Citrus Sinensis ID: 014400
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 425 | 2.2.26 [Sep-21-2011] | |||||||
| Q8GYT9 | 358 | E3 ubiquitin-protein liga | yes | no | 0.811 | 0.963 | 0.682 | 1e-153 | |
| Q9LN71 | 408 | E3 ubiquitin-protein liga | no | no | 0.268 | 0.279 | 0.257 | 4e-06 | |
| Q9FKX5 | 221 | NEP1-interacting protein- | no | no | 0.225 | 0.434 | 0.244 | 9e-06 | |
| Q9C1X4 | 513 | Uncharacterized RING fing | yes | no | 0.28 | 0.231 | 0.272 | 1e-05 | |
| Q641J8 | 622 | E3 ubiquitin-protein liga | N/A | no | 0.091 | 0.062 | 0.487 | 1e-05 | |
| Q7T037 | 757 | E3 ubiquitin-protein liga | N/A | no | 0.091 | 0.051 | 0.487 | 2e-05 | |
| Q07G42 | 639 | E3 ubiquitin-protein liga | yes | no | 0.091 | 0.061 | 0.461 | 3e-05 | |
| Q9WTV7 | 600 | E3 ubiquitin-protein liga | yes | no | 0.192 | 0.136 | 0.307 | 3e-05 | |
| Q9NVW2 | 624 | E3 ubiquitin-protein liga | yes | no | 0.091 | 0.062 | 0.461 | 3e-05 | |
| Q93Z92 | 390 | E3 ubiquitin-protein liga | no | no | 0.225 | 0.246 | 0.240 | 3e-05 |
| >sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 540 bits (1392), Expect = e-153, Method: Compositional matrix adjust.
Identities = 271/397 (68%), Positives = 308/397 (77%), Gaps = 52/397 (13%)
Query: 1 MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFV 60
MA+RGVDFKWYDGFFLSMLATSVIIVA+NW RY C YPLHIWIVVDYTTVF+FR+ MFV
Sbjct: 1 MAMRGVDFKWYDGFFLSMLATSVIIVAVNWNRYRACEYPLHIWIVVDYTTVFIFRVFMFV 60
Query: 61 DNGLASGMGLDLGWQQRYARFCGRVVVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE 120
DNGLASG+GLD G QQR A FCGRVVVLS+LSLLLYPFLWAWT+IGT WFT ++ CLPEE
Sbjct: 61 DNGLASGLGLDFGSQQRNAMFCGRVVVLSVLSLLLYPFLWAWTVIGTQWFTKSKTCLPEE 120
Query: 121 GQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEW 180
GQKWGFLIWL+FSYCGLLCIA + +GKWLTRRQ H +RAQQGIP+SE+G+L+DMIRVP+W
Sbjct: 121 GQKWGFLIWLMFSYCGLLCIAFICVGKWLTRRQVHLLRAQQGIPISEFGILVDMIRVPDW 180
Query: 181 AFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLE 240
AFEAAGQEMRGI QD A YHPGLYLT AQ EAVEALIQELPKFRLKAVP DC EC ICLE
Sbjct: 181 AFEAAGQEMRGISQDAATYHPGLYLTPAQTEAVEALIQELPKFRLKAVPDDCGECLICLE 240
Query: 241 EFHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEVLQVRGLPCAHNFH 300
EFH+G+E VRGLPCAHNFH
Sbjct: 241 EFHIGHE------------------------------------------VRGLPCAHNFH 258
Query: 301 IECIDEWLRLNVKCPRCRCSVFPNLDLSALSNLRTADSERSSASSVVTT-TRYVRTQPSS 359
+ECID+WLRLNVKCPRCRCSVFP+LDLSALSNL+++ +E+ S + T+ RY+R+QP S
Sbjct: 259 VECIDQWLRLNVKCPRCRCSVFPDLDLSALSNLQSSGTEQHSQVNTETSEARYIRSQPQS 318
Query: 360 QSYLVRMQGLLSPVHMGNTRLPNDTDIALQTVENGGV 396
+SY +R+Q L+ PVH TD AL+T ENGGV
Sbjct: 319 ESYFLRVQSLIHPVH---------TDTALETAENGGV 346
|
E3 ubiquitin protein ligase that acts as positive regulator of sugar signaling during early seedling development. Possesses E3 ligase activity in vitro. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 425 | ||||||
| 255540693 | 381 | protein binding protein, putative [Ricin | 0.896 | 1.0 | 0.743 | 0.0 | |
| 225457054 | 381 | PREDICTED: E3 ubiquitin-protein ligase S | 0.894 | 0.997 | 0.75 | 1e-175 | |
| 356513598 | 382 | PREDICTED: E3 ubiquitin-protein ligase S | 0.842 | 0.937 | 0.766 | 1e-175 | |
| 224119306 | 391 | predicted protein [Populus trichocarpa] | 0.894 | 0.971 | 0.701 | 1e-166 | |
| 357477371 | 365 | RING finger protein [Medicago truncatula | 0.783 | 0.912 | 0.771 | 1e-165 | |
| 356562736 | 383 | PREDICTED: E3 ubiquitin-protein ligase S | 0.865 | 0.960 | 0.733 | 1e-164 | |
| 449440682 | 377 | PREDICTED: E3 ubiquitin-protein ligase S | 0.837 | 0.944 | 0.718 | 1e-159 | |
| 224133512 | 333 | predicted protein [Populus trichocarpa] | 0.774 | 0.987 | 0.778 | 1e-159 | |
| 219886093 | 374 | unknown [Zea mays] | 0.823 | 0.935 | 0.689 | 1e-157 | |
| 242057653 | 374 | hypothetical protein SORBIDRAFT_03g02403 | 0.823 | 0.935 | 0.694 | 1e-153 |
| >gi|255540693|ref|XP_002511411.1| protein binding protein, putative [Ricinus communis] gi|223550526|gb|EEF52013.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 645 bits (1665), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 316/425 (74%), Positives = 342/425 (80%), Gaps = 44/425 (10%)
Query: 1 MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFV 60
MAIRGVDFKWYDGFFLSMLATSV+IVAINWKRYH CTYPLHIWIVVDYTTVFVFRLLMF+
Sbjct: 1 MAIRGVDFKWYDGFFLSMLATSVVIVAINWKRYHHCTYPLHIWIVVDYTTVFVFRLLMFI 60
Query: 61 DNGLASGMGLDLGWQQRYARFCGRVVVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE 120
DNGLA+GMGLD GWQQRYARFCGR+ VLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE
Sbjct: 61 DNGLAAGMGLDFGWQQRYARFCGRIAVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE 120
Query: 121 GQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEW 180
GQKWGFLIWL+FSYCGLLCIACM MGKWLTRRQAH +RAQQGIP+SEYGVL+DM+RVP+W
Sbjct: 121 GQKWGFLIWLVFSYCGLLCIACMCMGKWLTRRQAHLLRAQQGIPISEYGVLVDMVRVPDW 180
Query: 181 AFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLE 240
AFEAAGQEMRG+GQD AAYHPGLYLT QREAVEALIQELPKFRLK VPTDCSECPICLE
Sbjct: 181 AFEAAGQEMRGMGQDAAAYHPGLYLTPTQREAVEALIQELPKFRLKTVPTDCSECPICLE 240
Query: 241 EFHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEVLQVRGLPCAHNFH 300
EFHVGNE VRGLPCAHNFH
Sbjct: 241 EFHVGNE------------------------------------------VRGLPCAHNFH 258
Query: 301 IECIDEWLRLNVKCPRCRCSVFPNLDLSALSNLRTADSERSSASSVVTTTRYVRTQPSSQ 360
+ECIDEWLRLNVKCPRCRCSVFPNLDLSALSNLR AD ER A+ VTT RYVRTQPSSQ
Sbjct: 259 VECIDEWLRLNVKCPRCRCSVFPNLDLSALSNLR-ADPERPPAAD-VTTNRYVRTQPSSQ 316
Query: 361 SYLVRMQGLLSPVHMGNTRLPNDTDIALQTVENGGVLSATQNRIAMGPFSSTGRVLVSPS 420
SYL+R+QGLL P+ + +D D+ L+ VE+G + AT+ + M P S G +LV S
Sbjct: 317 SYLLRLQGLLRPIRTEDAGSSSDVDVDLEAVEHGREVVATREAMVMEPVSLVGSMLVGQS 376
Query: 421 TQPQH 425
+ PQH
Sbjct: 377 SPPQH 381
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225457054|ref|XP_002282957.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356513598|ref|XP_003525499.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224119306|ref|XP_002318038.1| predicted protein [Populus trichocarpa] gi|222858711|gb|EEE96258.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357477371|ref|XP_003608971.1| RING finger protein [Medicago truncatula] gi|355510026|gb|AES91168.1| RING finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356562736|ref|XP_003549625.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449440682|ref|XP_004138113.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Cucumis sativus] gi|449518937|ref|XP_004166492.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224133512|ref|XP_002321588.1| predicted protein [Populus trichocarpa] gi|222868584|gb|EEF05715.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|219886093|gb|ACL53421.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242057653|ref|XP_002457972.1| hypothetical protein SORBIDRAFT_03g024030 [Sorghum bicolor] gi|241929947|gb|EES03092.1| hypothetical protein SORBIDRAFT_03g024030 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 425 | ||||||
| TAIR|locus:2097830 | 358 | SIS3 "SUGAR-INSENSITIVE 3" [Ar | 0.581 | 0.689 | 0.781 | 4.4e-141 | |
| GENEDB_PFALCIPARUM|PF10_0276 | 274 | PF10_0276 "hypothetical protei | 0.265 | 0.412 | 0.256 | 2e-13 | |
| UNIPROTKB|Q8IJC2 | 274 | PF10_0276 "Zinc finger, C3HC4 | 0.265 | 0.412 | 0.256 | 2e-13 | |
| UNIPROTKB|G3MWN3 | 136 | G3MWN3 "Uncharacterized protei | 0.068 | 0.213 | 0.482 | 4.5e-08 | |
| TAIR|locus:2139717 | 390 | AT4G11680 [Arabidopsis thalian | 0.087 | 0.094 | 0.459 | 2.7e-07 | |
| TAIR|locus:2098916 | 379 | AT3G61180 [Arabidopsis thalian | 0.122 | 0.137 | 0.392 | 8.9e-07 | |
| TAIR|locus:2034934 | 106 | AT1G18770 [Arabidopsis thalian | 0.082 | 0.330 | 0.457 | 2.2e-06 | |
| TAIR|locus:2122348 | 132 | AT4G09100 [Arabidopsis thalian | 0.070 | 0.227 | 0.5 | 2.6e-06 | |
| TAIR|locus:2177886 | 164 | AT5G41450 [Arabidopsis thalian | 0.08 | 0.207 | 0.472 | 3.1e-06 | |
| ZFIN|ZDB-GENE-040426-1277 | 146 | rnf11a "ring finger protein 11 | 0.065 | 0.191 | 0.5 | 6.6e-06 |
| TAIR|locus:2097830 SIS3 "SUGAR-INSENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1088 (388.1 bits), Expect = 4.4e-141, Sum P(2) = 4.4e-141
Identities = 193/247 (78%), Positives = 212/247 (85%)
Query: 1 MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFV 60
MA+RGVDFKWYDGFFLSMLATSVIIVA+NW RY C YPLHIWIVVDYTTVF+FR+ MFV
Sbjct: 1 MAMRGVDFKWYDGFFLSMLATSVIIVAVNWNRYRACEYPLHIWIVVDYTTVFIFRVFMFV 60
Query: 61 DNGLASGMGLDLGWQQRYARFCGRXXXXXXXXXXXYPFLWAWTIIGTLWFTSARDCLPEE 120
DNGLASG+GLD G QQR A FCGR YPFLWAWT+IGT WFT ++ CLPEE
Sbjct: 61 DNGLASGLGLDFGSQQRNAMFCGRVVVLSVLSLLLYPFLWAWTVIGTQWFTKSKTCLPEE 120
Query: 121 GQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEW 180
GQKWGFLIWL+FSYCGLLCIA + +GKWLTRRQ H +RAQQGIP+SE+G+L+DMIRVP+W
Sbjct: 121 GQKWGFLIWLMFSYCGLLCIAFICVGKWLTRRQVHLLRAQQGIPISEFGILVDMIRVPDW 180
Query: 181 AFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLE 240
AFEAAGQEMRGI QD A YHPGLYLT AQ EAVEALIQELPKFRLKAVP DC EC ICLE
Sbjct: 181 AFEAAGQEMRGISQDAATYHPGLYLTPAQTEAVEALIQELPKFRLKAVPDDCGECLICLE 240
Query: 241 EFHVGNE 247
EFH+G+E
Sbjct: 241 EFHIGHE 247
|
|
| GENEDB_PFALCIPARUM|PF10_0276 PF10_0276 "hypothetical protein" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IJC2 PF10_0276 "Zinc finger, C3HC4 type, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MWN3 G3MWN3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139717 AT4G11680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098916 AT3G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034934 AT1G18770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122348 AT4G09100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177886 AT5G41450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1277 rnf11a "ring finger protein 11a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8GYT9 | SIS3_ARATH | 6, ., 3, ., 2, ., - | 0.6826 | 0.8117 | 0.9636 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 425 | |||
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 8e-08 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 6e-07 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 1e-05 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-04 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 2e-04 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 3e-04 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 4e-04 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 4e-04 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 0.001 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Score = 48.2 bits (115), Expect = 8e-08
Identities = 27/85 (31%), Positives = 31/85 (36%), Gaps = 42/85 (49%)
Query: 234 ECPICLEEFHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEVLQVRGL 293
ECPICL+EF G E V L
Sbjct: 2 ECPICLDEFEPGEE------------------------------------------VVVL 19
Query: 294 PCAHNFHIECIDEWLRLNVKCPRCR 318
PC H FH EC+D+WLR + CP CR
Sbjct: 20 PCGHVFHKECLDKWLRSSNTCPLCR 44
|
Length = 46 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 425 | |||
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 99.97 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.71 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.66 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.51 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.5 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.29 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 99.24 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.16 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 99.05 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.99 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.94 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.89 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.88 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.78 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.72 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.71 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.66 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.66 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.64 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.63 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.58 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.54 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.54 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.53 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.46 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.41 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 98.31 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.18 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.15 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.15 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.06 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.04 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.01 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.91 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.88 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.85 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.85 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.85 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.83 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.67 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.62 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.52 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.46 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.4 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.36 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.32 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.15 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.1 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.96 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.76 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.75 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 96.62 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.58 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 96.35 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.35 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.34 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 96.15 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.15 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.99 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.98 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 95.85 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.63 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.47 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 95.3 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.2 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.15 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.03 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.99 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 94.56 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.46 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.43 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 94.35 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 94.28 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.26 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.23 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 94.23 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 94.02 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.73 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.39 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 93.31 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 93.25 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.2 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 91.9 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.39 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.28 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 90.77 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 90.77 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 90.57 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 90.43 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.37 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 90.26 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 89.51 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 88.67 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 88.51 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 88.1 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 87.28 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.02 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 83.3 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 83.07 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 81.4 |
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.9e-32 Score=259.19 Aligned_cols=212 Identities=23% Similarity=0.381 Sum_probs=184.2
Q ss_pred HHHHHHHHHH--Hhhhccccccccccc----cceeeehhhHHHHHHHHHHHHhhhcccCCCCchhhhhhccccchhHHHH
Q 014400 15 FLSMLATSVI--IVAINWKRYHLCTYP----LHIWIVVDYTTVFVFRLLMFVDNGLASGMGLDLGWQQRYARFCGRVVVL 88 (425)
Q Consensus 15 ~~~~~~~~~~--~~~~~w~~~~~c~~~----~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~v~ 88 (425)
.+++++|+|| |++++||++|..+|. |+||.++.|+++.+. |.||...|+++
T Consensus 56 m~I~~i~lvIaQi~lv~WKkrh~RSy~~~tll~m~~iPlyf~~~~~-----------------------w~rfl~~WlmF 112 (328)
T KOG1734|consen 56 MAIFSIYLVIAQIFLVVWKKRHKRSYDVCTLLIMLFIPLYFFLYMQ-----------------------WYRFLFCWLMF 112 (328)
T ss_pred HHHHHHHHHHHHHHHHHHHHhcccchhHHHHHHHHHhhhhhhhhHH-----------------------HHHHHHHHHHH
Confidence 4677788888 999999999999999 599999999999988 88998889998
Q ss_pred HHHHhhhhhhhhheeeeEEEEEeeccccCCCCCC----chhhhHHHHHHHHHH---HHHHHHhhhhhhhcchhhhhhhhc
Q 014400 89 SILSLLLYPFLWAWTIIGTLWFTSARDCLPEEGQ----KWGFLIWLLFSYCGL---LCIACMSMGKWLTRRQAHSIRAQQ 161 (425)
Q Consensus 89 ~~~~l~l~pf~~~w~i~g~v~~~~~~~~l~~~~~----~~~~li~~v~~~~~l---l~i~~i~~~~~~~~r~~~~~r~~~ 161 (425)
+. ++..+++.++|+++.+++| |||++++++.+..++ |+++...++..+.........++-
T Consensus 113 ~~-------------~tafi~~ka~rkp~~g~tpRlVYkwFl~lyklSy~~g~vGyl~im~~~~g~n~~F~~~~~~~md~ 179 (328)
T KOG1734|consen 113 CG-------------FTAFITLKALRKPISGDTPRLVYKWFLFLYKLSYLLGVVGYLAIMFAQFGLNFTFFYLKTTYMDF 179 (328)
T ss_pred HH-------------HHHHHHHHHHhcccCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhceeeEEeecchhHhhh
Confidence 87 6777888999999999999 799999997766654 677777787888888888899999
Q ss_pred CCccccccceecceecchhhhhhhhhhhhccCcCccccCCCCcccHHHHHHHHHHHHhCCccccccCCCCCCcCcccccc
Q 014400 162 GIPVSEYGVLLDMIRVPEWAFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLEE 241 (425)
Q Consensus 162 ~i~~~~~g~~~~~~~~p~~~~~~~~~~~r~~~~d~~a~~~~~~l~~~~rea~~~~i~~Lp~~~~~~~~~~~~~CaICle~ 241 (425)
||.+.+||+|++++ |+|.+++++|.+|...|+|.. +.+|+..+++ +.|+||.+.
T Consensus 180 gi~~lfyglYyGvl----------gRdfa~icsd~mAs~iGfYs~-----------~glPtkhl~d-----~vCaVCg~~ 233 (328)
T KOG1734|consen 180 GISFLFYGLYYGVL----------GRDFAEICSDYMASTIGFYSP-----------SGLPTKHLSD-----SVCAVCGQQ 233 (328)
T ss_pred hHHHHHHHHHHHhh----------hhHHHHHHHHHHHHHhcccCC-----------CCCCCCCCCc-----chhHhhcch
Confidence 99999999999888 999999999999999999997 8899988776 899999999
Q ss_pred cccCccccccccccCCCCCCCCchhhHHHHHhhhhhcccchhhhhccceEEeccccccchhhHHHH--HhcCCCCccccc
Q 014400 242 FHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEVLQVRGLPCAHNFHIECIDEW--LRLNVKCPRCRC 319 (425)
Q Consensus 242 ~~~~~~~~~~~~~~p~~~~s~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~LpC~HiFH~~CL~~W--L~~~~tCP~CR~ 319 (425)
+.+..+ ++.--|+..+|.|+|+||+.||+.| +.++++||.|++
T Consensus 234 ~~~s~~-----------------------------------eegvienty~LsCnHvFHEfCIrGWcivGKkqtCPYCKe 278 (328)
T KOG1734|consen 234 IDVSVD-----------------------------------EEGVIENTYKLSCNHVFHEFCIRGWCIVGKKQTCPYCKE 278 (328)
T ss_pred heeecc-----------------------------------hhhhhhhheeeecccchHHHhhhhheeecCCCCCchHHH
Confidence 987543 1222356889999999999999999 566889999999
Q ss_pred ccCC
Q 014400 320 SVFP 323 (425)
Q Consensus 320 ~V~~ 323 (425)
+|.-
T Consensus 279 kVdl 282 (328)
T KOG1734|consen 279 KVDL 282 (328)
T ss_pred HhhH
Confidence 9954
|
|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 425 | ||||
| 2kiz_A | 69 | Solution Structure Of Arkadia Ring-H2 Finger Domain | 2e-05 | ||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 1e-04 |
| >pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 | Back alignment and structure |
|
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 80.1 bits (198), Expect = 4e-19
Identities = 23/115 (20%), Positives = 37/115 (32%), Gaps = 44/115 (38%)
Query: 212 AVEALIQELPKFRLKAV--PTDCSECPICLEEFHVGNEWQADVKFYPYGFTSHKPLCKLV 269
+LP +R ++ + C +C+ +F
Sbjct: 1 GSSGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQL---------------------- 38
Query: 270 HALMFLKEHMSTSLFLEVLQVRGLPCAHNFHIECIDEWLRLNVKCPRCRCSVFPN 324
+R LPC H FH +C+D+WL+ N CP CR P+
Sbjct: 39 --------------------LRVLPCNHEFHAKCVDKWLKANRTCPICRADSGPS 73
|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 425 | |||
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.58 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.54 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.48 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.46 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.46 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.45 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.41 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.4 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.37 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.33 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.33 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.3 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.3 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.29 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.29 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.25 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.24 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.24 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.21 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.21 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.2 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.18 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.18 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.17 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.17 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.14 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.11 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.1 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.1 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.1 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.09 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.09 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.07 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.06 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.04 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.04 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.03 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.03 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.01 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.98 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.97 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.96 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.95 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.93 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.9 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.87 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.87 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.86 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.86 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.85 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.84 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.82 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.82 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.81 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.79 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.74 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.74 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.7 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.63 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.57 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.57 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.55 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.54 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.48 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.38 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.34 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.33 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.31 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.22 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.05 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.79 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.32 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 89.38 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 87.93 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 87.12 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 81.49 |
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.58 E-value=5.2e-16 Score=127.06 Aligned_cols=72 Identities=35% Similarity=0.752 Sum_probs=59.7
Q ss_pred HHHHHHHHhCCccccccCC---CCCCcCcccccccccCccccccccccCCCCCCCCchhhHHHHHhhhhhcccchhhhhc
Q 014400 211 EAVEALIQELPKFRLKAVP---TDCSECPICLEEFHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEV 287 (425)
Q Consensus 211 ea~~~~i~~Lp~~~~~~~~---~~~~~CaICle~~~~~~~~~~~~~~~p~~~~s~~~~~r~~~~~~~~~~~~~~~~~~~~ 287 (425)
.++++.++.||...+.+.. .+...|+||+++|..++.
T Consensus 16 ~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~---------------------------------------- 55 (91)
T 2l0b_A 16 PASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDV---------------------------------------- 55 (91)
T ss_dssp CCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCE----------------------------------------
T ss_pred CCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCc----------------------------------------
Confidence 3455667899988776543 344579999999987665
Q ss_pred cceEEeccccccchhhHHHHHhcCCCCcccccccCCC
Q 014400 288 LQVRGLPCAHNFHIECIDEWLRLNVKCPRCRCSVFPN 324 (425)
Q Consensus 288 ~~~~~LpC~HiFH~~CL~~WL~~~~tCP~CR~~V~~~ 324 (425)
++.+||||.||..||..|++.+.+||+||..+.+.
T Consensus 56 --~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~~ 90 (91)
T 2l0b_A 56 --ATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPP 90 (91)
T ss_dssp --EEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSCC
T ss_pred --EEecCCCChHHHHHHHHHHHcCCcCcCcCccCCCC
Confidence 88899999999999999999999999999998764
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 425 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 8e-10 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-08 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 2e-08 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-07 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-06 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-06 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 8e-05 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 9e-05 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 2e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 3e-04 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.002 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 0.004 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 52.2 bits (125), Expect = 8e-10
Identities = 25/92 (27%), Positives = 29/92 (31%), Gaps = 43/92 (46%)
Query: 231 DCSECPICLEEFHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEVLQV 290
D EC +CL E G E
Sbjct: 4 DGVECAVCLAELEDGEE------------------------------------------A 21
Query: 291 RGLP-CAHNFHIECIDEWLRLNVKCPRCRCSV 321
R LP C H FH EC+D WL + CP CR +V
Sbjct: 22 RFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 425 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.59 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.41 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.4 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.4 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.38 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.29 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.18 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.15 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.07 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.05 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.89 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.87 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.85 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.83 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.64 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.38 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 83.43 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 81.26 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 81.07 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 80.53 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.59 E-value=2.3e-16 Score=116.47 Aligned_cols=49 Identities=49% Similarity=1.087 Sum_probs=43.6
Q ss_pred CCcCcccccccccCccccccccccCCCCCCCCchhhHHHHHhhhhhcccchhhhhccceEEec-cccccchhhHHHHHhc
Q 014400 232 CSECPICLEEFHVGNEWQADVKFYPYGFTSHKPLCKLVHALMFLKEHMSTSLFLEVLQVRGLP-CAHNFHIECIDEWLRL 310 (425)
Q Consensus 232 ~~~CaICle~~~~~~~~~~~~~~~p~~~~s~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~Lp-C~HiFH~~CL~~WL~~ 310 (425)
+.+|+||+++|..++. +++++ |||.||..||++|++.
T Consensus 5 ~~~C~ICl~~~~~~~~------------------------------------------~~~l~~C~H~Fh~~Ci~~Wl~~ 42 (55)
T d1iyma_ 5 GVECAVCLAELEDGEE------------------------------------------ARFLPRCGHGFHAECVDMWLGS 42 (55)
T ss_dssp SCCCTTTCCCCCTTSC------------------------------------------CEECSSSCCEECTTHHHHTTTT
T ss_pred CCCCeEECccccCCCE------------------------------------------EEEeCCCCCcccHHHHHHHHHh
Confidence 3579999999998766 77775 9999999999999999
Q ss_pred CCCCcccccccC
Q 014400 311 NVKCPRCRCSVF 322 (425)
Q Consensus 311 ~~tCP~CR~~V~ 322 (425)
+.+||+||.+|.
T Consensus 43 ~~~CP~CR~~i~ 54 (55)
T d1iyma_ 43 HSTCPLCRLTVV 54 (55)
T ss_dssp CCSCSSSCCCSC
T ss_pred CCcCCCCCCEeE
Confidence 999999999874
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|