVv~~l~~~~v~~i~l~~t~GL~~G~~V~~TG~~l~VP  162 (428)
                      +.|+|+||+|+||||+|++  .+|.|++++++..... ++++||++|+|++.||+|+|+.|+||.+|+.|.+||+|++||
T Consensus         2 ~~G~vvqv~g~VvdV~F~~~~~lP~I~naL~~~~~~~~~~~leV~q~lg~~~VR~Iam~~t~gl~rg~~v~dtg~pi~VP   81 (468)
T COG0055           2 NKGKVVQVIGPVVDVEFPEEDELPEIYNALEVQNGNQGTLVLEVAQHLGDNVVRTIAMGSTDGLVRGLEVIDTGKPISVP   81 (468)
T ss_pred             CCceEEEEEeeEEEEEecCcccCchhhhhheeccCCcceEeeehHHHhCCCeEEEEEecCccCcccCcEEecCCCceEEe
Confidence            4699999999999999983  4999999999976532 489999999999999999999999999999999999999999


Q ss_pred             CCccccceEEEEeccccccCCCCCCc--cccccccCCCcchhcccccceeeccceeeccccccCCCceeEEECCCCCChh
Q 014228          163 VGRVTLGRIMNVIGEPIDEKGDLKTE--HYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT  240 (428)
Q Consensus       163 VG~~lLGRVlD~lG~PiD~~~~i~~~--~~~pi~~~~P~~ler~~~qe~L~TGikvID~l~pigrGqri~IfG~~G~GKT  240 (428)
                      ||+++||||+|++|+|||+.+++..+  ++||||+.+|...+.....|.|+||||+||.|+|+.||+|+||||++|||||
T Consensus        82 VG~~~lgri~nvlG~~iD~~~~~~~~~~~~~~Ih~~~p~~~e~~~~~EIleTGIKVIDll~P~~kGgKiGLFGGAGVGKT  161 (468)
T COG0055          82 VGKGTLGRIFNVLGEPIDEKGPIKAEDFEKWPIHRKAPSFEELSTKTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKT  161 (468)
T ss_pred             cchhhcccchhccCCcccccCCCCccccceeeccCCCCchhhcccchhhhhhCceEEEEecccccCceeeeeccCCccce
Confidence            99999999999999999999999866  8999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCcEEEEEeecCCcchHHHHHHHHHHccccccCcccCCCeEEEEEecCCCCHHHHHHHHHHHHHHHH
Q 014228          241 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAE  320 (428)
Q Consensus       241 tLa~~ii~n~~~~~~~~~V~~giGeR~~Ev~dl~~el~e~~~~~~~~~~~~~~tvvv~~t~d~p~~~r~~~~~~a~tiAE  320 (428)
                      +|++++|+|.++.|.+++||+|+|||+||.+|+|+||.+++++        +++++|++||||||++|++++++|+|+||
T Consensus       162 Vl~~ELI~Nia~~h~g~SVFaGvGERtREGndLy~Em~es~vl--------~ktalv~gQMNEpPGaR~RValtGlT~AE  233 (468)
T COG0055         162 VLIQELINNIAKEHGGYSVFAGVGERTREGNDLYHEMKESGVL--------DKTALVFGQMNEPPGARMRVALTGLTMAE  233 (468)
T ss_pred             eeHHHHHHHHHHHcCCeEEEEeccccccchHHHHHHHHhcCCC--------CceeEEEeecCCCCcceeeehhhhhhHHH
Confidence            9999999999999999999999999999999999999999854        59999999999999999999999999999


Q ss_pred             HHHHhCCCcEEEEEeCchhHHHHHHHhHHhcCCCCCCCCCCCChhHhHHHHHHhhcCCCCccEeEEEEEEecCCCCCCch
Q 014228          321 HFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPA  400 (428)
Q Consensus       321 yfrd~~Gk~VLL~iDditRfa~A~reis~llgr~p~~~gyp~~l~~~l~~l~ERa~~~~~GSIT~i~~v~~~~dD~~dpi  400 (428)
                      ||||++|+|||||+|+|+||.+|.+|+|+||||+||.+||||+|.++++.|+||+.++++||||++|+||+|+||+|||.
T Consensus       234 yfRD~~gqdVLlFIDNIfRftQAGsEVSalLGr~PSavGYQpTLatemg~lQERItstk~GSITSiQavyvPaDDlTDPa  313 (468)
T COG0055         234 YFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSVQAVYVPADDLTDPA  313 (468)
T ss_pred             HhhcccCCeEEEEehhhhHHhhcchHHHHHhccCccccccCchhHHHHHHHHHHHhcCCCCceEEEEEEEeccccCCCcc
Confidence            99998899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccccCeEEEeehhhhhc
Q 014228          401 PATTFAHLDATTVLSRQVRMD  421 (428)
Q Consensus       401 ~~~~~~~ld~~ivLsR~la~~  421 (428)
                      |.++|+|||+++||||+||+.
T Consensus       314 pattFaHLDat~vLsR~ia~~  334 (468)
T COG0055         314 PATTFAHLDATTVLSRQIAAL  334 (468)
T ss_pred             hhhhhhhcccceeeeHhHHhc
Confidence            999999999999999999974

>KOG1350 consensus F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>KOG1352 consensus Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] Back     alignment and domain information
>KOG1351 consensus Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>KOG1353 consensus F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF11421 Synthase_beta: ATP synthase F1 beta subunit; InterPro: IPR020971 F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
1mab_B 479 Rat Liver F1-Atpase Length = 479 1e-159
1nbm_D 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 1e-158
1cow_D 482 Bovine Mitochondrial F1-Atpase Complexed With Aurov 1e-157
4asu_D 480 F1-Atpase In Which All Three Catalytic Sites Contai 1e-157
2w6e_D 528 Low Resolution Structures Of Bovine Mitochondrial F 1e-157
2xnd_D 467 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 1e-157
1nbm_E 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 1e-157
2xok_D 511 Refined Structure Of Yeast F1c10 Atpase Complex To 1e-147
4b2q_D 470 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-147
3fks_D 484 Yeast F1 Atpase In The Absence Of Bound Nucleotides 1e-147
2hld_D 478 Crystal Structure Of Yeast Mitochondrial F1-Atpase 1e-147
4b2q_E 473 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-147
3oeh_D 484 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-146
2qe7_D 462 Crystal Structure Of The F1-Atpase From The Thermoa 1e-128
1sky_E 473 Crystal Structure Of The Nucleotide Free Alpha3beta 1e-127
3oaa_D 459 Structure Of The E.Coli F1-Atp Synthase Inhibited B 1e-121
1fx0_B 498 Crystal Structure Of The Chloroplast F1-Atpase From 1e-120
2obl_A347 Structural And Biochemical Analysis Of A Prototypic 2e-26
2dpy_A438 Crystal Structure Of The Flagellar Type Iii Atpase 2e-21
3a5c_A 578 Inter-Subunit Interaction And Quaternary Rearrangem 2e-20
3mfy_A 588 Structural Characterization Of The Subunit A Mutant 3e-20
3m4y_A 588 Structural Characterization Of The Subunit A Mutant 8e-20
3gqb_A 578 Crystal Structure Of The A3b3 Complex From V-atpase 1e-19
3ikj_A 588 Structural Characterization For The Nucleotide Bind 1e-19
1vdz_A 588 Crystal Structure Of A-Type Atpase Catalytic Subuni 1e-19
3se0_A 588 Structural Characterization Of The Subunit A Mutant 1e-19
3sdz_A 588 Structural Characterization Of The Subunit A Mutant 1e-19
3i4l_A 588 Structural Characterization For The Nucleotide Bind 1e-19
3vr6_D 465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 4e-19
3oaa_A 513 Structure Of The E.Coli F1-Atp Synthase Inhibited B 5e-19
3nd9_A 588 Structural Characterization For The Nucleotide Bind 5e-19
3qjy_A 588 Crystal Structure Of P-Loop G234a Mutant Of Subunit 5e-19
3qia_A 588 Crystal Structure Of P-Loop G237a Mutant Of Subunit 5e-19
3qg1_A 588 Crystal Structure Of P-Loop G239a Mutant Of Subunit 6e-19
3nd8_A 588 Structural Characterization For The Nucleotide Bind 7e-19
2qe7_A 502 Crystal Structure Of The F1-Atpase From The Thermoa 7e-18
3gqb_B 464 Crystal Structure Of The A3b3 Complex From V-atpase 8e-18
3a5c_D 478 Inter-Subunit Interaction And Quaternary Rearrangem 1e-17
2r9v_A 515 Crystal Structure Of Atp Synthase Subunit Alpha (Tm 9e-17
3ssa_A 460 Crystal Structure Of Subunit B Mutant N157t Of The 1e-16
3vr6_A 600 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 2e-16
1sky_B 502 Crystal Structure Of The Nucleotide Free Alpha3beta 2e-16
3vr2_D 465 Crystal Structure Of Nucleotide-free A3b3 Complex F 3e-16
2rkw_A 469 Intermediate Position Of Atp On Its Trail To The Bi 3e-16
2c61_A 469 Crystal Structure Of The Non-Catalytic B Subunit Of 3e-16
3tiv_A 460 Crystal Structure Of Subunit B Mutant N157a Of The 4e-16
3tgw_A 460 Crystal Structure Of Subunit B Mutant H156a Of The 4e-16
3vr2_A 600 Crystal Structure Of Nucleotide-free A3b3 Complex F 7e-16
2xnd_A 492 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 2e-15
1ohh_B 487 Bovine Mitochondrial F1-Atpase Complexed With The I 2e-15
2jiz_A 510 The Structure Of F1-Atpase Inhibited By Resveratrol 2e-15
1cow_A 510 Bovine Mitochondrial F1-Atpase Complexed With Aurov 2e-15
1bmf_A 510 Bovine Mitochondrial F1-Atpase Length = 510 2e-15
2w6e_A 553 Low Resolution Structures Of Bovine Mitochondrial F 3e-15
1mab_A 510 Rat Liver F1-Atpase Length = 510 6e-15
2f43_A 510 Rat Liver F1-atpase Length = 510 6e-15
4b2q_A 485 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-14
4b2q_B 486 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-14
2hld_A 510 Crystal Structure Of Yeast Mitochondrial F1-Atpase 1e-14
3oee_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-14
3ofn_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-14
2xok_A 545 Refined Structure Of Yeast F1c10 Atpase Complex To 2e-14
1fx0_A 507 Crystal Structure Of The Chloroplast F1-Atpase From 9e-13
>pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 Back     alignment and structure 
Iteration: 1

 Score =  557 bits (1436), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/333 (83%), Positives = 299/333 (89%), Gaps = 2/333 (0%)
Query: 86  AIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEG 145
           A GQ+  VIGAVVDV+FDEGLPPIL ALEV     RLVLEVAQH+GE  VRTIAMDGTEG
Sbjct: 9   ATGQIVAVIGAVVDVQFDEGLPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEG 68
Query: 146 LVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQAT 205
           LVRGQ+VL++G+PI +PVG  TLGRIMNVIGEPIDE+G +KT+ + PIH EAP F+E + 
Sbjct: 69  LVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSV 128
Query: 206 EQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGE 265
           EQ+ILVTGIKVVDLLAPY +GGKIGLFGGAGVGKTVLIMELINNVAKAHGG+SVFAGVGE
Sbjct: 129 EQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGE 188
Query: 266 RTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDA 325
           RTREGNDLY EMIESGVI L D  A SK ALVYGQMNEPPGARARV LTGLTVAE+FRD 
Sbjct: 189 RTREGNDLYHEMIESGVINLKD--ATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQ 246
Query: 326 EGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITS 385
           EGQDVLLFIDNIFRFTQA SEVSALLGRIPSAVGYQPTLATD+G +QERITTTKKGSITS
Sbjct: 247 EGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITS 306
Query: 386 VQAIYVPADDLTDPAPATTFAHLDATTVLSRQV 418
           VQAIYVPADDLTDPAPATTFAHLDATTVLSR +
Sbjct: 307 VQAIYVPADDLTDPAPATTFAHLDATTVLSRAI 339
>pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 Back     alignment and structure
>pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 Back     alignment and structure
>pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 Back     alignment and structure
>pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 Back     alignment and structure
>pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 Back     alignment and structure
>pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 Back     alignment and structure
>pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 Back     alignment and structure
>pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 Back     alignment and structure
>pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 Back     alignment and structure
>pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 Back     alignment and structure
>pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 Back     alignment and structure
>pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 Back     alignment and structure
>pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 Back     alignment and structure
>pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 Back     alignment and structure
>pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 Back     alignment and structure
>pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 Back     alignment and structure
>pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 Back     alignment and structure
>pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 Back     alignment and structure
>pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 Back     alignment and structure
>pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 Back     alignment and structure
>pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure
>pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 Back     alignment and structure
>pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 Back     alignment and structure
>pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 Back     alignment and structure
>pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 Back     alignment and structure
>pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 Back     alignment and structure
>pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 Back     alignment and structure
>pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 Back     alignment and structure
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure
>pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 Back     alignment and structure
>pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 Back     alignment and structure
>pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 Back     alignment and structure
>pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 Back     alignment and structure
>pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 Back     alignment and structure
>pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 Back     alignment and structure
>pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 Back     alignment and structure
>pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 Back     alignment and structure
>pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 Back     alignment and structure
>pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 Back     alignment and structure
>pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 Back     alignment and structure
>pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 Back     alignment and structure
>pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 Back     alignment and structure
>pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 Back     alignment and structure
>pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 Back     alignment and structure
>pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 0.0
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 0.0
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 0.0
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 1e-123
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 1e-06
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 1e-120
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 4e-12
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 1e-85
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 3e-57
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 2e-49
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 3e-49
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 3e-20
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 4e-20
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 6e-20
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 6e-19
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 7e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1pyv_A54 ATP synthase beta chain, mitochondrial precursor; 2e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 Back     alignment and structure
 Score =  709 bits (1831), Expect = 0.0
 Identities = 276/345 (80%), Positives = 299/345 (86%), Gaps = 2/345 (0%)

Query: 74  GGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEG 133
             + +         G++  VIGAVVDV+FDEGLPPIL ALEV     RLVLEVAQH+GE 
Sbjct: 1   AAQASPSPKAGATTGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGES 60

Query: 134 VVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPI 193
            VRTIAMDGTEGLVRGQ+VL++G+PI +PVG  TLGRIMNVIGEPIDE+G +KT+ +  I
Sbjct: 61  TVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAI 120

Query: 194 HREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKA 253
           H EAP FVE + EQ+ILVTGIKVVDLLAPY +GGKIGLFGGAGVGKTVLIMELINNVAKA
Sbjct: 121 HAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKA 180

Query: 254 HGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGL 313
           HGG+SVFAGVGERTREGNDLY EMIESGVI L D  A SK ALVYGQMNEPPGARARV L
Sbjct: 181 HGGYSVFAGVGERTREGNDLYHEMIESGVINLKD--ATSKVALVYGQMNEPPGARARVAL 238

Query: 314 TGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQE 373
           TGLTVAE+FRD EGQDVLLFIDNIFRFTQA SEVSALLGRIPSAVGYQPTLATD+G +QE
Sbjct: 239 TGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQE 298

Query: 374 RITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQV 418
           RITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR +
Sbjct: 299 RITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAI 343
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1pyv_A ATP synthase beta chain, mitochondrial precursor; hydrolase; NMR {Nicotiana plumbaginifolia} SCOP: j.36.4.1 Length = 54 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 100.0
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 100.0
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 100.0
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 100.0
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 100.0
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 100.0
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 100.0
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 100.0
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 100.0
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 100.0
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 100.0
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 100.0
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 100.0
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 100.0
3l0o_A427 Transcription termination factor RHO; helicase, RH 100.0
3ice_A422 Transcription termination factor RHO; transcriptio 100.0
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 100.0
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 100.0
3pvs_A 447 Replication-associated recombination protein A; ma 98.87
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.04
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.04
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.88
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.87
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.86
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.83
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.83
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.78
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.76
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.76
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 97.71
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.7
3bos_A242 Putative DNA replication factor; P-loop containing 97.68
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.67
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.66
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.65
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.64
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.64
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.63
3io5_A 333 Recombination and repair protein; storage dimer, i 97.63
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.62
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.61
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.56
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.55
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.52
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.51
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.5
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.48
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.45
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.45
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.43
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.42
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.42
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.37
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.36
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.34
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.33
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.32
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.32
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.31
2z43_A324 DNA repair and recombination protein RADA; archaea 97.31
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.28
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.28
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.25
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.25
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.23
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.23
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.22
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.18
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.17
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.17
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.15
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.14
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.13
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.13
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.12
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.11
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.09
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.09
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.07
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.03
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.0
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.91
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.86
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.85
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.83
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.79
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.76
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.75
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.75
1pyv_A54 ATP synthase beta chain, mitochondrial precursor; 96.74
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.68
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.67
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.62
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.61
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.6
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.59
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.58
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.54
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.54
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.53
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.53
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.47
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.45
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.44
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.42
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.42
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.42
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.4
3bs4_A260 Uncharacterized protein PH0321; structural genomic 96.39
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.36
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.36
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.35
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.34
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.22
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.22
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.16
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.1
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.05
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.95
2fna_A 357 Conserved hypothetical protein; structural genomic 95.93
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.87
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.86
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.8
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 95.73
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.7
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.68
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.68
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.65
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.61
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.61
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.61
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.61
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.58
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.53
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.49
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.44
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.44
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.41
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.41
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.39
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.36
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.23
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 95.22
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.2
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.17
2qgz_A308 Helicase loader, putative primosome component; str 95.15
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.09
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.06
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.06
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.99
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.98
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.96
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.92
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.91
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.88
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.86
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.86
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.85
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.79
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.78
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.77
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 94.75
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.73
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.73
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.7
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.7
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.68
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.67
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.65
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.62
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.61
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.61
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 94.59
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.57
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.56
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.56
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.55
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.55
1g6h_A257 High-affinity branched-chain amino acid transport 94.55
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.52
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 94.51
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.48
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.48
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.46
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.45
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.45
2ghi_A260 Transport protein; multidrug resistance protein, M 94.44
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.44
1tue_A212 Replication protein E1; helicase, replication, E1E 94.43
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.43
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.42
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.41
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.4
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.39
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.36
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 94.36
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.36
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.35
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 94.34
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.33
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.31
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 94.3
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.3
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.29
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 94.29
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.29
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.28
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.28
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.25
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 94.22
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 94.19
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.18
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.12
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.11
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.1
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.09
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.08
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.06
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.05
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.05
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.04
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.04
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.01
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.01
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.0
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.99
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 93.98
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.97
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 93.92
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.92
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.91
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.88
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.86
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.85
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 93.85
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.81
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.77
1via_A175 Shikimate kinase; structural genomics, transferase 93.77
3co5_A143 Putative two-component system transcriptional RES 93.76
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 93.74
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.73
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.71
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 93.71
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.67
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.65
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.65
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.64
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 93.63
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.61
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.61
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.6
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.57
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.51
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.5
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 93.49
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 93.49
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.48
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.47
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.47
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.45
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.45
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 93.42
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.36
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.35
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.34
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.34
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 93.34
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 93.34
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.3
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.26
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.23
2og2_A359 Putative signal recognition particle receptor; nuc 93.21
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.2
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.16
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 93.08
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.05
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 92.97
2ewv_A372 Twitching motility protein PILT; pilus retraction 92.91
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 92.89
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.89
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 92.82
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.81
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.81
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.8
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 92.77
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.75
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.73
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.67
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.66
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 92.61
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.55
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 92.53
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 92.5
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.45
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.38
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 92.35
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 92.31
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.31
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 92.27
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 92.27
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.18
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 92.09
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.06
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.03
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 92.01
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 91.92
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 91.88
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 91.87
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.85
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.79
2wji_A165 Ferrous iron transport protein B homolog; membrane 91.69
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 91.68
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 91.66
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.65
2www_A349 Methylmalonic aciduria type A protein, mitochondri 91.6
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.58
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 91.57
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 91.52
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 91.51
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 91.49
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 91.49
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 91.47
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 91.37
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 91.37
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 91.36
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 91.3
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 91.29
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 91.23
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 91.19
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 91.14
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 91.13
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 91.12
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 91.11
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 91.02
3r20_A233 Cytidylate kinase; structural genomics, seattle st 91.0
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 90.98
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 90.94
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.9
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 90.85
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 90.84
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 90.76
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 90.74
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 90.73
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 90.65
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 90.62
1xjc_A169 MOBB protein homolog; structural genomics, midwest 90.62
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 90.61
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 90.58
1p9r_A418 General secretion pathway protein E; bacterial typ 90.57
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 90.56
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 90.56
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 90.53
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 90.5
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 90.46
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 90.43
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.41
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 90.36
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 90.35
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.33
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 90.33
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 90.3
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 90.29
2ged_A193 SR-beta, signal recognition particle receptor beta 90.28
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 90.26
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.2
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 90.13
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 90.13
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 90.11
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.1
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 90.09
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 90.08
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 90.04
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.0
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 89.99
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 89.96
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 89.95
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 89.95
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 89.94
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 89.92
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 89.91
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 89.9
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 89.9
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 89.85
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 89.84
1nrj_B218 SR-beta, signal recognition particle receptor beta 89.83
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 89.8
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 89.76
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 89.72
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.68
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 89.66
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 89.65
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.64
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 89.61
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 89.6
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 89.56
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 89.53
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 89.49
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 89.49
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 89.44
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 89.43
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 89.38
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 89.38
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 89.31
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 89.3
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 89.28
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 89.22
3kta_A182 Chromosome segregation protein SMC; structural mai 89.21
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 89.15
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 89.14
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 89.14
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 89.12
3t1o_A198 Gliding protein MGLA; G domain containing protein, 89.07
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.06
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 89.05
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 89.04
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 89.03
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 89.03
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 89.02
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 88.98
2xxa_A 433 Signal recognition particle protein; protein trans 88.97
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 88.94
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 88.91
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 88.85
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 88.84
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 88.83
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 88.81
2oap_1511 GSPE-2, type II secretion system protein; hexameri 88.74
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 88.7
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 88.6
2fh5_B214 SR-beta, signal recognition particle receptor beta 88.55
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 88.54
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 88.53
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 88.53
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 88.52
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 88.51
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 88.5
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 88.41
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 88.4
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 88.4
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 88.4
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 88.37
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 88.34
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 88.33
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 88.25
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 88.14
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 88.11
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 88.1
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 88.03
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 88.0
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 87.97
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 87.95
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 87.85
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 87.85
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 87.85
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 87.84
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 87.78
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 87.76
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 87.74
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 87.72
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 87.71
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 87.69
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 87.64
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 87.6
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 87.54
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 87.44
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 87.42
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 87.42
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 87.37
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 87.35
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 87.33
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 87.3
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 87.27
3lxx_A239 GTPase IMAP family member 4; structural genomics c 87.27
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 87.21
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 87.19
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 87.1
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 87.06
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 86.99
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 86.94
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 86.94
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 86.92
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 86.87
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 86.77
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 86.74
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 86.67
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 86.67
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 86.66
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 86.58
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 86.56
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 86.54
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 86.49
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 86.33
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 86.25
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 86.22
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 86.11
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 86.02
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 85.91
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 85.84
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 85.78
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 85.72
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
Probab=100.00  E-value=1.7e-88  Score=706.05  Aligned_cols=339  Identities=81%  Similarity=1.195  Sum_probs=315.7

Q ss_pred             cccCCceeeEEEEECCEEEEEeCCCCchhhhceEEeeccceeEEEEeeecCCceEEEEEecCccCCcCCCEEEecCCCcc
Q 014228           81 FTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPIT  160 (428)
Q Consensus        81 ~~~~~~~G~V~~V~G~vv~v~f~~glp~i~~~l~v~~~~~~~~~EVv~~l~~~~v~~i~l~~t~GL~~G~~V~~TG~~l~  160 (428)
                      .++..++|+|++|+|++|+|+|...+|.+++.+++...+.++++||++|++++.|++++|++++||++|+.|++||++++
T Consensus         8 ~~~~~~~G~v~~v~G~vv~v~~~~~~~~i~~~~~i~~~~~~~~~eV~~~~~~~~v~~~~~~~t~Gl~~G~~V~~tg~~~~   87 (482)
T 2ck3_D            8 PKAGATTGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIR   87 (482)
T ss_dssp             -----CEEEEEEEETTEEEEEESSCCCCTTCEEEESSCSSCCEEEEEEEEETTEEEEEESSCCTTCBTTCEEEECSSSCE
T ss_pred             cccCCcceEEEEEEccEEEEEecCccCcccceEEEeeCCCcEEEEEeEEecCCeEEEEeccCccCCCCCCEEEEcCCcce
Confidence            35566789999999999999997557888877766432346899999999999999999999999999999999999999


Q ss_pred             ccCCccccceEEEEeccccccCCCCCCccccccccCCCcchhcccccceeeccceeeccccccCCCceeEEECCCCCChh
Q 014228          161 VPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT  240 (428)
Q Consensus       161 VPVG~~lLGRVlD~lG~PiD~~~~i~~~~~~pi~~~~P~~ler~~~qe~L~TGikvID~l~pigrGqri~IfG~~G~GKT  240 (428)
                      ||||+++||||+|++|+|||+++++..+++||+++.+|++++|....++|.||+|+||.|+|++||||++|||++|+|||
T Consensus        88 vpvG~~lLGRV~d~lG~PiDg~~~~~~~~~~pi~~~~P~~~~r~~~~e~l~TGir~ID~l~pigkGQr~~Ifgg~G~GKT  167 (482)
T 2ck3_D           88 IPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKT  167 (482)
T ss_dssp             EECSGGGBTCEECTTSCBCSSSCSCCCCCEEESCCCCCCGGGCCCCCCEECCSCHHHHHHSCEETTCEEEEEECTTSSHH
T ss_pred             eeccccccCCEEcccCcCcCCcCCCCccccccccccCCchHHhcccCcCCccceEEEecccccccCCeeeeecCCCCChH
Confidence            99999999999999999999999988888999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCcEEEEEeecCCcchHHHHHHHHHHccccccCcccCCCeEEEEEecCCCCHHHHHHHHHHHHHHHH
Q 014228          241 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAE  320 (428)
Q Consensus       241 tLa~~ii~n~~~~~~~~~V~~giGeR~~Ev~dl~~el~e~~~~~~~~~~~~~~tvvv~~t~d~p~~~r~~~~~~a~tiAE  320 (428)
                      +|+++|++|+++++.++|||++||||++|++||++++.+.+.++...  .++|+++|++|+|+||.+|++++|+|+|+||
T Consensus       168 ~L~~~i~~~~~~~~~~v~V~~~iGER~rEv~e~~~~~~~~~~l~~~~--~~~rtvvV~~t~d~p~~~r~~~~~~a~tiAE  245 (482)
T 2ck3_D          168 VLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKD--ATSKVALVYGQMNEPPGARARVALTGLTVAE  245 (482)
T ss_dssp             HHHHHHHHHTTTTCSSEEEEEEESCCHHHHHHHHHHHHHHTSSCSSS--SCCCEEEEEECTTSCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhhHhhCCCEEEEEECCCcchHHHHHHHHhhhcccccccc--CCceEEEEEECCCCCHHHHHHHHHHHHHHHH
Confidence            99999999988888899999999999999999999999987653211  2469999999999999999999999999999


Q ss_pred             HHHHhCCCcEEEEEeCchhHHHHHHHhHHhcCCCCCCCCCCCChhHhHHHHHHhhcCCCCccEeEEEEEEecCCCCCCch
Q 014228          321 HFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTDPA  400 (428)
Q Consensus       321 yfrd~~Gk~VLL~iDditRfa~A~reis~llgr~p~~~gyp~~l~~~l~~l~ERa~~~~~GSIT~i~~v~~~~dD~~dpi  400 (428)
                      ||||++|+|||||+|||||||+|+||+|+++||+|+++||||++|++|++|||||++.++||||++++|++|+||++|||
T Consensus       246 yfrd~~G~dVLll~DsitR~A~A~rEis~~lge~P~~~GYpp~l~~~l~~l~ERag~~~~GSIT~i~tv~v~~dD~tdPi  325 (482)
T 2ck3_D          246 YFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPA  325 (482)
T ss_dssp             HHHHTTCSCEEEEEECTHHHHHHHHHHHGGGTCCCCGGGCCTTHHHHHHHHHTTSSCCSSCCEEEEEEEECGGGCTTSHH
T ss_pred             HHHHhcCCcEEEEeccHHHHHHHHHHhhhhcCCCCccccCchhHHHHhHHHHHhhcCCCCCceeeeEEEEecCCCCCCcc
Confidence            99997799999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccccCeEEEeehhhhhc
Q 014228          401 PATTFAHLDATTVLSRQVRMD  421 (428)
Q Consensus       401 ~~~~~~~ld~~ivLsR~la~~  421 (428)
                      ||++|+|+||||||||+||++
T Consensus       326 ~d~~~~i~dG~ivLsr~La~~  346 (482)
T 2ck3_D          326 PATTFAHLDATTVLSRAIAEL  346 (482)
T ss_dssp             HHHHGGGCSEEEEBCHHHHTT
T ss_pred             HHHHHHhcCeEEEEcHHHHhC
Confidence            999999999999999999987
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1pyv_A ATP synthase beta chain, mitochondrial precursor; hydrolase; NMR {Nicotiana plumbaginifolia} SCOP: j.36.4.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 428
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 1e-115
d2jdia3285 c.37.1.11 (A:95-379) Central domain of alpha subun 1e-101
d1fx0a3276 c.37.1.11 (A:97-372) Central domain of alpha subun 5e-80
d1xpua3289 c.37.1.11 (A:129-417) Transcription termination fa 4e-45
d2jdid272 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, d 1e-30
d1fx0b279 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, d 3e-28
d1skye282 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, do 6e-27
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  337 bits (865), Expect = e-115
 Identities = 223/259 (86%), Positives = 235/259 (90%), Gaps = 2/259 (0%)

Query: 159 ITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVD 218
           I +PVG  TLGRIMNVIGEPIDE+G +KT+ +  IH EAP FVE + EQ+ILVTGIKVVD
Sbjct: 1   IRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVD 60

Query: 219 LLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMI 278
           LLAPY +GGKIGLFGGAGVGKTVLIMELINNVAKAHGG+SVFAGVGERTREGNDLY EMI
Sbjct: 61  LLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMI 120

Query: 279 ESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIF 338
           ESGVI L D  A SK ALVYGQMNEPPGARARV LTGLTVAE+FRD EGQDVLLFIDNIF
Sbjct: 121 ESGVINLKD--ATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIF 178

Query: 339 RFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTD 398
           RFTQA SEVSALLGRIPSAVGYQPTLATD+G +QERITTTKKGSITSVQAIYVPADDLTD
Sbjct: 179 RFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTD 238

Query: 399 PAPATTFAHLDATTVLSRQ 417
           PAPATTFAHLDATTVLSR 
Sbjct: 239 PAPATTFAHLDATTVLSRA 257
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 72 Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 79 Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 100.0
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 100.0
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 100.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 100.0
d2jdid272 F1 ATP synthase beta subunit, domain 1 {Rat (Rattu 99.77
d1fx0b279 F1 ATP synthase beta subunit, domain 1 {Spinach (S 99.74
d1skye282 F1 ATP synthase beta subunit, domain 1 {Bacillus s 99.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.62
d2jdia271 F1 ATP synthase alpha subunit, domain 1 {Cow (Bos 98.6
d1skyb275 F1 ATP synthase alpha subunit, domain 1 {Bacillus 98.58
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.48
d1fx0a272 F1 ATP synthase alpha subunit, domain 1 {Spinach ( 98.47
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.44
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.34
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.28
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.1
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 98.08
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.98
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.74
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.69
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.46
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 97.41
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.41
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.39
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.37
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.35
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.32
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.29
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.23
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.17
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.16
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.13
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.11
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.08
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.06
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 97.03
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.02
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.99
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.93
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.9
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.9
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.86
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.78
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.76
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.65
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.64
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.57
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.51
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.49
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.45
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.43
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.38
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.32
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.28
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.2
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.19
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.04
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.96
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.84
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.83
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.82
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.69
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.67
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.66
d1vmaa2213 GTPase domain of the signal recognition particle r 95.58
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.57
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.55
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.55
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.43
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.38
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.37
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.37
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.34
d1okkd2207 GTPase domain of the signal recognition particle r 95.33
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.32
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.31
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.24
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.24
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.23
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.21
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.2
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.16
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.1
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.05
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.01
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.97
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.93
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.93
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.83
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.77
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.76
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.75
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.64
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.64
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.62
d2qy9a2211 GTPase domain of the signal recognition particle r 94.59
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.56
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.56
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.54
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.53
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 94.51
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.5
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.47
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.43
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.42
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.4
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.39
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.37
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.37
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.31
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.29
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.17
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.03
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.93
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.72
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.7
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.59
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.53
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.5
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.36
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.2
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.17
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 93.17
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.16
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.04
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.04
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.8
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.77
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.65
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.6
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.57
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.45
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.45
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.41
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.33
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.27
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.22
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.14
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.14
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.14
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.13
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.09
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.03
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.01
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.96
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.95
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.93
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.91
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.91
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.78
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.78
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.75
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.68
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.67
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 91.56
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.54
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.43
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.39
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.32
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.28
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.27
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.19
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.1
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.09
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.94
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.78
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.77
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.7
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.7
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.47
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.46
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.42
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.4
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.25
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 90.2
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.15
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.93
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 89.86
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.86
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.7
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.65
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.63
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.42
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.41
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.31
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.29
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.25
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.16
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 89.0
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 88.95
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.92
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.92
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 88.87
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 88.66
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.53
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.48
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.42
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.06
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.03
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.84
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 87.76
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 87.67
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.67
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 87.56
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.56
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.37
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.03
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.92
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 86.87
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.87
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 86.36
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.33
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.13
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.6
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.52
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.46
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 85.21
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 84.94
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 84.4
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 83.89
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 83.47
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.21
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.18
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 82.83
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 82.69
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 82.02
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 81.5
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.47
d1tuea_205 Replication protein E1 helicase domain {Human papi 80.25
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=1.7e-77  Score=584.48  Aligned_cols=261  Identities=85%  Similarity=1.239  Sum_probs=252.4

Q ss_pred             ccccCCccccceEEEEeccccccCCCCCCccccccccCCCcchhcccccceeeccceeeccccccCCCceeEEECCCCCC
Q 014228          159 ITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVG  238 (428)
Q Consensus       159 l~VPVG~~lLGRVlD~lG~PiD~~~~i~~~~~~pi~~~~P~~ler~~~qe~L~TGikvID~l~pigrGqri~IfG~~G~G  238 (428)
                      ++||||+++||||+|++|+|||+++++..+++|||++.+|++++|...+++|.||+|+||.|+|++||||++|||++|+|
T Consensus         1 l~vpVG~~lLGRVid~lG~piDg~~~i~~~~~~~i~~~~p~~~~R~~i~~~l~TGIraID~l~pigkGQr~~If~~~g~G   80 (276)
T d2jdid3           1 IRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVG   80 (276)
T ss_dssp             CEEECSGGGBTCEECTTSCBCSSSCCCCCSCEEESCCCCCCGGGCCCCCCEECCSCHHHHHHSCEETTCEEEEEECTTSS
T ss_pred             CeeecCccccCCEeCCCcceeCCCCCCCCcccccccCCCCChhHhcCCCcccccCceeeeeeccccCCCEEEeeCCCCCC
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHhhcCcEEEEEeecCCcchHHHHHHHHHHccccccCcccCCCeEEEEEecCCCCHHHHHHHHHHHHHH
Q 014228          239 KTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTV  318 (428)
Q Consensus       239 KTtLa~~ii~n~~~~~~~~~V~~giGeR~~Ev~dl~~el~e~~~~~~~~~~~~~~tvvv~~t~d~p~~~r~~~~~~a~ti  318 (428)
                      ||+|+.+|++|+.+++.++|||++||||++|+.||++++.+.++++.  +..++|+++|++|+|+||.+|++++++|+++
T Consensus        81 Kt~l~~~i~~~~~~~~~~v~V~~~iGer~~ev~~~~~~~~~~~~~~~--~~~~~~tvvv~~~s~~~~~~r~~~~~~a~~i  158 (276)
T d2jdid3          81 KTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINL--KDATSKVALVYGQMNEPPGARARVALTGLTV  158 (276)
T ss_dssp             HHHHHHHHHHHHTTTCSSEEEEEEESCCHHHHHHHHHHHHHHTSSCS--SSSCCCEEEEEECTTSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhCCCeEEEEEeccChHHHHHHHHHHHhcCcccc--ccccceEEEEEECCCCCHHHHHHHHHHHHHH
Confidence            99999999999878888999999999999999999999999987653  3467899999999999999999999999999


Q ss_pred             HHHHHHhCCCcEEEEEeCchhHHHHHHHhHHhcCCCCCCCCCCCChhHhHHHHHHhhcCCCCccEeEEEEEEecCCCCCC
Q 014228          319 AEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTKKGSITSVQAIYVPADDLTD  398 (428)
Q Consensus       319 AEyfrd~~Gk~VLL~iDditRfa~A~reis~llgr~p~~~gyp~~l~~~l~~l~ERa~~~~~GSIT~i~~v~~~~dD~~d  398 (428)
                      ||||||++|+|||||+||+||||+|+||+++++||+|+++|||+++|+.+++|||||++.++||||++++|++|+||++|
T Consensus       159 AEyf~~~~G~~VLv~~Dsltr~A~A~reis~~~ge~p~~~gyp~~l~~~~~~l~ERag~~~~GSIT~i~~v~~~~~d~~d  238 (276)
T d2jdid3         159 AEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTD  238 (276)
T ss_dssp             HHHHHHTTCSCEEEEEECTHHHHHHHHHHHGGGTCCCCGGGCCTTHHHHHHHHHTTSSCCSSCCEEEEEEEECGGGCTTS
T ss_pred             HHHHHhcCCCeEEEEEcchhHHHHHHHHHHHhcCCCCCcccCchhHHHHHHHHHHhhccCCCcccceEEEEEccCCCCCC
Confidence            99999867999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhccccCeEEEeehhhhhc
Q 014228          399 PAPATTFAHLDATTVLSRQVRMD  421 (428)
Q Consensus       399 pi~~~~~~~ld~~ivLsR~la~~  421 (428)
                      ||++++++|+||||||||+||++
T Consensus       239 pi~~~~~sitdg~i~Lsr~la~~  261 (276)
T d2jdid3         239 PAPATTFAHLDATTVLSRAIAEL  261 (276)
T ss_dssp             HHHHHHGGGCSEEEEBCHHHHTT
T ss_pred             cchHHHHhhcceEEEECHHHHhC
Confidence            99999999999999999999986
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure