Citrus Sinensis ID: 014502


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MALACRVLSVAKSSRYLLMPLRFDRLLCNTNTNSTSVSSSNPLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFAEYM
cccHHHHHHHHHHcccccccHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccc
cHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccc
MALACRVLSVAKSSRYLLMPLRFDRLlcntntnstsvsssnplisrllqvpvsqikttldsvdifafnssqfSWDALITSLQSSSPKKAQLVLEWRLDKmlkgnescLDEYACLIALSgkvqnvpfAMHVFTSmeaqgikpdsavFNSLICACLCSGDVVTALSLFEIMVSseeykpnsktydAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHgslkardfdSVDRFYEEMMslgiipsipILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDrlddveysvgrmgkqglsfksaEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFAEYM
malacrvlsvakssrylLMPLRFDRLLCNTNTnstsvsssnpliSRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSeeykpnsktYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSlgiipsipILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMgkqglsfksaedVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYrraglsgkldsviNEMKFAEYM
MALACRVLSVAKSSRYLLMPLRFDRLLCntntnstsvsssnPLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFAEYM
***ACRVLSVAKSSRYLLMPLRFDRLLCNTNT*********PLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQ*****KAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVIN********
*ALACRVLSVAKSSRYLLMPLRFDRLLCNTNTNSTSVSSSNPLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFAEYM
MALACRVLSVAKSSRYLLMPLRFDRLLCNTNT********NPLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFAEYM
MALACRVLSVAKSSRYLLMPLRFDRLLCNTNTNSTSVSSSNPLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFA*Y*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALACRVLSVAKSSRYLLMPLRFDRLLCNTNTNSTSVSSSNPLISRLLQVPVSQIKTTLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEMKFAEYM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query423 2.2.26 [Sep-21-2011]
Q0WVK7741 Pentatricopeptide repeat- yes no 0.567 0.323 0.259 1e-16
O49343452 Pentatricopeptide repeat- no no 0.768 0.719 0.229 4e-16
Q8GWE0 702 Pentatricopeptide repeat- no no 0.702 0.423 0.247 5e-16
Q9M302659 Pentatricopeptide repeat- no no 0.586 0.376 0.232 8e-16
Q9C6S6 840 Putative pentatricopeptid no no 0.645 0.325 0.256 9e-16
Q9ZU88481 Pentatricopeptide repeat- no no 0.768 0.675 0.236 1e-15
Q9SH26577 Pentatricopeptide repeat- no no 0.477 0.350 0.263 4e-15
Q9CAN6590 Pentatricopeptide repeat- no no 0.548 0.393 0.25 5e-15
Q8GZ63574 Pentatricopeptide repeat- no no 0.827 0.609 0.218 7e-15
Q76C99 791 Protein Rf1, mitochondria N/A no 0.550 0.294 0.250 1e-14
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 110/243 (45%), Gaps = 3/243 (1%)

Query: 111 YACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMV 170
           Y  LI    K  ++  A   F  M ++ I PD   + ++I      GD+V A  LF  M 
Sbjct: 354 YTTLIDGFCKRGDIRAASKFFYEMHSRDITPDVLTYTAIISGFCQIGDMVEAGKLFHEMF 413

Query: 171 SSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDF 230
             +  +P+S T+   I+G+   G++    + +   I AG S NV TY +LI G  K  D 
Sbjct: 414 C-KGLEPDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDL 472

Query: 231 DSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKL 290
           DS +    EM  +G+ P+I     ++ GLC    ++     +      G   +      L
Sbjct: 473 DSANELLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTL 532

Query: 291 VKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQ 350
           +  YC+ G +D+ +E L+ +      P ++   F+ ++  + L   L+D E  +  M  +
Sbjct: 533 MDAYCKSGEMDKAQEILKEMLGKGLQPTIVT--FNVLMNGFCLHGMLEDGEKLLNWMLAK 590

Query: 351 GLS 353
           G++
Sbjct: 591 GIA 593





Arabidopsis thaliana (taxid: 3702)
>sp|O49343|PP177_ARATH Pentatricopeptide repeat-containing protein At2g30780 OS=Arabidopsis thaliana GN=At2g30780 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWE0|PP314_ARATH Pentatricopeptide repeat-containing protein At4g16390, chloroplastic OS=Arabidopsis thaliana GN=P67 PE=1 SV=3 Back     alignment and function description
>sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZU88|PP204_ARATH Pentatricopeptide repeat-containing protein At2g48000 OS=Arabidopsis thaliana GN=At2g48000 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=1 SV=1 Back     alignment and function description
>sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
359476047420 PREDICTED: pentatricopeptide repeat-cont 0.983 0.990 0.578 1e-131
147812171 1331 hypothetical protein VITISV_033964 [Viti 0.940 0.299 0.586 1e-129
224092342424 predicted protein [Populus trichocarpa] 0.981 0.978 0.585 1e-128
255551056416 pentatricopeptide repeat-containing prot 0.966 0.983 0.559 1e-121
356554511421 PREDICTED: pentatricopeptide repeat-cont 0.893 0.897 0.544 1e-111
357436533428 Pentatricopeptide repeat-containing prot 0.860 0.850 0.516 7e-96
242042151409 hypothetical protein SORBIDRAFT_01g04648 0.936 0.968 0.405 3e-77
357113964413 PREDICTED: pentatricopeptide repeat-cont 0.893 0.915 0.424 1e-76
414864901410 TPA: hypothetical protein ZEAMMB73_84309 0.912 0.941 0.394 2e-73
125542489409 hypothetical protein OsI_10104 [Oryza sa 0.940 0.973 0.389 2e-73
>gi|359476047|ref|XP_002281582.2| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Vitis vinifera] gi|296081891|emb|CBI20896.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  476 bits (1225), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 246/425 (57%), Positives = 306/425 (72%), Gaps = 9/425 (2%)

Query: 1   MALACRVLSVAKSS---RYLLMPLRFDRLLCNTNTNSTSVSSSNPLISRLLQVPVSQIKT 57
           M    RVLSVAK     R +L+P R  RL C+          SNPL+ +LLQ  +S+IKT
Sbjct: 1   MGFVLRVLSVAKRGLRPRLVLIPCRSQRLFCDKPL------VSNPLLIKLLQESISRIKT 54

Query: 58  TLDSVDIFAFNSSQFSWDALITSLQSSSPKKAQLVLEWRLDKMLKGNESCLDEYACLIAL 117
            LDS D F F SS FSWD L+T+L+SSSP KA LVLEWRL+KM++ NE  L  Y  LI L
Sbjct: 55  VLDSEDNFTFKSSDFSWDILLTTLKSSSPAKAHLVLEWRLEKMVRDNERDLVPYLELIFL 114

Query: 118 SGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSSEEYKP 177
             KVQNVPFAM VF SMEA GIK  S+VFN+LI  CL SG+V+TALSLFEIM SSE  KP
Sbjct: 115 CSKVQNVPFAMRVFNSMEAHGIKLTSSVFNALIYTCLSSGNVMTALSLFEIMQSSENCKP 174

Query: 178 NSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFY 237
           NS+TY+ FIS +S+LGN  AM  WY A   AGFS +++TYESLI G +++R+FD  DRFY
Sbjct: 175 NSETYNTFISVYSNLGNDKAMQAWYLAQKGAGFSADLRTYESLISGCVRSRNFDCADRFY 234

Query: 238 EEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCEL 297
           EEMM  GI+P+  ILE +L GLC +R + +V+  LKF++ G W+IN +MA+KL+  Y E 
Sbjct: 235 EEMMLSGIMPNGQILENILRGLCEQRSISKVEQLLKFMMDGEWEINVSMAEKLMGLYFEH 294

Query: 298 GRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGKQGLSFKSA 357
           G V+++EE L  L   NQS  VL     GIIR++A+ DRLDD+EYSVGRM KQG+SF+  
Sbjct: 295 GTVEKMEELLLNLMNSNQSFAVLQQVHCGIIRMHAMLDRLDDMEYSVGRMLKQGMSFRCP 354

Query: 358 EDVEMVICSYFRCAAYDRLDLFLDHIKGSYKLRRATYDFLVAGYRRAGLSGKLDSVINEM 417
           +D+E V+C+YFR  AY+RLDLFL HIKGSYKL ++TYD LVAGYRRAGLS KLD V++ M
Sbjct: 355 DDIEKVVCAYFRREAYERLDLFLGHIKGSYKLTKSTYDLLVAGYRRAGLSEKLDLVMDGM 414

Query: 418 KFAEY 422
           K A +
Sbjct: 415 KLAGF 419




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147812171|emb|CAN61515.1| hypothetical protein VITISV_033964 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224092342|ref|XP_002309567.1| predicted protein [Populus trichocarpa] gi|222855543|gb|EEE93090.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255551056|ref|XP_002516576.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544396|gb|EEF45917.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356554511|ref|XP_003545589.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357436533|ref|XP_003588542.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477590|gb|AES58793.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|242042151|ref|XP_002468470.1| hypothetical protein SORBIDRAFT_01g046480 [Sorghum bicolor] gi|241922324|gb|EER95468.1| hypothetical protein SORBIDRAFT_01g046480 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357113964|ref|XP_003558771.1| PREDICTED: pentatricopeptide repeat-containing protein At2g48000-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|414864901|tpg|DAA43458.1| TPA: hypothetical protein ZEAMMB73_843092 [Zea mays] Back     alignment and taxonomy information
>gi|125542489|gb|EAY88628.1| hypothetical protein OsI_10104 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
TAIR|locus:2054462452 AT2G30780 "AT2G30780" [Arabido 0.775 0.725 0.231 5.8e-17
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.744 0.500 0.244 1.4e-15
TAIR|locus:2034528 840 AT1G31840 [Arabidopsis thalian 0.621 0.313 0.261 6.5e-15
TAIR|locus:2027382 657 AT1G11710 "AT1G11710" [Arabido 0.690 0.444 0.238 7.2e-15
TAIR|locus:2099458659 AT3G48810 "AT3G48810" [Arabido 0.661 0.424 0.224 7.3e-15
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.475 0.348 0.271 3.5e-14
TAIR|locus:2130549 702 SVR7 "suppressor of variegatio 0.548 0.330 0.271 3.8e-14
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.744 0.5 0.241 4.1e-14
TAIR|locus:2015218590 AT1G63070 [Arabidopsis thalian 0.479 0.344 0.263 1e-13
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.761 0.351 0.248 1.3e-13
TAIR|locus:2054462 AT2G30780 "AT2G30780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 233 (87.1 bits), Expect = 5.8e-17, P = 5.8e-17
 Identities = 77/333 (23%), Positives = 147/333 (44%)

Query:    92 VLEWRLDKMLKGNESCLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLIC 151
             VLEWR  +         +EYA  I ++G+ +++  A+++F     + ++  S V+NSL+ 
Sbjct:    88 VLEWRRGQKDYCIPLTSEEYAKGIKIAGRARDINLAVYLFDEAAKKRMQTAS-VYNSLMS 146

Query:   152 ACLCSGDVVTALSLFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFS 211
               + +G      SLF+         P   TY+  +S +  L  V  M   +         
Sbjct:   147 VYMWNGLAEECQSLFKDFRRQTHCAPTVVTYNILVSVYGRLLMVKNMEAAFEELQKVKLP 206

Query:   212 VNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVKSF 271
              N  TY  LI G + A ++D ++  ++EM    + P     + +L G      L+R++  
Sbjct:   207 PNSVTYNFLIAGYMTAWNWDKMEATFQEMKRGPVEPDTDTYQLMLRGYANSGNLNRMEEM 266

Query:   272 LKFLLGGGWKINEN-MAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRL 330
              + ++     +N   + + ++  YC+   V++  +++E L       E L      +IRL
Sbjct:   267 YE-VIKDQVGVNSGPLVRAMICAYCKKA-VEDRVQKIENLLSLLSGEEYLPWLNVLLIRL 324

Query:   331 YALSDRLDDVEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYDRLDLFLDHIKGS-YKL 389
             YA  D ++ +E  +    +Q      +  +  +I +YFRC   D L  F+   + + +KL
Sbjct:   325 YAQEDFVEAMESKINEAFEQKTCVNKSSIMRAIIAAYFRCNEVDNLANFVKRAESAGWKL 384

Query:   390 RRATYDFLVAGYRRAGLSGKLDSVINEMKFAEY 422
              R+ Y   +  Y       +++ V+NEM    Y
Sbjct:   385 CRSLYHCKIMMYGSQKRFEEMEGVVNEMAETNY 417




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034528 AT1G31840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027382 AT1G11710 "AT1G11710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099458 AT3G48810 "AT3G48810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130549 SVR7 "suppressor of variegation 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015218 AT1G63070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00032475001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (420 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-06
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 53.0 bits (127), Expect = 2e-07
 Identities = 38/157 (24%), Positives = 69/157 (43%), Gaps = 4/157 (2%)

Query: 109 DE--YACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLF 166
           DE  ++ L+ ++G   ++  A  +      QGIK  +  ++SL+ AC  + +   AL L+
Sbjct: 648 DEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELY 707

Query: 167 EIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLK 226
           E + S  + +P   T +A I+       +    +  +     G   N  TY  L+  S +
Sbjct: 708 EDIKSI-KLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASER 766

Query: 227 ARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARR 263
             D D       +    GI P+  ++ + + GLC RR
Sbjct: 767 KDDADVGLDLLSQAKEDGIKPN-LVMCRCITGLCLRR 802


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 423
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.8
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.79
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.78
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.77
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.74
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.71
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.71
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.7
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.65
PRK14574 822 hmsH outer membrane protein; Provisional 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.57
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.55
KOG2076 895 consensus RNA polymerase III transcription factor 99.54
KOG2076 895 consensus RNA polymerase III transcription factor 99.51
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.5
KOG1126638 consensus DNA-binding cell division cycle control 99.48
PF1304150 PPR_2: PPR repeat family 99.47
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.46
PRK12370553 invasion protein regulator; Provisional 99.45
KOG2003 840 consensus TPR repeat-containing protein [General f 99.45
PF1304150 PPR_2: PPR repeat family 99.44
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.43
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.41
PRK12370553 invasion protein regulator; Provisional 99.4
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.39
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.37
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.36
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.34
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.3
KOG1129478 consensus TPR repeat-containing protein [General f 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.25
KOG1129478 consensus TPR repeat-containing protein [General f 99.25
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.21
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.2
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.19
KOG2003840 consensus TPR repeat-containing protein [General f 99.17
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.12
PRK11189296 lipoprotein NlpI; Provisional 99.1
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.1
PRK11189296 lipoprotein NlpI; Provisional 99.09
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.09
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.08
KOG0547606 consensus Translocase of outer mitochondrial membr 99.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.03
KOG0547606 consensus Translocase of outer mitochondrial membr 99.01
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.01
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.0
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.98
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.97
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.95
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.93
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.91
PF1285434 PPR_1: PPR repeat 98.9
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.88
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.88
PF1285434 PPR_1: PPR repeat 98.86
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.85
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.78
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.78
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.74
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.69
KOG1128777 consensus Uncharacterized conserved protein, conta 98.63
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.61
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.61
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.6
PRK04841 903 transcriptional regulator MalT; Provisional 98.59
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.59
PLN02789320 farnesyltranstransferase 98.59
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.58
KOG1125579 consensus TPR repeat-containing protein [General f 98.58
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.58
PLN02789320 farnesyltranstransferase 98.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.58
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.56
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.55
KOG1125579 consensus TPR repeat-containing protein [General f 98.54
PRK04841 903 transcriptional regulator MalT; Provisional 98.53
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.5
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.49
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.49
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.45
PRK10370198 formate-dependent nitrite reductase complex subuni 98.45
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.44
PRK15359144 type III secretion system chaperone protein SscB; 98.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.41
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.41
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.4
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.38
PRK10370198 formate-dependent nitrite reductase complex subuni 98.36
PRK15359144 type III secretion system chaperone protein SscB; 98.34
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.33
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.33
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.32
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.3
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.29
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.28
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.25
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.25
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.24
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.23
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.2
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.19
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.17
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.16
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.15
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 98.12
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.12
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.12
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.1
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.09
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.09
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.08
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.08
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.08
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.07
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.01
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.92
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.89
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.83
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.82
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.74
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.74
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.7
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.68
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.63
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.61
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.61
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.57
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.54
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.53
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.49
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.48
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.45
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.44
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.43
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.37
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.34
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.34
PF12688120 TPR_5: Tetratrico peptide repeat 97.33
KOG0553304 consensus TPR repeat-containing protein [General f 97.31
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.29
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.29
PF12688120 TPR_5: Tetratrico peptide repeat 97.24
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.24
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.12
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.12
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.11
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.08
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.0
COG3898531 Uncharacterized membrane-bound protein [Function u 96.98
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.97
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.96
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.96
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.93
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.91
KOG0553304 consensus TPR repeat-containing protein [General f 96.91
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.82
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.82
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.81
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.79
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.75
COG4700251 Uncharacterized protein conserved in bacteria cont 96.75
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.7
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.7
PRK10803263 tol-pal system protein YbgF; Provisional 96.67
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.65
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.64
PRK10803263 tol-pal system protein YbgF; Provisional 96.64
smart00299140 CLH Clathrin heavy chain repeat homology. 96.53
COG4700251 Uncharacterized protein conserved in bacteria cont 96.45
KOG3941406 consensus Intermediate in Toll signal transduction 96.44
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.35
PRK15331165 chaperone protein SicA; Provisional 96.34
PF1337173 TPR_9: Tetratricopeptide repeat 96.34
PF1337173 TPR_9: Tetratricopeptide repeat 96.17
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.14
KOG3941406 consensus Intermediate in Toll signal transduction 96.11
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.1
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.08
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.08
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.05
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.01
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.99
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.98
COG3898 531 Uncharacterized membrane-bound protein [Function u 95.95
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.94
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.89
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.86
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.85
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.85
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.73
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.72
smart00299140 CLH Clathrin heavy chain repeat homology. 95.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.48
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.41
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.36
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.34
PF13512142 TPR_18: Tetratricopeptide repeat 95.34
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.32
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.21
PRK15331165 chaperone protein SicA; Provisional 95.16
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.14
PF1342844 TPR_14: Tetratricopeptide repeat 95.13
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.05
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.99
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.97
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.86
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.78
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.73
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.62
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.41
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.35
COG3629280 DnrI DNA-binding transcriptional activator of the 94.23
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.21
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.1
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.95
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.88
KOG1586288 consensus Protein required for fusion of vesicles 93.83
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 93.7
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.68
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.64
PRK11906458 transcriptional regulator; Provisional 93.54
KOG1550552 consensus Extracellular protein SEL-1 and related 93.35
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.34
COG3629280 DnrI DNA-binding transcriptional activator of the 93.25
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.15
PF13512142 TPR_18: Tetratricopeptide repeat 93.14
KOG4555175 consensus TPR repeat-containing protein [Function 93.12
PF1342844 TPR_14: Tetratricopeptide repeat 93.02
PF13929292 mRNA_stabil: mRNA stabilisation 93.01
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.94
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.71
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.7
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.37
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.2
PF13929292 mRNA_stabil: mRNA stabilisation 92.18
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.13
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.12
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.11
KOG4555175 consensus TPR repeat-containing protein [Function 92.02
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.97
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.49
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 91.48
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 91.41
PRK11619 644 lytic murein transglycosylase; Provisional 91.02
PF1343134 TPR_17: Tetratricopeptide repeat 90.98
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.59
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.41
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 90.27
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.8
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 89.14
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.94
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.81
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.58
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.04
PF1343134 TPR_17: Tetratricopeptide repeat 88.0
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 87.53
COG3947361 Response regulator containing CheY-like receiver a 87.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.96
PF13762145 MNE1: Mitochondrial splicing apparatus component 86.94
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 86.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.54
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.46
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.24
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.14
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.09
PRK09687280 putative lyase; Provisional 85.95
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.94
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 85.74
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.67
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.48
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.0
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 84.32
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 83.63
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 83.02
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.92
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 82.72
PHA02875 413 ankyrin repeat protein; Provisional 82.71
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.42
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 82.3
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.93
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 80.81
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.53
KOG1585308 consensus Protein required for fusion of vesicles 80.42
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.4
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 80.09
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.6e-61  Score=478.47  Aligned_cols=383  Identities=19%  Similarity=0.212  Sum_probs=359.1

Q ss_pred             CCCccccHHHHHHHhcCCc-hhHHHHHHHhhhccCCcChhhHHHHHHH-HhcCCHHHHHHHHHHHHHHHhhCCC-CCHhH
Q 014502           34 STSVSSSNPLISRLLQVPV-SQIKTTLDSVDIFAFNSSQFSWDALITS-LQSSSPKKAQLVLEWRLDKMLKGNE-SCLDE  110 (423)
Q Consensus        34 ~~~~~~~~~ll~~l~~~~~-~~~~~~~~~m~~~g~~p~~~~~~~li~~-~~~~~~~~a~~~~~~~~~~m~~~~~-~~~~~  110 (423)
                      .|+..+||.++..+++.+. ..+.++|+.|.+.|+.||..+||++|.+ ++.|+.++|.++    |++|.+.+. ||..+
T Consensus       434 ~pd~~Tyn~LL~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~v----f~eM~~~Gv~PdvvT  509 (1060)
T PLN03218        434 NPTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEV----FHEMVNAGVEANVHT  509 (1060)
T ss_pred             CCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHH----HHHHHHcCCCCCHHH
Confidence            4899999999999999994 5669999999999999999999999999 799999999999    688888777 89999


Q ss_pred             HHHHHHHHhcCCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhc-CCCCCCHHhHHHHHHHH
Q 014502          111 YACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALSLFEIMVSS-EEYKPNSKTYDAFISGF  189 (423)
Q Consensus       111 ~~~l~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~-~~~~p~~~~~~~li~~~  189 (423)
                      |+.||.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|... .|+.||..+|+++|.+|
T Consensus       510 ynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay  589 (1060)
T PLN03218        510 FGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKAC  589 (1060)
T ss_pred             HHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999752 57899999999999999


Q ss_pred             HhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHH
Q 014502          190 SSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGLCARRKLDRVK  269 (423)
Q Consensus       190 ~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~  269 (423)
                      ++.|++++|.++|++|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|++|++.|++++|.
T Consensus       590 ~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~  669 (1060)
T PLN03218        590 ANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAF  669 (1060)
T ss_pred             HHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCccCHHhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHhcCChhHHHHHHHHHHh
Q 014502          270 SFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYSVGRMGK  349 (423)
Q Consensus       270 ~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~  349 (423)
                      +++++|.+.|+.||..+|+++|.+|++.|++++|.++|++|.+.|+.|+..+  |+.||.+|++.|++++|.++|++|.+
T Consensus       670 ~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~Pdvvt--yN~LI~gy~k~G~~eeAlelf~eM~~  747 (1060)
T PLN03218        670 EILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVST--MNALITALCEGNQLPKALEVLSEMKR  747 (1060)
T ss_pred             HHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHH--HHHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999988  99999999999999999999999999


Q ss_pred             CCCCCCChHhHHHHHHHHhhccccc-hHHHHHHHHhCCCcccHHHHHHHHHHHHh----c-------------------C
Q 014502          350 QGLSFKSAEDVEMVICSYFRCAAYD-RLDLFLDHIKGSYKLRRATYDFLVAGYRR----A-------------------G  405 (423)
Q Consensus       350 ~~~~~~~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~p~~~~~~~l~~~~~~----~-------------------g  405 (423)
                      .|+.|+ ..+|+.++.+|++.|+.+ +.+++.+|.+.|+.||..+|++++..|.+    +                   +
T Consensus       748 ~Gi~Pd-~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~  826 (1060)
T PLN03218        748 LGLCPN-TITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENK  826 (1060)
T ss_pred             cCCCCC-HHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccc
Confidence            999776 999999999999999995 78899999999999999999999876542    1                   2


Q ss_pred             ChhHHHHHHHHHHhcCCC
Q 014502          406 LSGKLDSVINEMKFAEYM  423 (423)
Q Consensus       406 ~~~~a~~~~~~m~~~g~~  423 (423)
                      ..++|..+|++|.+.|+.
T Consensus       827 w~~~Al~lf~eM~~~Gi~  844 (1060)
T PLN03218        827 WTSWALMVYRETISAGTL  844 (1060)
T ss_pred             hHHHHHHHHHHHHHCCCC
Confidence            346799999999999974



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.1 bits (142), Expect = 1e-09
 Identities = 64/466 (13%), Positives = 123/466 (26%), Gaps = 173/466 (37%)

Query: 8   LSVAK--SSRYLLMPL-----RFDRLLCNTNTNSTSVS----SSNPLISRLLQVPVSQ-- 54
           L++    S   +L  L     + D    + + +S+++     S    + RLL+    +  
Sbjct: 187 LNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENC 246

Query: 55  --IKTTLDSV----DIFAFNSSQFSWDALITSLQSS--SPKKAQLVLEWRLDKMLKGNES 106
             +   L +V       AFN    S   L+T+          A       LD        
Sbjct: 247 LLV---LLNVQNAKAWNAFN---LSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTP 300

Query: 107 CLDEYACLIA--LSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGDVVTALS 164
             DE   L+   L  + Q++P         E     P                     LS
Sbjct: 301 --DEVKSLLLKYLDCRPQDLP--------REVLTTNP-------------------RRLS 331

Query: 165 LFEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGS 224
           +      +E  +    T+D                 W          VN     ++I  S
Sbjct: 332 II-----AESIRDGLATWD----------------NWK--------HVNCDKLTTIIESS 362

Query: 225 LKARDFDSVDRFYEEMMSLGIIP-SIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKIN 283
           L   +     + ++    L + P S  I   +L  +                    W   
Sbjct: 363 LNVLEPAEYRKMFDR---LSVFPPSAHIPTILLSLI--------------------W--- 396

Query: 284 ENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDDVEYS 343
            ++                  + +  + K ++   V        I + ++          
Sbjct: 397 FDV---------------IKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLE------- 434

Query: 344 VGRMGKQGLSFKSAEDVEM---VICSYFRCAAYDRLDLFLDHIKG------SYKLRRAT- 393
                   L  K   +  +   ++  Y     +D  DL   ++         + L+    
Sbjct: 435 --------LKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEH 486

Query: 394 -------------YDFLVAGYRRAGL----SGKLDSVINEMKFAEY 422
                        + FL    R        SG + + + ++KF  Y
Sbjct: 487 PERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKF--Y 530


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.79
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.77
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.73
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
3u4t_A272 TPR repeat-containing protein; structural genomics 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.63
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.63
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.62
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.54
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.53
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.49
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.48
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.37
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.34
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.33
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.28
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.27
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.26
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.24
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.21
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.09
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.07
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.99
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.96
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.93
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.92
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.91
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.9
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.9
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.89
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.89
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.88
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.86
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.84
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.82
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.75
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.69
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.64
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.62
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.56
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.56
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 98.55
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.54
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.52
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.49
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.47
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.45
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.44
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.42
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.41
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.4
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.38
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.36
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.34
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.31
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.29
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.28
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.28
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.26
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.2
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.03
3k9i_A117 BH0479 protein; putative protein binding protein, 98.0
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.98
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.96
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.96
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.92
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.91
3k9i_A117 BH0479 protein; putative protein binding protein, 97.91
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.9
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.86
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.83
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.82
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.81
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.79
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.78
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.76
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.74
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.73
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.72
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.61
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.57
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.55
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.47
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.45
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.4
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.39
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.33
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.23
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.2
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.18
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.1
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.96
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.96
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.79
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.67
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.63
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.57
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.45
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.34
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.29
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.18
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.17
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.92
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.91
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.73
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.72
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.71
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.61
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.52
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.49
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.29
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.01
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.91
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.63
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.35
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.28
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.04
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.88
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.83
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.79
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.13
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.91
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.9
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.84
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.31
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.81
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 90.38
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 89.22
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.54
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.39
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.3
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 87.32
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 85.06
2p58_C116 Putative type III secretion protein YSCG; type III 83.17
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 82.84
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.2
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 81.59
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.33
2p58_C116 Putative type III secretion protein YSCG; type III 81.08
2uwj_G115 Type III export protein PSCG; virulence, chaperone 80.51
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=1.8e-34  Score=272.89  Aligned_cols=200  Identities=15%  Similarity=0.175  Sum_probs=181.6

Q ss_pred             HHHHhhCCC-C-CHhHHHHHHHHHhcCCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCC---------HHHHHHH
Q 014502           97 LDKMLKGNE-S-CLDEYACLIALSGKVQNVPFAMHVFTSMEAQGIKPDSAVFNSLICACLCSGD---------VVTALSL  165 (423)
Q Consensus        97 ~~~m~~~~~-~-~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~---------~~~A~~~  165 (423)
                      .+++.+.+. + ....++.+|++|++.|++++|.++|++|.+.|++||..+||++|.+|++.+.         +++|.++
T Consensus        13 ~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~l   92 (501)
T 4g26_A           13 SRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDI   92 (501)
T ss_dssp             -----------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHH
T ss_pred             HHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHH
Confidence            455555554 2 2456889999999999999999999999999999999999999999987664         6889999


Q ss_pred             HHHHHhcCCCCCCHHhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCC
Q 014502          166 FEIMVSSEEYKPNSKTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGI  245 (423)
Q Consensus       166 ~~~m~~~~~~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~  245 (423)
                      |++|.+ .|+.||..||++||.+|++.|++++|.++|++|.+.|+.||..|||++|.+|++.|++++|.++|++|.+.|+
T Consensus        93 f~~M~~-~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~  171 (501)
T 4g26_A           93 FKQMIV-DKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEV  171 (501)
T ss_dssp             HHHHHH-TTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTC
T ss_pred             HHHHHH-hCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCC
Confidence            999999 8999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCccCHHhHHHHHHHHHhc
Q 014502          246 IPSIPILEKVLEGLCARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCEL  297 (423)
Q Consensus       246 ~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~  297 (423)
                      .||..||+++|.+|++.|+.++|.+++++|.+.|..|+..||+.++..|+..
T Consensus       172 ~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          172 VPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             CCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999999999998764



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.84
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.33
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.26
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.2
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.16
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.1
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.09
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.03
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.93
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.64
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.57
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.34
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.32
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.31
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.19
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.15
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.13
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.12
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.05
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.01
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.96
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.89
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.85
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.82
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.81
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.8
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.77
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.76
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.75
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.7
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.66
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.63
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.45
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.42
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.39
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.27
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.97
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.92
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.68
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.53
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.51
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.38
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.71
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.32
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.51
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.7
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=4.1e-19  Score=160.96  Aligned_cols=216  Identities=11%  Similarity=0.041  Sum_probs=112.0

Q ss_pred             HhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q 014502          180 KTYDAFISGFSSLGNVDAMNKWYAANIAAGFSVNVQTYESLIHGSLKARDFDSVDRFYEEMMSLGIIPSIPILEKVLEGL  259 (423)
Q Consensus       180 ~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~  259 (423)
                      ..+..+...+...|++++|...+++..+.... +...|..+...+...|++++|...+++....+ ..+...+..+...+
T Consensus       170 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~  247 (388)
T d1w3ba_         170 VAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVY  247 (388)
T ss_dssp             HHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHH
T ss_pred             HHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHH
Confidence            34444445555555555565555555544322 34455555555555566666665555554433 23344455555555


Q ss_pred             HhcCCHHHHHHHHHHHHhCCCccCHHhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHhcCChhH
Q 014502          260 CARRKLDRVKSFLKFLLGGGWKINENMAQKLVKCYCELGRVDELEEQLETLTKCNQSPEVLLHFFSGIIRLYALSDRLDD  339 (423)
Q Consensus       260 ~~~g~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~~~li~~~~~~g~~~~  339 (423)
                      .+.|++++|...+++..+.. +.+..++..+...+...|++++|.+.++......  |+.... +..+...+...|++++
T Consensus       248 ~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~--~~~~~~-~~~l~~~~~~~~~~~~  323 (388)
T d1w3ba_         248 YEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADS-LNNLANIKREQGNIEE  323 (388)
T ss_dssp             HHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--TTCHHH-HHHHHHHHHTTTCHHH
T ss_pred             HHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC--Cccchh-hhHHHHHHHHCCCHHH
Confidence            55566666666665555532 2234455555555555666666665555554422  222211 4555555555566666


Q ss_pred             HHHHHHHHHhCCCCCCChHhHHHHHHHHhhccccc-hHHHHHHHHhCCCcc-cHHHHHHHHHHHHhcC
Q 014502          340 VEYSVGRMGKQGLSFKSAEDVEMVICSYFRCAAYD-RLDLFLDHIKGSYKL-RRATYDFLVAGYRRAG  405 (423)
Q Consensus       340 a~~~~~~m~~~~~~~~~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~p-~~~~~~~l~~~~~~~g  405 (423)
                      |++.|++..+  +.|+++.++..+...|.+.|+.+ +...+.+.++.  .| +...|..+..+|.+.|
T Consensus       324 A~~~~~~al~--~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         324 AVRLYRKALE--VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--SPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             HHHHHHHHTT--SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--CTTCHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcC
Confidence            6666655554  33445555555555555555553 34444444432  23 2445555555555544



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure