Citrus Sinensis ID: 014457


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----
MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCASRRGGGASNEVQKCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNKSSNRTSQASSVSLSRSSSGGGSLDDRPKFSLGNLLWSRLERLSGNFSLI
cHHHHcccccEEEEEEEEEcccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcccccccHHcccccccccccccccccEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccc
ccEEEEcccEEEEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHccccccccccHHHcccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccEEEEccccccccHHHHHHHHHccccccccccccccHHHHcccccccEEEEEccccccEEEEEEEccccccHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEccccccccHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccc
MVQVLTDLELVISKsyissdggwfmDVFHVTDQLGNKLTDETLILYIQQALCasrrgggasneVQKClkrdvrprhvstentalevtgvdrpglMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEdglegrpitapEMLAHVEEQLEIVVGahhgegetrsvrlttpmpgrthTERRLHQLMYADRDyelcrgcdggaghwngctrTHVLIDsckekgysvvnikcidrpkllFDTLCALTDLQYVVFHAAIsskgcfadqeyfirqtdgctldtESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVsmaeigtngekatgsfyvmdasghdvNQRTVELLKQEIGGSVLVVnkssnrtsqaSSVSlsrsssgggslddrpkfslgNLLWSRLERLSGNFSLI
MVQVLTDLELVISKsyissdggwFMDVFHVTDQLGNKLTDETLILYIQQALCASrrgggasnevqkclkrdvrprhvstentalevtgvdrpgLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAhhgegetrsvrlttpmpgrthTERRLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLvvnkssnrtsqassvslsrsssgggslddrpkFSLGnllwsrlerlsgnfsli
MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCASRRGGGASNEVQKCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNKSSNRTsqassvslsrsssgggsLDDRPKFSLGNLLWSRLERLSGNFSLI
***VLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCASRRG*********CL*************TALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHH**********************RLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVV********************************LGNLLWSRL**********
MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQAL*************************VSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHG*****SVRLTTPMPGRTHTERRLHQLMYADRDYELC*************TRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGS***********************************SLGNLLWSRLERLSGNFSLI
MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCA**********VQKCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNKS**********************DDRPKFSLGNLLWSRLERLSGNFSLI
MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCAS**********************VSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYADRDYELCRGCDGGA***NGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNK**************************PKFSLGNLLWSRLERLSGNFSLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCASRRGGGASNEVQKCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNKSSNRTSQASSVSLSRSSSGGGSLDDRPKFSLGNLLWSRLERLSGNFSLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query424 2.2.26 [Sep-21-2011]
Q65SZ8875 [Protein-PII] uridylyltra yes no 0.344 0.166 0.247 1e-05
Q2N784919 [Protein-PII] uridylyltra yes no 0.297 0.137 0.292 1e-05
Q1QRM1931 [Protein-PII] uridylyltra yes no 0.167 0.076 0.375 3e-05
Q1I624900 [Protein-PII] uridylyltra yes no 0.339 0.16 0.256 9e-05
Q5WVX6861 [Protein-PII] uridylyltra yes no 0.200 0.098 0.284 0.0001
A5ICM0861 [Protein-PII] uridylyltra yes no 0.200 0.098 0.284 0.0001
Q5X4J1861 [Protein-PII] uridylyltra yes no 0.200 0.098 0.284 0.0001
Q5ZUS2861 [Protein-PII] uridylyltra yes no 0.200 0.098 0.284 0.0001
Q3SWE0925 [Protein-PII] uridylyltra yes no 0.167 0.076 0.361 0.0001
B1JBR2900 [Protein-PII] uridylyltra yes no 0.339 0.16 0.262 0.0002
>sp|Q65SZ8|GLND_MANSM [Protein-PII] uridylyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=glnD PE=3 SV=1 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 78/174 (44%), Gaps = 28/174 (16%)

Query: 221 GYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAI-SSKGCFADQEYFIRQTDGCTLDTE 279
           G + V I C DRP L    + A+ + +  +  A I +S   +A   + + + DG  L  +
Sbjct: 697 GGTEVFIYCKDRPNLFLKVVAAIGNKKLSIHDAQIITSLDGYAFDSFIVTELDGSLLKFD 756

Query: 280 SQR-------QKLTQCLIAAIERRVSHGLR--------------------LEICTQNRMG 312
            +R         L    +  ++   +H L+                    +E+ T ++ G
Sbjct: 757 RRRVLEKAIINSLNSNELTKLQGSENHKLQHFNVKTEVRFLNTEKTTHTEMELFTLDKAG 816

Query: 313 LLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEI 366
           LL+DV+  F E  LS+  A+I T GEKA   F + +A G  +++R  + L +++
Sbjct: 817 LLADVSLVFSELNLSIQNAKITTIGEKAQDFFILTNAKGEALSERERQSLSEKL 870




Modifies, by uridylylation or deuridylylation the PII (GlnB) regulatory protein.
Mannheimia succiniciproducens (strain MBEL55E) (taxid: 221988)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 5EC: 9
>sp|Q2N784|GLND_ERYLH [Protein-PII] uridylyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q1QRM1|GLND_NITHX [Protein-PII] uridylyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q1I624|GLND_PSEE4 [Protein-PII] uridylyltransferase OS=Pseudomonas entomophila (strain L48) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q5WVX6|GLND_LEGPL [Protein-PII] uridylyltransferase OS=Legionella pneumophila (strain Lens) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|A5ICM0|GLND_LEGPC [Protein-PII] uridylyltransferase OS=Legionella pneumophila (strain Corby) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q5X4J1|GLND_LEGPA [Protein-PII] uridylyltransferase OS=Legionella pneumophila (strain Paris) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q5ZUS2|GLND_LEGPH [Protein-PII] uridylyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q3SWE0|GLND_NITWN [Protein-PII] uridylyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|B1JBR2|GLND_PSEPW [Protein-PII] uridylyltransferase OS=Pseudomonas putida (strain W619) GN=glnD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query424
224095019482 predicted protein [Populus trichocarpa] 0.997 0.877 0.727 1e-178
255568655477 amino acid binding protein, putative [Ri 0.995 0.884 0.723 1e-176
224129764482 predicted protein [Populus trichocarpa] 0.992 0.873 0.703 1e-172
359496882468 PREDICTED: uncharacterized protein LOC10 0.976 0.884 0.682 1e-162
449508537476 PREDICTED: uncharacterized protein LOC10 0.983 0.876 0.630 1e-147
449451315476 PREDICTED: uncharacterized protein LOC10 0.983 0.876 0.626 1e-146
356497013477 PREDICTED: uncharacterized protein LOC10 0.985 0.876 0.613 1e-139
356541590459 PREDICTED: uncharacterized protein LOC10 0.950 0.877 0.597 1e-135
357482521486 ACT domain-containing protein [Medicago 1.0 0.872 0.575 1e-129
297794201477 hypothetical protein ARALYDRAFT_919932 [ 0.959 0.853 0.569 1e-128
>gi|224095019|ref|XP_002310330.1| predicted protein [Populus trichocarpa] gi|222853233|gb|EEE90780.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 313/430 (72%), Positives = 363/430 (84%), Gaps = 7/430 (1%)

Query: 1   MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCASRRGGGA 60
           MVQVLTDL+LVISKSYISSDGGWFMDVFHVTDQLGNKLTDE+LILYIQQALCA+RR G  
Sbjct: 52  MVQVLTDLDLVISKSYISSDGGWFMDVFHVTDQLGNKLTDESLILYIQQALCANRRRG-V 110

Query: 61  SNEVQKCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTR 120
           S E+  CL R+VRPRHVSTE+T LE+ G DRPGL+SEISAVL+EL CHV AA+AWTH TR
Sbjct: 111 SKELPTCLNREVRPRHVSTEHTTLEMAGTDRPGLLSEISAVLFELECHVTAALAWTHNTR 170

Query: 121 AACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGR-THTER 179
           AA I Y+EDG  G PIT P+ LAHV+EQLE VV A HG GE RSVRLT P PG+ THTER
Sbjct: 171 AASIIYMEDGFRGGPITDPKRLAHVQEQLENVVEARHGMGERRSVRLTAPAPGQQTHTER 230

Query: 180 RLHQLMYADRDYELCRGCDGG-AGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFD 238
           RLHQLMYA+ DYE C+GC+GG A H N CT+THV I+SC+EKGYSVVN++  DRPKLLFD
Sbjct: 231 RLHQLMYANIDYEPCQGCNGGGAAHRNNCTKTHVFIESCEEKGYSVVNVRSRDRPKLLFD 290

Query: 239 TLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVS 298
           TLCALTD+QYVVFHA +SSKG  ADQEYFIRQ DGCTLDT+S+R KLTQCLIAAIERRVS
Sbjct: 291 TLCALTDMQYVVFHAVVSSKGTMADQEYFIRQKDGCTLDTDSERHKLTQCLIAAIERRVS 350

Query: 299 HGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRT 358
           HGLRL+I T NRMGLLSD+TRAFRENGLS+S AEIGTNG++A GSFYV DASG++ N + 
Sbjct: 351 HGLRLDIRTHNRMGLLSDLTRAFRENGLSISSAEIGTNGDRAVGSFYVTDASGYEANPQV 410

Query: 359 VELLKQEIGGSVLVVNKS---SNRTSQASSVSLSRSSSGGGSL-DDRPKFSLGNLLWSRL 414
           +E +K+EIGGS++VVNKS   + +TS+  SV+    +S G S+ +D+P+FSLG+L WS+L
Sbjct: 411 IEHVKKEIGGSIVVVNKSPGWTPKTSKTPSVASISRTSSGSSIHEDKPRFSLGSLFWSQL 470

Query: 415 ERLSGNFSLI 424
           ERLS NFS I
Sbjct: 471 ERLSNNFSSI 480




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255568655|ref|XP_002525301.1| amino acid binding protein, putative [Ricinus communis] gi|223535459|gb|EEF37129.1| amino acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224129764|ref|XP_002320665.1| predicted protein [Populus trichocarpa] gi|222861438|gb|EEE98980.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496882|ref|XP_002265013.2| PREDICTED: uncharacterized protein LOC100264704 [Vitis vinifera] gi|296085715|emb|CBI29515.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449508537|ref|XP_004163340.1| PREDICTED: uncharacterized protein LOC101229243 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451315|ref|XP_004143407.1| PREDICTED: uncharacterized protein LOC101215529 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356497013|ref|XP_003517359.1| PREDICTED: uncharacterized protein LOC100781435 [Glycine max] Back     alignment and taxonomy information
>gi|356541590|ref|XP_003539257.1| PREDICTED: uncharacterized protein LOC100811109 [Glycine max] Back     alignment and taxonomy information
>gi|357482521|ref|XP_003611547.1| ACT domain-containing protein [Medicago truncatula] gi|355512882|gb|AES94505.1| ACT domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297794201|ref|XP_002864985.1| hypothetical protein ARALYDRAFT_919932 [Arabidopsis lyrata subsp. lyrata] gi|297310820|gb|EFH41244.1| hypothetical protein ARALYDRAFT_919932 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query424
TAIR|locus:2152094477 ACR1 "ACT domain repeat 1" [Ar 0.964 0.857 0.560 1.1e-117
TAIR|locus:2025317453 ACR3 "ACT domain repeat 3" [Ar 0.870 0.814 0.5 3.4e-93
TAIR|locus:2145482500 AT5G25320 [Arabidopsis thalian 0.622 0.528 0.415 5e-89
TAIR|locus:2033223455 ACR4 "ACT domain repeat 4" [Ar 0.849 0.791 0.484 2e-88
TAIR|locus:2044289456 ACR5 "ACT domain repeat 5" [Ar 0.865 0.804 0.471 1.9e-83
TAIR|locus:2078678433 ACR6 "ACT domain repeat 6" [Ar 0.672 0.658 0.449 1.2e-60
TAIR|locus:2132609449 ACR7 "ACT domain repeat 7" [Ar 0.643 0.608 0.449 1.5e-58
TAIR|locus:2034630441 ACR8 "AT1G12420" [Arabidopsis 0.672 0.646 0.427 1.1e-57
TAIR|locus:2039782411 ACR9 "ACT domain repeats 9" [A 0.554 0.571 0.242 7.2e-05
TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1159 (413.0 bits), Expect = 1.1e-117, P = 1.1e-117
 Identities = 240/428 (56%), Positives = 298/428 (69%)

Query:     1 MVQVLTDLELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQALCASRRGGGA 60
             MVQVL DL+LVISK YISSDG WFMDVFHVTDQLGNKLTD +LILYIQQA+C+SR GG  
Sbjct:    53 MVQVLADLDLVISKCYISSDGEWFMDVFHVTDQLGNKLTDRSLILYIQQAICSSRTGG-I 111

Query:    61 SNEVQKCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTR 120
             + E+Q  LKR+V+ RHVSTE+TA E+TG++RPGL+SEISAVL ++GCHV AAVAWTH  R
Sbjct:   112 TKEMQSNLKREVQQRHVSTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHER 171

Query:   121 AACIFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSV--RLTTP--MP-GRT 175
             AA + Y+EDG  G PI  P   A V++ L+ V+ AHH  G+   V  R+     +P G  
Sbjct:   172 AAMVIYLEDGFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDVSHVVVRVVEAKGVPVGWA 231

Query:   176 HTERRLHQLMYADRDYELCRGCD--GGA--GHWNG-CTRTHVLIDSCKEKGYSVVNIKCI 230
             HTERRLH+LMY + DYE C  CD  G      W G C R HV I++C   GYS+VN+KC 
Sbjct:   232 HTERRLHELMYGEGDYENCFDCDCFGDRCDALWRGRCERIHVTIEACN--GYSMVNVKCR 289

Query:   231 DRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQRQKLTQCLI 290
             DRPKLLFDT+CAL +LQ+VVFHA   +KG  A+QEYFIR+ +G TL+TE QR++L  CL+
Sbjct:   290 DRPKLLFDTVCALKELQFVVFHAVAGAKGSTAEQEYFIRKKNGGTLETEGQRERLRHCLV 349

Query:   291 AAIERRVSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNGEKATGSFYVMDAS 350
             AAI RR S GL+LEI T+N+MGLLSDVTR  RENGLS++ AE+ T GE A GSFYV D +
Sbjct:   350 AAISRRASQGLKLEIRTENKMGLLSDVTRVVRENGLSITRAEMCTQGEIAVGSFYVTDVN 409

Query:   351 GHDVNQRTVELLKQEIGGSVLVVNKSSNRTXXXXXXXXXXXXXXXXXLDDRPKFSLGNLL 410
             G +     VE + +E+GG+V+   K                        D+ K S+G + 
Sbjct:   410 GGETGPSEVEAVVRELGGAVVSAVKGVGMMPRRIGSTSDSVE------QDKAKSSIGRMF 463

Query:   411 WSRLERLS 418
             WS+LERLS
Sbjct:   464 WSKLERLS 471




GO:0008152 "metabolic process" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISS
TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145482 AT5G25320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039782 ACR9 "ACT domain repeats 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_VII000505
hypothetical protein (482 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query424
cd0489775 cd04897, ACT_ACR_3, ACT domain-containing protein 6e-35
cd0489572 cd04895, ACT_ACR_1, ACT domain-containing protein 4e-29
cd0492672 cd04926, ACT_ACR_4, C-terminal ACT domain, of a no 4e-29
cd0492574 cd04925, ACT_ACR_2, ACT domain-containing protein 4e-26
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 9e-18
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 2e-17
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 5e-15
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 8e-13
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 9e-12
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 7e-10
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 9e-09
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 1e-08
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 1e-08
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 2e-08
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 7e-08
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 2e-07
pfam0184266 pfam01842, ACT, ACT domain 3e-07
cd0211660 cd02116, ACT, ACT domains are commonly involved in 3e-06
PRK00275895 PRK00275, glnD, PII uridylyl-transferase; Provisio 5e-06
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 7e-06
PRK00275895 PRK00275, glnD, PII uridylyl-transferase; Provisio 1e-05
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 2e-04
PRK03381774 PRK03381, PRK03381, PII uridylyl-transferase; Prov 3e-04
PRK01759854 PRK01759, glnD, PII uridylyl-transferase; Provisio 0.001
cd0490073 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU 0.003
PRK05007884 PRK05007, PRK05007, PII uridylyl-transferase; Prov 0.003
cd0211660 cd02116, ACT, ACT domains are commonly involved in 0.004
>gnl|CDD|153169 cd04897, ACT_ACR_3, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
 Score =  123 bits (311), Expect = 6e-35
 Identities = 47/75 (62%), Positives = 57/75 (76%)

Query: 222 YSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTESQ 281
           YSVV ++C DRPKLLFD +C LTD+ YVVFHA I + G  A QEY+IR  DG TL TE +
Sbjct: 1   YSVVTVQCRDRPKLLFDVVCTLTDMDYVVFHATIDTDGDDAHQEYYIRHKDGRTLSTEGE 60

Query: 282 RQKLTQCLIAAIERR 296
           RQ++ +CL AAIERR
Sbjct: 61  RQRVIKCLEAAIERR 75


This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 75

>gnl|CDD|153167 cd04895, ACT_ACR_1, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153197 cd04925, ACT_ACR_2, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|190133 pfam01842, ACT, ACT domain Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|234980 PRK01759, glnD, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|235329 PRK05007, PRK05007, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 424
PRK05007884 PII uridylyl-transferase; Provisional 99.96
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.96
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.95
PRK05007884 PII uridylyl-transferase; Provisional 99.95
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.94
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.94
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.93
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.93
PRK05092931 PII uridylyl-transferase; Provisional 99.93
PRK04374869 PII uridylyl-transferase; Provisional 99.93
PRK03059856 PII uridylyl-transferase; Provisional 99.92
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.92
PRK03381774 PII uridylyl-transferase; Provisional 99.92
PRK04374869 PII uridylyl-transferase; Provisional 99.91
PRK03381774 PII uridylyl-transferase; Provisional 99.91
PRK05092931 PII uridylyl-transferase; Provisional 99.9
PRK03059856 PII uridylyl-transferase; Provisional 99.89
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.88
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.84
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.81
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.81
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.79
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.75
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.75
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.7
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.64
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.6
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.58
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.55
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.55
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.52
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.49
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.37
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.35
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 99.33
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.32
COG2716176 GcvR Glycine cleavage system regulatory protein [A 99.31
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 99.25
COG2716176 GcvR Glycine cleavage system regulatory protein [A 99.22
PRK00227693 glnD PII uridylyl-transferase; Provisional 99.21
PRK00227693 glnD PII uridylyl-transferase; Provisional 99.21
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.21
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.98
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.87
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.78
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.48
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 98.38
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.38
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.37
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.36
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.23
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 98.2
COG4747142 ACT domain-containing protein [General function pr 98.19
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 98.16
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 98.08
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.98
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.95
PRK0019490 hypothetical protein; Validated 97.94
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.9
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.87
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.84
PRK0019490 hypothetical protein; Validated 97.82
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 97.82
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.65
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.61
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.46
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 97.4
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 97.4
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.39
COG383090 ACT domain-containing protein [Signal transduction 97.35
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 97.32
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 97.28
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 97.27
COG4747142 ACT domain-containing protein [General function pr 97.25
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 97.24
CHL00100174 ilvH acetohydroxyacid synthase small subunit 97.18
COG383090 ACT domain-containing protein [Signal transduction 97.18
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 97.15
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 97.15
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 97.06
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.05
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 97.03
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 96.97
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 96.96
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.95
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 96.94
PRK07431587 aspartate kinase; Provisional 96.92
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.89
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 96.89
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 96.88
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 96.84
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.81
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.81
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.79
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 96.74
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 96.73
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.73
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.73
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.64
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.64
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 96.61
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.58
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.56
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 96.56
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 96.56
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 96.55
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.53
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 96.52
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 96.51
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.49
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 96.47
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 96.4
CHL00100174 ilvH acetohydroxyacid synthase small subunit 96.39
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 96.33
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 96.2
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.19
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.17
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.17
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.16
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.13
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.12
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 96.08
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 96.07
PRK08577136 hypothetical protein; Provisional 96.04
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 96.01
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 95.98
PRK08577136 hypothetical protein; Provisional 95.97
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 95.87
PRK11899279 prephenate dehydratase; Provisional 95.85
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 95.83
PRK04435147 hypothetical protein; Provisional 95.81
cd0211660 ACT ACT domains are commonly involved in specifica 95.81
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 95.78
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 95.77
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.75
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 95.71
PRK04435147 hypothetical protein; Provisional 95.6
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.53
PRK07431587 aspartate kinase; Provisional 95.53
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 95.41
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 95.4
cd0211660 ACT ACT domains are commonly involved in specifica 95.27
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 95.26
PRK07334403 threonine dehydratase; Provisional 95.19
COG0077279 PheA Prephenate dehydratase [Amino acid transport 95.12
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 95.1
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 94.96
PRK06635404 aspartate kinase; Reviewed 94.66
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 94.64
PRK07334403 threonine dehydratase; Provisional 94.53
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 94.4
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 94.31
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 94.19
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 93.98
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 93.92
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 93.65
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 93.31
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.31
PRK08210403 aspartate kinase I; Reviewed 93.19
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 93.15
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 93.14
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 93.1
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 93.09
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 92.98
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 92.43
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 92.41
PRK06291465 aspartate kinase; Provisional 92.35
PRK14630143 hypothetical protein; Provisional 92.34
COG1707218 ACT domain-containing protein [General function pr 92.27
PRK06635404 aspartate kinase; Reviewed 92.12
COG0527447 LysC Aspartokinases [Amino acid transport and meta 92.04
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 92.0
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 91.99
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 91.76
PLN02317382 arogenate dehydratase 91.75
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 91.7
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 91.57
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 91.07
PRK09034454 aspartate kinase; Reviewed 90.87
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 90.71
PRK06349426 homoserine dehydrogenase; Provisional 90.61
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 90.57
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 90.45
PRK14646155 hypothetical protein; Provisional 90.42
PRK08818370 prephenate dehydrogenase; Provisional 90.32
PLN02551521 aspartokinase 90.26
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 90.19
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 90.12
PRK14634155 hypothetical protein; Provisional 89.81
PRK14636176 hypothetical protein; Provisional 89.77
PRK14645154 hypothetical protein; Provisional 89.42
PRK06382406 threonine dehydratase; Provisional 89.19
PRK06382406 threonine dehydratase; Provisional 89.02
PRK09181475 aspartate kinase; Validated 88.84
PRK06545359 prephenate dehydrogenase; Validated 88.72
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 88.69
COG1707218 ACT domain-containing protein [General function pr 87.96
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 87.82
TIGR01268 436 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra 87.66
PRK14637151 hypothetical protein; Provisional 87.26
PRK14640152 hypothetical protein; Provisional 87.14
PRK14647159 hypothetical protein; Provisional 87.04
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal 86.96
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 86.71
PRK06545359 prephenate dehydrogenase; Validated 86.36
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK 86.24
PRK11898283 prephenate dehydratase; Provisional 86.16
KOG2663 309 consensus Acetolactate synthase, small subunit [Am 85.98
PRK09224504 threonine dehydratase; Reviewed 85.83
TIGR01270 464 Trp_5_monoox tryptophan 5-monooxygenase, tetrameri 85.82
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 85.74
PRK12483521 threonine dehydratase; Reviewed 85.52
PRK00092154 ribosome maturation protein RimP; Reviewed 85.1
PRK14638150 hypothetical protein; Provisional 85.03
KOG2663309 consensus Acetolactate synthase, small subunit [Am 84.88
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 84.78
PRK14639140 hypothetical protein; Provisional 84.77
PRK14633150 hypothetical protein; Provisional 84.62
PRK08198404 threonine dehydratase; Provisional 84.21
TIGR00657441 asp_kinases aspartate kinase. The Lys-sensitive en 84.16
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 83.91
PRK11899279 prephenate dehydratase; Provisional 83.21
PRK06349426 homoserine dehydrogenase; Provisional 83.1
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 83.0
PRK09084448 aspartate kinase III; Validated 82.75
PRK14631174 hypothetical protein; Provisional 82.69
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 82.51
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 82.49
PRK08818370 prephenate dehydrogenase; Provisional 82.36
PRK08210403 aspartate kinase I; Reviewed 82.06
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 81.59
PRK14643164 hypothetical protein; Provisional 81.57
COG0077279 PheA Prephenate dehydratase [Amino acid transport 81.5
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 81.49
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 81.4
PRK06291465 aspartate kinase; Provisional 81.33
COG0779153 Uncharacterized protein conserved in bacteria [Fun 81.3
PRK14632172 hypothetical protein; Provisional 80.99
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona 80.71
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to th 80.7
PRK09034454 aspartate kinase; Reviewed 80.66
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 80.21
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
Probab=99.96  E-value=7.6e-28  Score=267.63  Aligned_cols=162  Identities=23%  Similarity=0.348  Sum_probs=148.9

Q ss_pred             CccEEEEeecCCCCeEEEEEEecCChhHHHHHHHHHHhCCceEEEEEEEe-eCCeEEEEEEEeecCCCCCCCHHHHHHHH
Q 014457          208 TRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISS-KGCFADQEYFIRQTDGCTLDTESQRQKLT  286 (424)
Q Consensus       208 ~~p~V~v~~~~~~~~tvV~V~~~DRpgLL~~i~~~L~~~gl~I~~A~I~T-~~~~a~d~F~V~~~~g~~~~~~~~~~~l~  286 (424)
                      .+|.|.+++.++.++++|+|+++||||||++||++|+.+|+||.+|+|+| .+|+++|+|||++.+|.++. ++++++|+
T Consensus       687 ~~p~V~i~~~~~~~~t~V~V~a~DrpGLfa~Ia~~La~~~L~I~~A~I~T~~dg~alD~F~V~d~~g~~~~-~~~~~~I~  765 (884)
T PRK05007        687 DKPLVLLSKQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTSRDGMAMDTFIVLEPDGSPLS-QDRHQVIR  765 (884)
T ss_pred             CCCeEEEEecCCCCeEEEEEEecCCcCHHHHHHHHHHHCCCEEEEEEEEEcCCCeEEEEEEEECCCCCCCC-HHHHHHHH
Confidence            57889999999999999999999999999999999999999999999998 56799999999999999884 56889999


Q ss_pred             HHHHHHHhhc---------C--------------------CCceEEEEEeCCCCchHHHHHHHHHHCCceEEEEEEeecC
Q 014457          287 QCLIAAIERR---------V--------------------SHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNG  337 (424)
Q Consensus       287 ~~L~~al~rr---------~--------------------~~~~~lev~~~DrpGLL~~Itr~l~e~gl~I~~A~i~T~g  337 (424)
                      ++|+++|..+         .                    +.+|+|||.|.|||||||+|+++|.++|++|++|+|+|.|
T Consensus       766 ~~L~~aL~~~~~~~~~~~~~~~~~~~~~~~~~V~~d~~~s~~~TvlEV~a~DRpGLL~~I~~~l~~~~l~I~~AkI~T~g  845 (884)
T PRK05007        766 KALEQALTQSSPQPPKPRRLPAKLRHFNVPTEVSFLPTHTDRRSYMELIALDQPGLLARVGKIFADLGISLHGARITTIG  845 (884)
T ss_pred             HHHHHHHcCCCCCcccccccccccCCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCcEEEEEEEeccC
Confidence            9999998422         0                    1268999999999999999999999999999999999999


Q ss_pred             CceeeEEEEEeCCCCCCChHHHHHHHHHHHhhh
Q 014457          338 EKATGSFYVMDASGHDVNQRTVELLKQEIGGSV  370 (424)
Q Consensus       338 ~~a~d~Fyv~d~~g~~v~~~~~~~lr~~l~~~~  370 (424)
                      ++|+|+|||++.+|.|++++.++.|+++|.+++
T Consensus       846 era~DvFyV~~~~g~~l~~~~~~~l~~~L~~~l  878 (884)
T PRK05007        846 ERVEDLFILATADRRALNEELQQELRQRLTEAL  878 (884)
T ss_pred             ceEEEEEEEEcCCCCcCCHHHHHHHHHHHHHHH
Confidence            999999999999999999778899999999876



>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PRK14630 hypothetical protein; Provisional Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PLN02317 arogenate dehydratase Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK14646 hypothetical protein; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PRK14645 hypothetical protein; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>PRK14637 hypothetical protein; Provisional Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>PRK14647 hypothetical protein; Provisional Back     alignment and domain information
>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK14631 hypothetical protein; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14632 hypothetical protein; Provisional Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query424
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 54.9 bits (131), Expect = 3e-08
 Identities = 60/344 (17%), Positives = 104/344 (30%), Gaps = 113/344 (32%)

Query: 8   LELVISKSYISSDGGWFMDVFHVTDQLGNKLTDETLILYIQQ--ALCASRRGGGASNEVQ 65
           +E V+  +Y      + M       +  + +T      YI+Q   L          N+ Q
Sbjct: 83  VEEVLRINY-----KFLMSPIKTEQRQPSMMTRM----YIEQRDRLY---------NDNQ 124

Query: 66  KCLKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYEL------------GC--HVPA 111
                     +VS            R     ++   L EL            G      A
Sbjct: 125 V-----FAKYNVS------------RLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVA 167

Query: 112 A-VAWTHKTRAAC---IFYIEDGLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRL 167
             V  ++K +      IF++       P T  EML    ++L   +  +       S  +
Sbjct: 168 LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEML----QKLLYQIDPNWTSRSDHSSNI 223

Query: 168 TTPMPGRTHTER-RLHQLMYADRDYELCRGCDGGAGHWNGCTRTHVLI--DSCKEKGYSV 224
                 R H+ +  L +L+   + YE C                 +L+  +    K ++ 
Sbjct: 224 ----KLRIHSIQAELRRLL-KSKPYENC-----------------LLVLLNVQNAKAWNA 261

Query: 225 VNIKC----IDRPKLLFDTLCALTDLQYVVFHAAISSKGCFADQEYFIRQTDGCTLDTES 280
            N+ C      R K + D L A T     + H    S                    T  
Sbjct: 262 FNLSCKILLTTRFKQVTDFLSAATTTHISLDH---HSMT-L----------------TPD 301

Query: 281 QRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFREN 324
           + + L   L+  ++ R    L  E+ T N    LS +  + R+ 
Sbjct: 302 EVKSL---LLKYLDCRPQ-DLPREVLTTNPR-RLSIIAESIRDG 340


>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query424
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.75
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.7
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.67
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.61
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 98.76
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 98.64
2f06_A144 Conserved hypothetical protein; structural genomic 98.6
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 98.15
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 98.07
2f06_A144 Conserved hypothetical protein; structural genomic 98.02
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.84
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.79
2re1_A167 Aspartokinase, alpha and beta subunits; structural 97.6
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 97.33
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 97.22
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 97.22
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 97.18
2re1_A167 Aspartokinase, alpha and beta subunits; structural 97.15
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 97.08
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 97.04
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 96.97
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 96.95
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 96.93
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 96.92
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 96.92
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 96.9
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 96.9
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 96.86
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 96.82
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 96.76
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 96.68
2pc6_A165 Probable acetolactate synthase isozyme III (small; 96.67
2pc6_A165 Probable acetolactate synthase isozyme III (small; 96.63
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 96.59
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 96.44
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 96.38
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 96.37
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 95.99
1y7p_A223 Hypothetical protein AF1403; structural genomics, 95.65
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 95.51
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 95.5
1y7p_A223 Hypothetical protein AF1403; structural genomics, 95.39
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 95.37
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 95.32
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 95.04
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 94.94
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 94.67
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 94.37
3luy_A329 Probable chorismate mutase; structural genomics, A 94.31
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 94.06
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 93.84
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 92.77
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 91.3
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 90.36
3tvi_A446 Aspartokinase; structural genomics, ACT domains, r 89.39
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 88.93
1phz_A 429 Protein (phenylalanine hydroxylase); aromatic amin 88.05
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 87.86
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 85.79
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 85.71
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 85.35
2cdq_A510 Aspartokinase; aspartate kinase, amino acid metabo 84.48
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
Probab=99.75  E-value=1.3e-17  Score=153.82  Aligned_cols=142  Identities=15%  Similarity=0.096  Sum_probs=112.7

Q ss_pred             CeEEEEEEecCChhHHHHHHHHHHhCCceEEEEEEEeeCC-eEEEEEEEeecCCCCCCCHHHHHHHHHHHHHHHhhc---
Q 014457          221 GYSVVNIKCIDRPKLLFDTLCALTDLQYVVFHAAISSKGC-FADQEYFIRQTDGCTLDTESQRQKLTQCLIAAIERR---  296 (424)
Q Consensus       221 ~~tvV~V~~~DRpgLL~~i~~~L~~~gl~I~~A~I~T~~~-~a~d~F~V~~~~g~~~~~~~~~~~l~~~L~~al~rr---  296 (424)
                      ..++|+|+|+|||||++.|+++|+++|+||.++++++..+ +++ .|.|.... .  .....++.|++.|.....+.   
T Consensus         4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m-~~~v~~~~-~--~~~~~~~~l~~~L~~~~~~~~~~   79 (195)
T 2nyi_A            4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAM-IVLVSLNA-K--DGKLIQSALESALPGFQISTRRA   79 (195)
T ss_dssp             EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEE-EEEEEESS-S--SSHHHHHHHHHHSTTCEEEEEEC
T ss_pred             eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEE-EEEEEecC-c--cchhHHHHHHHHHHHHHHhcCCe
Confidence            4579999999999999999999999999999999998555 554 77775432 1  22235677777776543210   


Q ss_pred             ----------CCCceEEEEEeCCCCchHHHHHHHHHHCCceEEEEEEeecC--CceeeEEEEEeCCCCCCChHHHHHHHH
Q 014457          297 ----------VSHGLRLEICTQNRMGLLSDVTRAFRENGLSVSMAEIGTNG--EKATGSFYVMDASGHDVNQRTVELLKQ  364 (424)
Q Consensus       297 ----------~~~~~~lev~~~DrpGLL~~Itr~l~e~gl~I~~A~i~T~g--~~a~d~Fyv~d~~g~~v~~~~~~~lr~  364 (424)
                                ....++|+|.++|||||+++||++|+++|+||..++..|.+  +++.+.||++...+.| .+.. +.|++
T Consensus        80 ~~~~~~~~~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~~~F~m~~~~~~~-~~~~-~~l~~  157 (195)
T 2nyi_A           80 SSVAERHVSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRMGSRVAFP-FPLY-QEVVT  157 (195)
T ss_dssp             CCC----CCTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTCEEEEEEEEEEEE-GGGH-HHHHH
T ss_pred             EEEEeCCcCCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCCCeEEEEEEEEcC-CCcc-HHHHH
Confidence                      11358999999999999999999999999999999999998  7889999998877655 2335 77888


Q ss_pred             HHHh
Q 014457          365 EIGG  368 (424)
Q Consensus       365 ~l~~  368 (424)
                      +|..
T Consensus       158 ~l~~  161 (195)
T 2nyi_A          158 ALSR  161 (195)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            7775



>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 424
d1u8sa186 d.58.18.5 (A:2-87) putative transcriptional repres 0.002
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Glycine cleavage system transcriptional repressor
domain: putative transcriptional repressor VC2159
species: Vibrio cholerae [TaxId: 666]
 Score = 34.8 bits (80), Expect = 0.002
 Identities = 14/72 (19%), Positives = 29/72 (40%), Gaps = 8/72 (11%)

Query: 79  TENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITA 138
           T++  +   G DRPG+ +E+  ++ + GC++  +           +  I          +
Sbjct: 3   TQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLIS--------GS 54

Query: 139 PEMLAHVEEQLE 150
           P  +  VE  L 
Sbjct: 55  PSNITRVETTLP 66


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query424
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.75
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.49
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.46
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.38
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 98.14
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.88
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.85
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.7
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.59
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.48
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.44
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.43
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.41
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.14
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.05
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 96.96
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 96.92
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 96.92
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 96.86
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 96.86
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 96.78
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 96.76
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 96.67
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 96.21
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 93.1
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 91.31
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 87.13
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) 83.92
d2hmfa3100 Aspartokinase {Methanococcus jannaschii [TaxId: 21 80.7
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Glycine cleavage system transcriptional repressor
domain: putative transcriptional repressor VC2159
species: Vibrio cholerae [TaxId: 666]
Probab=98.75  E-value=2e-08  Score=78.02  Aligned_cols=65  Identities=22%  Similarity=0.457  Sum_probs=56.2

Q ss_pred             CCcEEEEEEeCCcchHHHHHHHHHHHcCceEeeEEEEcCCceEEEEEEEecCCCCCCCCcHHHHHHHHHHHHH
Q 014457           79 TENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIEDGLEGRPITAPEMLAHVEEQLEI  151 (424)
Q Consensus        79 ~~~t~iev~~~DRpGLLs~I~~vL~~~~~~I~~A~i~T~~~r~~dvf~V~d~~~g~~i~d~~~~~~i~~~L~~  151 (424)
                      ..+.+|++.|+||||++++++++|+++||||.+++.++.++...-++.|+-+        +..+++++..|..
T Consensus         3 ~~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~~--------~~~~~~l~~~L~~   67 (86)
T d1u8sa1           3 TQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGS--------PSNITRVETTLPL   67 (86)
T ss_dssp             CEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEEC--------HHHHHHHHHHHHH
T ss_pred             ccEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEcC--------cccHHHHHHHHHH
Confidence            3578999999999999999999999999999999999999999999988752        3456778877754



>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure