Citrus Sinensis ID: 014624

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MEWELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLVEKRDAKTQPVKQKKSWVEMCFFSRSNKRKRNGMDYVKA
ccccccccccccccccccccccccccccccccccHHHHHHHccccEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccEEEcccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccccccHHHHHHHHHHHccccccHHcccccccccc
cccccccccccccHHHHHHHHHHHHHHccccccccHHHHcccccEEEEcccccccccccHHHHHccHHHccEEEcccccccccccHHHHccccEEEcccccccccccccHHHHccccccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccccccHHHHHHHHHHHEEEccccccccccccccc
mewelleplfpprlrytiplsnpvpflvsFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCcvgqdgekLSLIKLASLIEVsskkgtrdlNLQNKLMDNIEWLPDSIGKLSSLVsldlsenrivavpatigglsslkkLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLeeldlgsnnlsslpdsIGSLISLKKLIvetndleelphtigqcsSLRELRVDYNRLKalpeavgkIHTLEVLSVRYNNikqlpttmssLSSLRELDVSFnelesvpeslCFATTLVKMNignnfadlralprsignlemleeldisnnqirvlPDSFRMLSRLRVLRvqenplevpprnivEMGAQAVVQYMADLVEkrdaktqpvkqkkSWVEMCFFsrsnkrkrngmdyvka
MEWELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEvsskkgtrdlnLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVpatigglsslKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDlgsnnlsslpdsIGSLISLKKLIVETndleelphtigqcsslrELRVDYNRLKALpeavgkihtleVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRvqenplevpprnivEMGAQAVVQYMADLVEKrdaktqpvkqkkswvemcffsrsnkrkrngmdyvka
MewelleplfppRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLVEKRDAKTQPVKQKKSWVEMCFFSRSNKRKRNGMDYVKA
***ELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLVE*************SWVEMCFF****************
*EWELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLV*************KSWVEMC******************
MEWELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLVEKR***********SWVEMCFFSRSNKRKRNGMDYVKA
*EWELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLVEKRDAKTQPVKQKKSWVEMCFFSRSN**K*N**D****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEWELLEPLFPPRLRYTIPLSNPVPFLVSFIPLFSSFCLLLTDFLILQLGSIIFRNKVPIMIMCMCCVGQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIVEMGAQAVVQYMADLVEKRDAKTQPVKQKKSWVEMCFFSRSNKRKRNGMDYVKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query421 2.2.26 [Sep-21-2011]
Q9Y4C4 1052 Malignant fibrous histioc yes no 0.662 0.265 0.377 1e-40
Q3V1N1 1048 Malignant fibrous histioc yes no 0.662 0.266 0.374 6e-38
A4IIK1 997 Malignant fibrous histioc yes no 0.624 0.263 0.368 8e-37
Q6GPJ5 605 Leucine-rich repeat-conta N/A no 0.679 0.472 0.348 1e-36
Q5M8G4 605 Leucine-rich repeat-conta no no 0.679 0.472 0.348 5e-36
Q8AVI4577 Leucine-rich repeat prote N/A no 0.619 0.452 0.340 2e-35
Q9V780 849 Protein lap1 OS=Drosophil yes no 0.617 0.306 0.377 3e-35
Q5F4C4529 Leucine-rich repeat prote yes no 0.619 0.493 0.337 9e-35
Q7SXW3 601 Leucine-rich repeat-conta no no 0.665 0.465 0.327 6e-34
Q5ZLN0 603 Leucine-rich repeat-conta no no 0.676 0.472 0.323 4e-33
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 162/286 (56%), Gaps = 7/286 (2%)

Query: 112 IGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRG 171
           +  L  L  L+LS N++ A+PA +G L+ L++LD+  NR+  LPDS+  L  L  LD+  
Sbjct: 131 VSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSLSCLSRLRTLDVDH 190

Query: 172 NQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCS 231
           NQ++A P  L +LV LEELD+ SN L  LP+ I +L +LK L +   +L  LP    + +
Sbjct: 191 NQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLPAGFCELA 250

Query: 232 SLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELES 291
           SL  L +D N L+ALP     +  L++L++  N  ++ P  +  L+ L EL +S N+L S
Sbjct: 251 SLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTS 310

Query: 292 VPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLR 351
           VP  +     L+ + + NN   +R LP SI  L  LEEL +  NQI VLPD F  LSR+ 
Sbjct: 311 VPSLISGLGRLLTLWLDNN--RIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVG 368

Query: 352 VLRVQENPLEVPPRNIVEMGAQAVVQYMADLVEKRDAKTQPVKQKK 397
           + ++++NPL  PP  +   G   +  Y  +L     A +QP  Q +
Sbjct: 369 LWKIKDNPLIQPPYEVCMKGIPYIAAYQKEL-----AHSQPAVQPR 409

Homo sapiens (taxid: 9606)
>sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 Back     alignment and function description
>sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 Back     alignment and function description
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query421
225438416 557 PREDICTED: leucine-rich repeat protein S 0.838 0.633 0.841 1e-171
224081457 531 predicted protein [Populus trichocarpa] 0.859 0.681 0.806 1e-169
356538413 567 PREDICTED: leucine-rich repeat protein S 0.845 0.627 0.802 1e-168
255583434 581 leucine-rich repeat-containing protein, 0.847 0.614 0.818 1e-168
224094248 537 predicted protein [Populus trichocarpa] 0.859 0.674 0.803 1e-167
356496527 574 PREDICTED: uncharacterized protein LOC10 0.845 0.620 0.807 1e-162
357484257 585 Leucine-rich repeat-containing protein [ 0.874 0.629 0.751 1e-161
356561015 548 PREDICTED: malignant fibrous histiocytom 0.850 0.653 0.756 1e-155
356531327 551 PREDICTED: malignant fibrous histiocytom 0.836 0.638 0.765 1e-149
297802402 550 predicted protein [Arabidopsis lyrata su 0.862 0.66 0.754 1e-149
>gi|225438416|ref|XP_002276062.1| PREDICTED: leucine-rich repeat protein SHOC-2 [Vitis vinifera] gi|296082577|emb|CBI21582.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  608 bits (1569), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 297/353 (84%), Positives = 329/353 (93%)

Query: 69  GQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRI 128
           GQD EKLSLIKLASLIEVSSKKGTRDLNLQNKLMD IEWLPDSIGKLSSL++LDLSENRI
Sbjct: 205 GQDSEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDQIEWLPDSIGKLSSLMTLDLSENRI 264

Query: 129 VAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLE 188
           VA+PATIGGLSSL KLDLH+NRI ELPD IG+LLS+V LDLRGNQ+++LP    RLVRLE
Sbjct: 265 VALPATIGGLSSLTKLDLHSNRIAELPDCIGNLLSVVVLDLRGNQLTSLPATFCRLVRLE 324

Query: 189 ELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPE 248
           ELDL SN LSSLP+SIGSL+ LKKL VETND+EE+PHTIGQCSSL+ELR DYNRLKALPE
Sbjct: 325 ELDLSSNRLSSLPESIGSLVKLKKLSVETNDIEEIPHTIGQCSSLKELRADYNRLKALPE 384

Query: 249 AVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIG 308
           AVG+I +LE+LSVRYNNIKQLPTTMSSLS+LRELDVSFNELES+PESLCFATTLVKMNIG
Sbjct: 385 AVGRIQSLEILSVRYNNIKQLPTTMSSLSNLRELDVSFNELESIPESLCFATTLVKMNIG 444

Query: 309 NNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIV 368
           +NFADL+ LPRSIGNLEMLEELDISNNQIRVLPDSF+ML+RLRVLR+ +NPLEVPPR++ 
Sbjct: 445 SNFADLQYLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTRLRVLRLDQNPLEVPPRHVA 504

Query: 369 EMGAQAVVQYMADLVEKRDAKTQPVKQKKSWVEMCFFSRSNKRKRNGMDYVKA 421
           EMGAQAVVQYMA+LV KR+ K+ PVKQKK+W + CFFSRSNKRKRNGMDYVKA
Sbjct: 505 EMGAQAVVQYMAELVAKREVKSLPVKQKKTWAQRCFFSRSNKRKRNGMDYVKA 557

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224081457|ref|XP_002306417.1| predicted protein [Populus trichocarpa] gi|222855866|gb|EEE93413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356538413|ref|XP_003537698.1| PREDICTED: leucine-rich repeat protein SHOC-2-like [Glycine max] Back     alignment and taxonomy information
>gi|255583434|ref|XP_002532476.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223527801|gb|EEF29900.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224094248|ref|XP_002310108.1| predicted protein [Populus trichocarpa] gi|222853011|gb|EEE90558.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356496527|ref|XP_003517118.1| PREDICTED: uncharacterized protein LOC100787496 [Glycine max] Back     alignment and taxonomy information
>gi|357484257|ref|XP_003612416.1| Leucine-rich repeat-containing protein [Medicago truncatula] gi|355513751|gb|AES95374.1| Leucine-rich repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356561015|ref|XP_003548781.1| PREDICTED: malignant fibrous histiocytoma-amplified sequence 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356531327|ref|XP_003534229.1| PREDICTED: malignant fibrous histiocytoma-amplified sequence 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297802402|ref|XP_002869085.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314921|gb|EFH45344.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query421
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.833 0.639 0.772 7e-141
TAIR|locus:2827587526 PIRL5 "AT2G17440" [Arabidopsis 0.809 0.648 0.722 3.3e-127
TAIR|locus:2074728499 PIRL9 "plant intracellular ras 0.610 0.515 0.421 1.1e-48
TAIR|locus:2088807471 PIRL2 "AT3G26500" [Arabidopsis 0.665 0.594 0.386 7.7e-48
TAIR|locus:2010326464 PIRL3 "AT1G12970" [Arabidopsis 0.641 0.581 0.421 3.3e-47
TAIR|locus:2166429506 PIRL1 "plant intracellular ras 0.567 0.472 0.437 1e-45
TAIR|locus:2120825383 PIRL8 "AT4G26050" [Arabidopsis 0.612 0.673 0.442 2.1e-45
MGI|MGI:1098644 1048 Mfhas1 "malignant fibrous hist 0.660 0.265 0.377 4.2e-41
RGD|1308812 1046 Mfhas1 "malignant fibrous hist 0.660 0.265 0.377 5.3e-41
ZFIN|ZDB-GENE-050208-523561 shoc2 "soc-2 suppressor of cle 0.619 0.465 0.340 4.8e-39
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1378 (490.1 bits), Expect = 7.0e-141, P = 7.0e-141
 Identities = 271/351 (77%), Positives = 314/351 (89%)

Query:    69 GQDGEKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRI 128
             G DGEKLSLIKLASLIEVS+KK T+++NLQNKL + +EWLPDS+GKLSSL SLDLSEN I
Sbjct:   199 GNDGEKLSLIKLASLIEVSAKKATQEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHI 258

Query:   129 VAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLE 188
             V +P TIGGLSSL KLDLH+NRI +LP+SIG+LL+LVYL+L  NQ+S+LP A SRLVRLE
Sbjct:   259 VVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLE 318

Query:   189 ELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPE 248
             ELDL  NNL  LP+SIGSL+SLKKL VETND+EE+P++IG CSSL ELR DYN+LKALPE
Sbjct:   319 ELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLIELRADYNKLKALPE 378

Query:   249 AVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIG 308
             A+GKI TLE+LSVRYNNI+QLPTTMSSL+SL+ELDVSFNELESVPESLCFATTLVK+NIG
Sbjct:   379 AIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTLVKLNIG 438

Query:   309 NNFADLRALPRSIGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPRNIV 368
             NNFAD+ +LPRSIGNLEMLEELDISNNQIRVLPDSF+ML++LRV R QENPL +PPR+I 
Sbjct:   439 NNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPRDIA 498

Query:   369 EMGAQAVVQYMADLVEKRDAKTQPVKQKKSWVEMCFFSRSNKRKRNGMDYV 419
             E G QAVVQYM DLVE R+AK+  VK KKSWV+MCFFS+SNKRK++ M+ V
Sbjct:   499 EKGPQAVVQYMNDLVETRNAKSLMVKPKKSWVQMCFFSKSNKRKQSSMEIV 549
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005886 "plasma membrane" evidence=IDA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074728 PIRL9 "plant intracellular ras group-related LRR 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166429 PIRL1 "plant intracellular ras group-related LRR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1098644 Mfhas1 "malignant fibrous histiocytoma amplified sequence 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308812 Mfhas1 "malignant fibrous histiocytoma amplified sequence 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-22
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-18
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-14
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-09
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 7e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 98.9 bits (246), Expect = 1e-22
 Identities = 77/264 (29%), Positives = 126/264 (47%), Gaps = 1/264 (0%)

Query: 73  EKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVP 132
             L+L     L+  SS      L+L +    +     +++  L  L SLDL+ NR+ +  
Sbjct: 50  LALNLSSNTLLLLPSSLSRLLSLDLLSPSGISSLDGSENLLNLLPLPSLDLNLNRLRSNI 109

Query: 133 ATIGGLSSLKKLDLHANRIIELPDSIGDLLS-LVYLDLRGNQISALPVALSRLVRLEELD 191
           + +  L++L  LDL  N I ++P  IG L S L  LDL  N+I +LP  L  L  L+ LD
Sbjct: 110 SELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLD 169

Query: 192 LGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVG 251
           L  N+LS LP  + +L +L  L +  N + +LP  I   S+L EL +  N +  L  ++ 
Sbjct: 170 LSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIELLSSLS 229

Query: 252 KIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNF 311
            +  L  L +  N ++ LP ++ +LS+L  LD+S N++ S+               GN+ 
Sbjct: 230 NLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISSLGSLTNLRELDLSGNSL 289

Query: 312 ADLRALPRSIGNLEMLEELDISNN 335
           ++   L   +  L  L    +   
Sbjct: 290 SNALPLIALLLLLLELLLNLLLTL 313

Length = 394
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 421
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.64
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.55
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.51
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.47
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.47
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.46
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.44
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.38
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.38
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.33
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.12
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.99
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.81
KOG4341483 consensus F-box protein containing LRR [General fu 98.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.57
KOG4341483 consensus F-box protein containing LRR [General fu 98.56
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.53
PLN03150623 hypothetical protein; Provisional 98.51
PLN03150623 hypothetical protein; Provisional 98.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.38
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.34
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.07
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.0
PRK15386426 type III secretion protein GogB; Provisional 97.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.64
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.39
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.23
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.97
KOG4308478 consensus LRR-containing protein [Function unknown 96.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.66
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.02
KOG4308478 consensus LRR-containing protein [Function unknown 95.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.84
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.29
smart0037026 LRR Leucine-rich repeats, outliers. 91.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.74
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.23
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.77
smart0037026 LRR Leucine-rich repeats, outliers. 89.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.39
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.78
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.46
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.28
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information 
Probab=99.96  E-value=1.6e-31  Score=249.62  Aligned_cols=280  Identities=28%  Similarity=0.451  Sum_probs=171.6

Q ss_pred             hccCCCCCcEEEcCCcccccccccchhhcCCCCCCEEEccCCcCCcCchhhcCCCCCcEEEccCCCCCCCch-hhhCCCC
Q 014624           85 EVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSSLVSLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPD-SIGDLLS  163 (421)
Q Consensus        85 ~~~~~~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~l~~~~~~l~~l~~L~~L~L~~~~i~~l~~-~~~~l~~  163 (421)
                      .++.++.||.+.+..|++... .+|..+..+..|+.||+++|++.+.|..+..-.++-.|+|++|+|..||. .+.++..
T Consensus        73 ELs~Lp~LRsv~~R~N~LKns-GiP~diF~l~dLt~lDLShNqL~EvP~~LE~AKn~iVLNLS~N~IetIPn~lfinLtD  151 (1255)
T KOG0444|consen   73 ELSDLPRLRSVIVRDNNLKNS-GIPTDIFRLKDLTILDLSHNQLREVPTNLEYAKNSIVLNLSYNNIETIPNSLFINLTD  151 (1255)
T ss_pred             hhccchhhHHHhhhccccccC-CCCchhcccccceeeecchhhhhhcchhhhhhcCcEEEEcccCccccCCchHHHhhHh
Confidence            455677788888887777654 35667778888888888888888888878888888888888888888875 3457777


Q ss_pred             CcEEECcCCCCCCCchhhcCCCCCCEEECCCCCCCCC-ccccCCCccccccccccccCC--CCcchhcCCcCccEEEccc
Q 014624          164 LVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSL-PDSIGSLISLKKLIVETNDLE--ELPHTIGQCSSLRELRVDY  240 (421)
Q Consensus       164 L~~L~l~~~~l~~l~~~~~~~~~L~~L~l~~~~l~~~-~~~~~~l~~L~~L~l~~n~~~--~~~~~~~~~~~L~~L~l~~  240 (421)
                      |-+||+++|.+..+|..+..+..|+.|.+++|.+..+ -..+.++++|+.|.+++.+-+  .+|..+..+.+|..++++.
T Consensus       152 LLfLDLS~NrLe~LPPQ~RRL~~LqtL~Ls~NPL~hfQLrQLPsmtsL~vLhms~TqRTl~N~Ptsld~l~NL~dvDlS~  231 (1255)
T KOG0444|consen  152 LLFLDLSNNRLEMLPPQIRRLSMLQTLKLSNNPLNHFQLRQLPSMTSLSVLHMSNTQRTLDNIPTSLDDLHNLRDVDLSE  231 (1255)
T ss_pred             HhhhccccchhhhcCHHHHHHhhhhhhhcCCChhhHHHHhcCccchhhhhhhcccccchhhcCCCchhhhhhhhhccccc
Confidence            8888888888888887777777888888887765422 122334445555555544322  4455555555555555555


Q ss_pred             CCCCCchhhhhccCCCCeeecccccCCcCCcccCCCCCCcEEECcCCCCCCCchhhhccCcccEEEccCCccCCCccchh
Q 014624          241 NRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRS  320 (421)
Q Consensus       241 ~~l~~~~~~l~~~~~L~~L~l~~n~l~~l~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~  320 (421)
                      |.+..+|+.+..+++|+.|++++|+++.+........+|++|++|+|+++.+|+.++.+++|+.|.+.+|....+.+|.+
T Consensus       232 N~Lp~vPecly~l~~LrrLNLS~N~iteL~~~~~~W~~lEtLNlSrNQLt~LP~avcKL~kL~kLy~n~NkL~FeGiPSG  311 (1255)
T KOG0444|consen  232 NNLPIVPECLYKLRNLRRLNLSGNKITELNMTEGEWENLETLNLSRNQLTVLPDAVCKLTKLTKLYANNNKLTFEGIPSG  311 (1255)
T ss_pred             cCCCcchHHHhhhhhhheeccCcCceeeeeccHHHHhhhhhhccccchhccchHHHhhhHHHHHHHhccCcccccCCccc
Confidence            55555555555555555555555555554444444455555555555555555555555555555555555555555555


Q ss_pred             hcCCCCCcEEeCccCCCCccchhhcCCCCCCEEEccCCCCCCCcH
Q 014624          321 IGNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPPR  365 (421)
Q Consensus       321 ~~~l~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~l~~n~~~~~~~  365 (421)
                      ++++.+|+.+..++|.+.-+|++++.|+.|+.|.|+.|++-..|+
T Consensus       312 IGKL~~Levf~aanN~LElVPEglcRC~kL~kL~L~~NrLiTLPe  356 (1255)
T KOG0444|consen  312 IGKLIQLEVFHAANNKLELVPEGLCRCVKLQKLKLDHNRLITLPE  356 (1255)
T ss_pred             hhhhhhhHHHHhhccccccCchhhhhhHHHHHhcccccceeechh
Confidence            555545544444444444444444444444444444444444443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-17
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 7e-13
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 4e-11
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-11
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-10
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-10
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-10
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-10
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-09
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-09
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 7e-08
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 7e-09
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 8e-09
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 8e-09
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 4e-05
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 4e-05
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-08
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-07
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 6e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 3e-08
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 6e-08
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 2e-07
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 2e-06
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-07
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 9e-07
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-06
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 6e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 7e-06
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 7e-06
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 4e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 8e-06
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 9e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 7e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 1e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 1e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 2e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 2e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 1e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 3e-05
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 2e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-05
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 2e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-05
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 2e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 9e-05
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 3e-05
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 4e-05
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 7e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 7e-05
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-05
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 2e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-04
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 3e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-04
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 9e-04
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 9e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 129/272 (47%), Gaps = 62/272 (22%)
Query: 120 SLDLSENRIVAVPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPV 179
           S+D S  ++ A+P+ I   +  KKLDL +N++  LP                        
Sbjct: 20  SVDCSSKKLTAIPSNIP--ADTKKLDLQSNKLSSLPSK---------------------- 55
Query: 180 ALSRLVRLEELDLGSNNLSSLPDSI-GSLISLKKLIVETNDLEELP-HTIGQCSSLRELR 237
           A  RL +L  L L  N L +LP  I   L +L+ L V  N L+ LP     Q  +L ELR
Sbjct: 56  AFHRLTKLRLLYLNDNKLQTLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELR 115
Query: 238 VDYNRLKALPEAVGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVSFNELESVPESLC 297
           +D N+LK+LP                      P    SL+ L  L + +NEL+S+P+ + 
Sbjct: 116 LDRNQLKSLP----------------------PRVFDSLTKLTYLSLGYNELQSLPKGVF 153
Query: 298 FA-TTLVKMNIGNNFADLRALPR-SIGNLEMLEELDISNNQIRVLPD-SFRMLSRLRVLR 354
              T+L ++ + NN   L+ +P  +   L  L+ L + NNQ++ +P+ +F  L +L++L+
Sbjct: 154 DKLTSLKELRLYNN--QLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQ 211
Query: 355 VQENPLEVPPRNIVEMGAQAVVQYMADLVEKR 386
           +QENP +     I+         YMA  ++K+
Sbjct: 212 LQENPWDCTCNGII---------YMAKWLKKK 234
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-67
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-61
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-51
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-41
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-59
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-59
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-53
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-52
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-51
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-46
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-50
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-48
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-48
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-50
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-47
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-45
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-47
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-45
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-46
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-42
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-38
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-37
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-46
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-44
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-45
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-43
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-42
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-41
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-44
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-43
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-43
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-40
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-42
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-36
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-30
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-38
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-32
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-36
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-36
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-36
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-34
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-33
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-30
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-32
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-31
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-19
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-31
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-27
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-24
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-19
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-24
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-20
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-24
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-22
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-20
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-21
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-20
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-11
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-18
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-16
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 4e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  214 bits (548), Expect = 8e-67
 Identities = 59/299 (19%), Positives = 122/299 (40%), Gaps = 20/299 (6%)

Query: 73  EKLSLIKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPDSIGKLSS--LVSLDLSENRIVA 130
           ++              +  + +  ++ +    ++   D +   +    V+L+L    +  
Sbjct: 36  QRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQ 95

Query: 131 VPATIGGLSSLKKLDLHANRIIELPDSIGDLLSLVYLDLRGNQISALPVALSRLVRLEEL 190
            P     LS L+ + + A  ++ELPD++     L  L L  N + ALP +++ L RL EL
Sbjct: 96  FPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLREL 155

Query: 191 DL-GSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEA 249
            +     L+ LP+ + S               +         +L+ LR+++  +++LP +
Sbjct: 156 SIRACPELTELPEPLAST--------------DASGEHQGLVNLQSLRLEWTGIRSLPAS 201

Query: 250 VGKIHTLEVLSVRYNNIKQLPTTMSSLSSLRELDVS-FNELESVPESLCFATTLVKMNIG 308
           +  +  L+ L +R + +  L   +  L  L ELD+     L + P        L ++ + 
Sbjct: 202 IANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLIL- 260

Query: 309 NNFADLRALPRSIGNLEMLEELDISNN-QIRVLPDSFRMLSRLRVLRVQENPLEVPPRN 366
            + ++L  LP  I  L  LE+LD+     +  LP     L    ++ V  +      ++
Sbjct: 261 KDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQLDQH 319
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query421
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.07
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.04
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.97
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.0
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.89
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.6
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.48
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.34
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=100.00  E-value=2.6e-33  Score=283.71  Aligned_cols=319  Identities=20%  Similarity=0.302  Sum_probs=245.6

Q ss_pred             hhhHHHHHHhcccccccCccceeeecccCCC---CCcc-chH----HhhhhhhhccCCCCCcEEEcCCcccccccccch-
Q 014624           40 LLTDFLILQLGSIIFRNKVPIMIMCMCCVGQ---DGEK-LSL----IKLASLIEVSSKKGTRDLNLQNKLMDNIEWLPD-  110 (421)
Q Consensus        40 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~---~~~~-~~~----~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~l~~-  110 (421)
                      ++++|+.|++++|.+.+.+|..+..+..+..   ..-. +.-    ..+..+.....+++|++|++++|.+.   .+|. 
T Consensus       247 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~---~ip~~  323 (636)
T 4eco_A          247 NLKDLTDVEVYNCPNLTKLPTFLKALPEMQLINVACNRGISGEQLKDDWQALADAPVGEKIQIIYIGYNNLK---TFPVE  323 (636)
T ss_dssp             GCTTCCEEEEECCTTCSSCCTTTTTCSSCCEEECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCS---SCCCH
T ss_pred             ccCCCCEEEecCCcCCccChHHHhcCCCCCEEECcCCCCCccccchHHHHhhhccccCCCCCEEECCCCcCC---ccCch
Confidence            7788888888888888888866554443322   1111 111    11112222234478888888888766   3466 


Q ss_pred             -hhcCCCCCCEEEccCCcCC-cCchhhcCCCCCcEEEccCCCCCCCchhhhCCCC-CcEEECcCCCCCCCchhhcCCC--
Q 014624          111 -SIGKLSSLVSLDLSENRIV-AVPATIGGLSSLKKLDLHANRIIELPDSIGDLLS-LVYLDLRGNQISALPVALSRLV--  185 (421)
Q Consensus       111 -~~~~~~~L~~L~l~~~~l~-~~~~~l~~l~~L~~L~L~~~~i~~l~~~~~~l~~-L~~L~l~~~~l~~l~~~~~~~~--  185 (421)
                       .+..+++|++|++++|.+. .+| .+..+++|++|++++|.++.+|..+..+++ |++|++++|.++.+|..+....  
T Consensus       324 ~~l~~l~~L~~L~L~~N~l~g~ip-~~~~l~~L~~L~L~~N~l~~lp~~l~~l~~~L~~L~Ls~N~l~~lp~~~~~~~l~  402 (636)
T 4eco_A          324 TSLQKMKKLGMLECLYNQLEGKLP-AFGSEIKLASLNLAYNQITEIPANFCGFTEQVENLSFAHNKLKYIPNIFDAKSVS  402 (636)
T ss_dssp             HHHTTCTTCCEEECCSCCCEEECC-CCEEEEEESEEECCSSEEEECCTTSEEECTTCCEEECCSSCCSSCCSCCCTTCSS
T ss_pred             hhhccCCCCCEEeCcCCcCccchh-hhCCCCCCCEEECCCCccccccHhhhhhcccCcEEEccCCcCcccchhhhhcccC
Confidence             7888888888888888888 777 788888888888888888888888888888 9999999988888887665544  


Q ss_pred             CCCEEECCCCCCCC-CccccC-------CCccccccccccccCCCCcchh-cCCcCccEEEcccCCCCCchhhhhc----
Q 014624          186 RLEELDLGSNNLSS-LPDSIG-------SLISLKKLIVETNDLEELPHTI-GQCSSLRELRVDYNRLKALPEAVGK----  252 (421)
Q Consensus       186 ~L~~L~l~~~~l~~-~~~~~~-------~l~~L~~L~l~~n~~~~~~~~~-~~~~~L~~L~l~~~~l~~~~~~l~~----  252 (421)
                      +|+.|++++|.+.. .|..+.       .+++|+.|++++|.++.++..+ ..+++|+.|++++|+++.+|.....    
T Consensus       403 ~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L~~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~~~~~~~~  482 (636)
T 4eco_A          403 VMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINVSSINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKNSLKDENE  482 (636)
T ss_dssp             CEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCEEEEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSSSSEETTE
T ss_pred             ccCEEECcCCcCCCcchhhhcccccccccCCCCCEEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHHHhccccc
Confidence            78899999888874 455555       6778999999999988887654 4588999999999999877754332    


Q ss_pred             ----cCCCCeeecccccCCcCCcccC--CCCCCcEEECcCCCCCCCchhhhccCcccEEEccCCc-----cCCCccchhh
Q 014624          253 ----IHTLEVLSVRYNNIKQLPTTMS--SLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNF-----ADLRALPRSI  321 (421)
Q Consensus       253 ----~~~L~~L~l~~n~l~~l~~~l~--~~~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~l~~~~-----~~~~~~~~~~  321 (421)
                          +++|+.|++++|.++.+|..+.  .+++|++|++++|+++.+|..+..+++|+.|++++|.     .....+|..+
T Consensus       483 ~~~~l~~L~~L~Ls~N~l~~lp~~~~~~~l~~L~~L~Ls~N~l~~ip~~~~~l~~L~~L~Ls~N~~ls~N~l~~~~p~~l  562 (636)
T 4eco_A          483 NFKNTYLLTSIDLRFNKLTKLSDDFRATTLPYLVGIDLSYNSFSKFPTQPLNSSTLKGFGIRNQRDAQGNRTLREWPEGI  562 (636)
T ss_dssp             ECTTGGGCCEEECCSSCCCBCCGGGSTTTCTTCCEEECCSSCCSSCCCGGGGCSSCCEEECCSCBCTTCCBCCCCCCTTG
T ss_pred             cccccCCccEEECcCCcCCccChhhhhccCCCcCEEECCCCCCCCcChhhhcCCCCCEEECCCCcccccCcccccChHHH
Confidence                2289999999999999988776  8999999999999999998889999999999996542     1346778888


Q ss_pred             cCCCCCcEEeCccCCCCccchhhcCCCCCCEEEccCCCCCCCc
Q 014624          322 GNLEMLEELDISNNQIRVLPDSFRMLSRLRVLRVQENPLEVPP  364 (421)
Q Consensus       322 ~~l~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~l~~n~~~~~~  364 (421)
                      ..+++|+.|+|++|.++.+|..+.  ++|+.|++++|++.+..
T Consensus       563 ~~l~~L~~L~Ls~N~l~~ip~~~~--~~L~~L~Ls~N~l~~~~  603 (636)
T 4eco_A          563 TLCPSLTQLQIGSNDIRKVNEKIT--PNISVLDIKDNPNISID  603 (636)
T ss_dssp             GGCSSCCEEECCSSCCCBCCSCCC--TTCCEEECCSCTTCEEE
T ss_pred             hcCCCCCEEECCCCcCCccCHhHh--CcCCEEECcCCCCcccc
Confidence            899999999999999999988655  79999999999987654
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 421
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-13
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-09
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-08
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 90.1 bits (222), Expect = 8e-21
 Identities = 51/272 (18%), Positives = 109/272 (40%), Gaps = 21/272 (7%)

Query: 104 NIEWLPDSIGKLSSLVSLDLSENRIVAVPA-TIGGLSSLKKLDLHANRIIEL-PDSIGDL 161
            +E +P  +        LDL  N+I  +       L +L  L L  N+I ++ P +   L
Sbjct: 21  GLEKVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPL 78

Query: 162 LSLVYLDLRGNQISALPVALSRLVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETN--- 218
           + L  L L  NQ+  LP  + +   L+EL +  N ++ +  S+ + ++   ++       
Sbjct: 79  VKLERLYLSKNQLKELPEKMPK--TLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPL 136

Query: 219 -DLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRYNNI-KQLPTTMSSL 276
                          L  +R+    +  +P+ +    +L  L +  N I K    ++  L
Sbjct: 137 KSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPP--SLTELHLDGNKITKVDAASLKGL 194

Query: 277 SSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQ 336
           ++L +L +SFN + +V       T  +   +  N   L  +P  + + + ++ + + NN 
Sbjct: 195 NNLAKLGLSFNSISAVDNGSLANTPHL-RELHLNNNKLVKVPGGLADHKYIQVVYLHNNN 253

Query: 337 IRVLPDS-------FRMLSRLRVLRVQENPLE 361
           I  +  +           +    + +  NP++
Sbjct: 254 ISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQ 285
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query421
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.59
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.73
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.94  E-value=1e-24  Score=205.18  Aligned_cols=171  Identities=22%  Similarity=0.385  Sum_probs=83.6

Q ss_pred             CCCCCEEECCCCCCCCCccccCCCccccccccccccCCCCcchhcCCcCccEEEcccCCCCCchhhhhccCCCCeeeccc
Q 014624          184 LVRLEELDLGSNNLSSLPDSIGSLISLKKLIVETNDLEELPHTIGQCSSLRELRVDYNRLKALPEAVGKIHTLEVLSVRY  263 (421)
Q Consensus       184 ~~~L~~L~l~~~~l~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~l~~~~~L~~L~l~~  263 (421)
                      +++++.+++++|.+..++. ....++|++|++++|.++.++ .+..+++|+.+++++|.++.++. +..+++|++|++++
T Consensus       196 l~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~-~~~~~~L~~L~l~~  272 (384)
T d2omza2         196 LTNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGA  272 (384)
T ss_dssp             CTTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCS
T ss_pred             ccccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCc-ccccccCCEeeccC
Confidence            3445555555555554432 334455556666665555542 34455556666666655555432 44555566666655


Q ss_pred             ccCCcCCcccCCCCCCcEEECcCCCCCCCchhhhccCcccEEEccCCccCCCccchhhcCCCCCcEEeCccCCCCccchh
Q 014624          264 NNIKQLPTTMSSLSSLRELDVSFNELESVPESLCFATTLVKMNIGNNFADLRALPRSIGNLEMLEELDISNNQIRVLPDS  343 (421)
Q Consensus       264 n~l~~l~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~l~~~  343 (421)
                      +.++.++ .+..++.++.+++++|.++.++ .+..+++++.|++++|  .+..++ .+..+++|++|++++|+|+.++ .
T Consensus       273 ~~l~~~~-~~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n--~l~~l~-~l~~l~~L~~L~L~~n~l~~l~-~  346 (384)
T d2omza2         273 NQISNIS-PLAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFN--NISDIS-PVSSLTKLQRLFFANNKVSDVS-S  346 (384)
T ss_dssp             SCCCCCG-GGTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSS--CCSCCG-GGGGCTTCCEEECCSSCCCCCG-G
T ss_pred             cccCCCC-cccccccccccccccccccccc-ccchhcccCeEECCCC--CCCCCc-ccccCCCCCEEECCCCCCCCCh-h
Confidence            5555443 2344444555555554444432 2344444555555444  222332 1344445555555555544443 2


Q ss_pred             hcCCCCCCEEEccCCCCCCC
Q 014624          344 FRMLSRLRVLRVQENPLEVP  363 (421)
Q Consensus       344 ~~~l~~L~~L~l~~n~~~~~  363 (421)
                      +..+++|++|++++|+++..
T Consensus       347 l~~l~~L~~L~l~~N~l~~l  366 (384)
T d2omza2         347 LANLTNINWLSAGHNQISDL  366 (384)
T ss_dssp             GGGCTTCCEEECCSSCCCBC
T ss_pred             HcCCCCCCEEECCCCcCCCC
Confidence            44445555555555544433
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure