Citrus Sinensis ID: 014774

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQMKSSHSSSDDFFDEICRFRCMNRKIVRIE
cccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccEEccccccccccccccHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEEEEEcHHHHHHHHHccccccEEEEEcccccEEEEEEcccccEEEEEEEEEccEEEEEEcccEEEEEEEcEEEEEEccccccEEEEEEccccEEEEEcccccccccEEEEccEEEEHHHHHHHHHccccccEEcEEEEEccccccccccccccHHHHHHHcccccEEEEEcHHHHHHHHcccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHEEEEccccccccccccccccHHHHHHHHcHHHEEEcccccccccccccccccEEEEEEEEEEcHHHHHHHHHHcccHHHHHHHccccccEEEEEcccccHEEEEEccccccEEEEEcccEEEEEEEccEEEEEEcccEEEEEEEEccccEEEEEEccccHHHHHEcccccEEcHHHHHHHHHHHHHccEEEEEEEEEcccccccccccccHHHHHcccccccEEEEHHHHHHHHHHHHcccccccccEcccccEEEEEEcccccHHHHHHHHHHHHHHcHHHHHEEEEEHHHccccHHHHHHHHHHHHHHHHcccEEEEc
MDSLPDAIVQYILSHMKNARDVALCNCVSKrwkesipylkslyfprnsfdnqscdnspddiVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYqgclenpskldcISRAKNLESLKLWGVLMvsspkwdvfhKLQNLEIvgarledpalstalracpnltnllLLGCEGvrsvsielphleqckldfyglgncslsvscpkiqflevqgcSWIRVQETNCLrnlsisnnagrvyMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEftgdfdtlqpfpevdfveffnnhpklqkfdIHGAMFAALCQKnslknvesgfvipCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQMksshsssddfFDEICRfrcmnrkivrie
MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQmksshsssddffdeiCRFRCMNRKIVRIE
MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQMKsshsssddffdEICRFRCMNRKIVRIE
******AIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQM********DFFDEICRFRCMNRKIV***
MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNS**NVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQ*********DFFDEICRFRCMNRK*****
MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQMKSSHSSSDDFFDEICRFRCMNRKIVRIE
*DSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQMKSSHSSSDDFFDEICRFRCMNRKIVRIE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRILQMKSSHSSSDDFFDEICRFRCMNRKIVRIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query419 2.2.26 [Sep-21-2011]
Q9SAC4418 F-box protein At1g10780 O yes no 0.997 1.0 0.680 1e-166
Q9ZW88419 F-box/LRR-repeat protein no no 0.515 0.515 0.261 2e-07
Q9LJF8306 F-box/LRR-repeat protein no no 0.520 0.712 0.241 0.0008
>sp|Q9SAC4|FB2_ARATH F-box protein At1g10780 OS=Arabidopsis thaliana GN=At1g10780 PE=2 SV=1 Back     alignment and function desciption
 Score =  586 bits (1511), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 285/419 (68%), Positives = 345/419 (82%), Gaps = 1/419 (0%)

Query: 1   MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDD 60
           MDSLPDAI+QYILS++ +ARDVA CNCVSKRWKES   +KS+ F RNSF++    +  D 
Sbjct: 1   MDSLPDAILQYILSYLTSARDVAACNCVSKRWKESTDSVKSVVFHRNSFESIMETDDSDS 60

Query: 61  IVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKL 120
           IV KMI S   LEELVVY+PF+ +GL SW+M   S+L+ LELRMDNLA  +  +E P KL
Sbjct: 61  IVRKMISSSRRLEELVVYSPFTSSGLASWMMHVSSSLRLLELRMDNLASEEVVVEGPLKL 120

Query: 121 DCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLL 180
           DCI  AKNLE LKLWGVLM+S PKWD+F  L++LEIVGA+++D +LS ALRACPNL+NLL
Sbjct: 121 DCIGVAKNLEILKLWGVLMMSPPKWDMFPNLRSLEIVGAKMDDSSLSHALRACPNLSNLL 180

Query: 181 LLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRN 240
           LL CEGV+S+SI+LP+LE CKLDFYG GN  L ++  ++  L+VQGCSWIRV ET  L+N
Sbjct: 181 LLACEGVKSISIDLPYLEHCKLDFYGQGNTLLVLTSQRLVSLDVQGCSWIRVPETKFLKN 240

Query: 241 LSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFD 300
           LSIS+  GRVYMVDF  L++LE+L++RGVQWCWDAI  +L  A +VKHL+MKVEFTG+ +
Sbjct: 241 LSISSVTGRVYMVDFNNLSSLEALSIRGVQWCWDAICMILQQARDVKHLFMKVEFTGN-E 299

Query: 301 TLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRS 360
            LQPFPE+DFVEFFNNHPKLQ FDIHGAMFAALCQKNSLK +E+GF IPCLEEVV+TVRS
Sbjct: 300 ALQPFPEIDFVEFFNNHPKLQTFDIHGAMFAALCQKNSLKKLETGFTIPCLEEVVITVRS 359

Query: 361 PLNAEQKMSTLESLLKYGKNLKTMVIRILQMKSSHSSSDDFFDEICRFRCMNRKIVRIE 419
           PLNAEQKM+TLESL+KY + LK MVIRIL+MKS+HSS+DDF D+IC+FR MN  +V IE
Sbjct: 360 PLNAEQKMNTLESLVKYARGLKRMVIRILRMKSNHSSADDFCDDICKFRHMNEHLVHIE 418

Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZW88|FBL34_ARATH F-box/LRR-repeat protein At1g67190 OS=Arabidopsis thaliana GN=At1g67190 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJF8|FBL47_ARATH F-box/LRR-repeat protein At3g26922 OS=Arabidopsis thaliana GN=At3g26922 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
255581229419 conserved hypothetical protein [Ricinus 1.0 1.0 0.835 0.0
224073302419 predicted protein [Populus trichocarpa] 1.0 1.0 0.809 0.0
225448028422 PREDICTED: F-box protein At1g10780 [Viti 1.0 0.992 0.803 0.0
224058969419 predicted protein [Populus trichocarpa] 1.0 1.0 0.806 0.0
356558498419 PREDICTED: F-box protein At1g10780-like 1.0 1.0 0.763 0.0
255638547419 unknown [Glycine max] 1.0 1.0 0.756 0.0
147856604405 hypothetical protein VITISV_039785 [Viti 0.937 0.970 0.803 0.0
356525950419 PREDICTED: F-box protein At1g10780-like 1.0 1.0 0.744 0.0
449444677419 PREDICTED: F-box protein At1g10780-like 1.0 1.0 0.749 0.0
449489678419 PREDICTED: LOW QUALITY PROTEIN: F-box pr 1.0 1.0 0.744 0.0
>gi|255581229|ref|XP_002531427.1| conserved hypothetical protein [Ricinus communis] gi|223528977|gb|EEF30969.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/419 (83%), Positives = 389/419 (92%)

Query: 1   MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDD 60
           M+SLPDAIVQYILSHMKNA+DVA+CNCVSKRWK+S+PY+KSLYFPRNSFDN +  + PD 
Sbjct: 1   MESLPDAIVQYILSHMKNAKDVAVCNCVSKRWKDSLPYIKSLYFPRNSFDNHTGIDHPDS 60

Query: 61  IVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKL 120
           IV KMI SIV LEELVVY+PFS  GL SWL+LAGS+L+HLELRMDNLA+YQ C+E+PSKL
Sbjct: 61  IVWKMIASIVRLEELVVYSPFSSTGLASWLLLAGSSLRHLELRMDNLAEYQTCIESPSKL 120

Query: 121 DCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLL 180
           +CIS AKNLESLKLWGVLM++SPKWD F KLQNLE+VGARLEDPAL  AL+ACPNL NLL
Sbjct: 121 ECISAAKNLESLKLWGVLMINSPKWDNFSKLQNLEVVGARLEDPALCAALQACPNLKNLL 180

Query: 181 LLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRN 240
           LLGCEGVRS+SIEL HLEQCKLDFYGLGNCSL+++CPK++ LEVQGCSWIRV+ETNCLR 
Sbjct: 181 LLGCEGVRSISIELLHLEQCKLDFYGLGNCSLTLTCPKMECLEVQGCSWIRVRETNCLRK 240

Query: 241 LSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDFD 300
           LSISNNAGRVYMVDFG+LAALE L++RGVQWCWDAISKML WASEVK LYMKVEFTGDFD
Sbjct: 241 LSISNNAGRVYMVDFGRLAALEFLSIRGVQWCWDAISKMLQWASEVKQLYMKVEFTGDFD 300

Query: 301 TLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVRS 360
            L PFPEVDFVEFFN+H KLQKFD+HGAMFAALCQKNSLKNVESGFVIPCLEEVV+TVRS
Sbjct: 301 ALLPFPEVDFVEFFNSHQKLQKFDVHGAMFAALCQKNSLKNVESGFVIPCLEEVVITVRS 360

Query: 361 PLNAEQKMSTLESLLKYGKNLKTMVIRILQMKSSHSSSDDFFDEICRFRCMNRKIVRIE 419
           PLNAEQKMSTLESLLK GKN+ +MVIRILQMKS+HSS+DDFFD+ICRF+ MNRKIVRIE
Sbjct: 361 PLNAEQKMSTLESLLKSGKNITSMVIRILQMKSNHSSADDFFDDICRFQRMNRKIVRIE 419

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224073302|ref|XP_002304069.1| predicted protein [Populus trichocarpa] gi|222841501|gb|EEE79048.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448028|ref|XP_002273123.1| PREDICTED: F-box protein At1g10780 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224058969|ref|XP_002299669.1| predicted protein [Populus trichocarpa] gi|222846927|gb|EEE84474.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356558498|ref|XP_003547543.1| PREDICTED: F-box protein At1g10780-like [Glycine max] Back     alignment and taxonomy information
>gi|255638547|gb|ACU19581.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147856604|emb|CAN82469.1| hypothetical protein VITISV_039785 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356525950|ref|XP_003531584.1| PREDICTED: F-box protein At1g10780-like [Glycine max] Back     alignment and taxonomy information
>gi|449444677|ref|XP_004140100.1| PREDICTED: F-box protein At1g10780-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489678|ref|XP_004158383.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At1g10780-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
TAIR|locus:2019978418 AT1G10780 "AT1G10780" [Arabido 0.995 0.997 0.664 8.1e-147
TAIR|locus:2033696419 AT1G67190 "AT1G67190" [Arabido 0.844 0.844 0.237 3.4e-08
TAIR|locus:5019474764306 AT3G26922 "AT3G26922" [Arabido 0.515 0.705 0.256 3.9e-06
TAIR|locus:2099644481 AT3G03360 [Arabidopsis thalian 0.448 0.390 0.273 0.00033
TAIR|locus:2140538316 AT4G09920 "AT4G09920" [Arabido 0.479 0.636 0.253 0.00035
TAIR|locus:2083268456 AT3G52680 "AT3G52680" [Arabido 0.639 0.587 0.245 0.00065
TAIR|locus:2161053422 AT5G56420 "AT5G56420" [Arabido 0.448 0.445 0.244 0.00097
TAIR|locus:2019978 AT1G10780 "AT1G10780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1434 (509.9 bits), Expect = 8.1e-147, P = 8.1e-147
 Identities = 279/420 (66%), Positives = 337/420 (80%)

Query:     1 MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDN-QSCDNSPD 59
             MDSLPDAI+QYILS++ +ARDVA CNCVSKRWKES   +KS+ F RNSF++    D+S D
Sbjct:     1 MDSLPDAILQYILSYLTSARDVAACNCVSKRWKESTDSVKSVVFHRNSFESIMETDDS-D 59

Query:    60 DIVLKMIYSIVCLEELVVYTPFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSK 119
              IV KMI S   LEELVVY+PF+ +GL SW+M   S+L+ LELRMDNLA  +  +E P K
Sbjct:    60 SIVRKMISSSRRLEELVVYSPFTSSGLASWMMHVSSSLRLLELRMDNLASEEVVVEGPLK 119

Query:   120 LDCISRAKNLESLKLWGVLMVSSPKWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNL 179
             LDCI  AKNLE LKLWGVLM+S PKWD+F  L++LEIVGA+++D +LS ALRACPNL+NL
Sbjct:   120 LDCIGVAKNLEILKLWGVLMMSPPKWDMFPNLRSLEIVGAKMDDSSLSHALRACPNLSNL 179

Query:   180 LLLGCEGVRSVSIELPHLEQCKLDFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLR 239
             LLL CEGV+S+SI+LP+LE CKLDFYG GN  L ++  ++  L+VQGCSWIRV ET  L+
Sbjct:   180 LLLACEGVKSISIDLPYLEHCKLDFYGQGNTLLVLTSQRLVSLDVQGCSWIRVPETKFLK 239

Query:   240 NLSISNNAGRVYMVDFGKLAALESLTLRGVQWCWDAISKMLYWASEVKHLYMKVEFTGDF 299
             NLSIS+  GRVYMVDF  L++LE+L++RGVQWCWDAI  +L  A +VKHL+MKVEFTG+ 
Sbjct:   240 NLSISSVTGRVYMVDFNNLSSLEALSIRGVQWCWDAICMILQQARDVKHLFMKVEFTGN- 298

Query:   300 DTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVTVR 359
             + LQPFPE+DFVEFFNNHPKLQ FDIHGAMFAALCQKNSLK +E+GF IPCLEEVV+TVR
Sbjct:   299 EALQPFPEIDFVEFFNNHPKLQTFDIHGAMFAALCQKNSLKKLETGFTIPCLEEVVITVR 358

Query:   360 SPLNAEQKMSTLESLLKYGKNLKTMVIRILQMKXXXXXXXXXXXEICRFRCMNRKIVRIE 419
             SPLNAEQKM+TLESL+KY + LK MVIRIL+MK           +IC+FR MN  +V IE
Sbjct:   359 SPLNAEQKMNTLESLVKYARGLKRMVIRILRMKSNHSSADDFCDDICKFRHMNEHLVHIE 418
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009506 "plasmodesma" evidence=IDA
GO:0006270 "DNA replication initiation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=RCA
GO:0016572 "histone phosphorylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
TAIR|locus:2033696 AT1G67190 "AT1G67190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:5019474764 AT3G26922 "AT3G26922" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140538 AT4G09920 "AT4G09920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083268 AT3G52680 "AT3G52680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161053 AT5G56420 "AT5G56420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SAC4FB2_ARATHNo assigned EC number0.68010.99761.0yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 419
KOG4341483 consensus F-box protein containing LRR [General fu 99.84
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.76
KOG4341483 consensus F-box protein containing LRR [General fu 99.25
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.69
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.59
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.56
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.43
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.36
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.33
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.12
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.8
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.67
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.51
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.41
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.35
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.83
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.45
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.26
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.02
KOG0617264 consensus Ras suppressor protein (contains leucine 95.87
KOG4237 498 consensus Extracellular matrix protein slit, conta 95.64
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.55
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.52
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.39
KOG2997366 consensus F-box protein FBX9 [General function pre 95.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.36
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.31
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.29
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 95.17
KOG0472 565 consensus Leucine-rich repeat protein [Function un 95.06
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.01
KOG0281499 consensus Beta-TrCP (transducin repeats containing 94.76
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 94.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 94.29
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.88
KOG0617264 consensus Ras suppressor protein (contains leucine 93.2
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 93.17
KOG0472565 consensus Leucine-rich repeat protein [Function un 93.13
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 92.72
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.66
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.27
PRK15386426 type III secretion protein GogB; Provisional 91.07
KOG2123 388 consensus Uncharacterized conserved protein [Funct 89.0
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.01
PF13013109 F-box-like_2: F-box-like domain 87.37
PLN03150623 hypothetical protein; Provisional 86.96
PRK15386426 type III secretion protein GogB; Provisional 86.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 85.06
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 84.74
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 84.22
PLN03150623 hypothetical protein; Provisional 83.09
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 81.8
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 81.21
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.84  E-value=3.3e-22  Score=178.83  Aligned_cols=331  Identities=17%  Similarity=0.221  Sum_probs=181.8

Q ss_pred             CCcHHHHHHHHhCCCCHHHHHHhhccchhHHHhh---ccCCeeeecCCCCCCCCCCCChHHHHHHHHHhCCCcceEEEec
Q 014774            3 SLPDAIVQYILSHMKNARDVALCNCVSKRWKESI---PYLKSLYFPRNSFDNQSCDNSPDDIVLKMIYSIVCLEELVVYT   79 (419)
Q Consensus         3 ~LPd~ll~~I~~~L~~~~~~~~~~~vsk~w~~~~---~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~l~l~~   79 (419)
                      .||+|++..||++|+ ++.+.+++++|+.|....   ..|+++++.  .|+.+-..+    .+..++.+           
T Consensus        74 ~LPpEl~lkvFS~LD-tksl~r~a~~c~~~n~~AlD~~~~q~idL~--t~~rDv~g~----VV~~~~~R-----------  135 (483)
T KOG4341|consen   74 SLPPELLLKVFSMLD-TKSLCRAAQCCTMWNKLALDGSCWQHIDLF--TFQRDVDGG----VVENMISR-----------  135 (483)
T ss_pred             cCCHHHHHHHHHHHh-HHHHHHHHHHHHHhhhhhhccccceeeehh--cchhcCCCc----ceehHhhh-----------
Confidence            589999999999999 999999999999999865   456666652  222111111    12222222           


Q ss_pred             CCCcchHHHHHHHhcCCceEEEEEecCccccccccCCCcccccccC-CCCccEEEecCccccCCccc----ccCCCccEE
Q 014774           80 PFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCISR-AKNLESLKLWGVLMVSSPKW----DVFHKLQNL  154 (419)
Q Consensus        80 ~~~~~~~~~w~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~l~~-~~~L~~L~L~~~~~~~~~~~----~~~~~L~~L  154 (419)
                                   .+..|+.|.+++..       .+.+..+.-+.. |||+++|.+.+|..+++...    ..|++|+.|
T Consensus       136 -------------cgg~lk~LSlrG~r-------~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l  195 (483)
T KOG4341|consen  136 -------------CGGFLKELSLRGCR-------AVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHL  195 (483)
T ss_pred             -------------hccccccccccccc-------cCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhh
Confidence                         12334444433221       123444444444 88888888888887766632    567888888


Q ss_pred             EecCee-eChHHHHHHHhcCCCCcEEEccCCCCcccccccccccccceeeEecccCce---------eeecCCCccEEEe
Q 014774          155 EIVGAR-LEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKLDFYGLGNCS---------LSVSCPKIQFLEV  224 (419)
Q Consensus       155 ~L~~~~-~~~~~l~~l~~~~p~L~~L~l~~c~~~~~~~~~~~~l~~~~L~~l~~~~~~---------l~~~~~~L~~L~l  224 (419)
                      ++..|. +++..+..+...||+|+.+++++|+.+...+++.....+..++.+...+|.         ...+++-+.++++
T Consensus       196 ~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl  275 (483)
T KOG4341|consen  196 NLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNL  275 (483)
T ss_pred             hhcccchhHHHHHHHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccch
Confidence            888877 888888888888888888888888888777777766555555555444441         1223333444443


Q ss_pred             cCc--------------------------cc------eeec-cCCcCceeEeecccceEE---EeccCCCCCcCEeeeCC
Q 014774          225 QGC--------------------------SW------IRVQ-ETNCLRNLSISNNAGRVY---MVDFGKLAALESLTLRG  268 (419)
Q Consensus       225 ~~~--------------------------~~------~~l~-~~~~L~~L~l~~~~~~~~---~~~~~~~~~L~~L~l~~  268 (419)
                      .+|                          ..      ..++ ++.+|+.+.+..+..+-.   ..-..+++.|+.+++.+
T Consensus       276 ~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~  355 (483)
T KOG4341|consen  276 QHCNQLTDEDLWLIACGCHALQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEE  355 (483)
T ss_pred             hhhccccchHHHHHhhhhhHhhhhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccc
Confidence            333                          21      0111 133444444433311100   00112344555555521


Q ss_pred             ---CCchHHHHHHHhccCCcccEEEeee-eecCCCCCCcCCCCcCHHHHhhcCCCeeEEEecCchhHhhhhccccccccc
Q 014774          269 ---VQWCWDAISKMLYWASEVKHLYMKV-EFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVES  344 (419)
Q Consensus       269 ---~~~~~~~l~~l~~~~~~L~~L~l~~-~~~~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~l~~l~~  344 (419)
                         .++  ..+..+..+||.|+.+.++. ...+| +|++.+     .....+...|+.+++.++....-.   .+   ..
T Consensus       356 ~~~~~d--~tL~sls~~C~~lr~lslshce~itD-~gi~~l-----~~~~c~~~~l~~lEL~n~p~i~d~---~L---e~  421 (483)
T KOG4341|consen  356 CGLITD--GTLASLSRNCPRLRVLSLSHCELITD-EGIRHL-----SSSSCSLEGLEVLELDNCPLITDA---TL---EH  421 (483)
T ss_pred             cceehh--hhHhhhccCCchhccCChhhhhhhhh-hhhhhh-----hhccccccccceeeecCCCCchHH---HH---HH
Confidence               122  23444455555555555543 33333 232211     111123334555555544321000   00   11


Q ss_pred             ccccccccceeeeccCCCCchhhhhhHHhhhhcccchhhHHHHhh
Q 014774          345 GFVIPCLEEVVVTVRSPLNAEQKMSTLESLLKYGKNLKTMVIRIL  389 (419)
Q Consensus       345 ~~~~p~L~~l~l~~~~~~~~~~~~~~l~~ll~~~~~L~~L~i~~~  389 (419)
                      -..|++||.+++-.|.+++.    +.+..+..++|+++.......
T Consensus       422 l~~c~~Leri~l~~~q~vtk----~~i~~~~~~lp~i~v~a~~a~  462 (483)
T KOG4341|consen  422 LSICRNLERIELIDCQDVTK----EAISRFATHLPNIKVHAYFAP  462 (483)
T ss_pred             HhhCcccceeeeechhhhhh----hhhHHHHhhCccceehhhccC
Confidence            12478888888888888874    456666778888877666543

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 4e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score = 59.5 bits (144), Expect = 1e-09
 Identities = 47/303 (15%), Positives = 97/303 (32%), Gaps = 43/303 (14%)

Query: 2   DSLPDAIVQYILSHMKNARDVALCNCVSKRWKESIPYLKSLYFPRNSFDNQSCDNSPDDI 61
            S P+ +++++ S ++  +D    + V K W       +   + R      +C       
Sbjct: 7   LSFPEEVLEHVFSFIQLDKDRNSVSLVCKSW------YEIERWCRRKVFIGNCYAVSPAT 60

Query: 62  VLKMIYSIVCLEELVVYTPFSKAGL--DSWLMLAGSTLKHLELRMDNLA--DYQGCLENP 117
           V++    +  + EL     F+   L  D W       ++ +      L     +  +   
Sbjct: 61  VIRRFPKVRSV-ELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTD 119

Query: 118 SKLDCISRA-KNLESLKLWGVLMVSSPKWDVF----HKLQNLEIVG---ARLEDPALSTA 169
             L+ I+++ KN + L L      S+            L+ L++       +    LS  
Sbjct: 120 DCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHF 179

Query: 170 LRACPNLTNLLLLGC------EGVRSVSIELPHLEQCKLDFYGL----GNCSLSVSCPKI 219
                +L +L +           +  +    P+L+   L            +L    P++
Sbjct: 180 PDTYTSLVSLNISCLASEVSFSALERLVTRCPNLK--SLKLNRAVPLEKLATLLQRAPQL 237

Query: 220 QFLEVQGCSWIRVQET---------NC--LRNLSISNNAGRVYMVDFGK-LAALESLTLR 267
           + L   G +     +           C  LR LS   +A   Y+       + L +L L 
Sbjct: 238 EELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLS 297

Query: 268 GVQ 270
              
Sbjct: 298 YAT 300
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.52
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.47
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.3
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.24
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.18
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.1
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.1
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.03
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.02
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.01
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.01
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.01
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.99
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.99
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.98
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.95
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.86
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.79
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.79
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.74
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.7
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.68
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.63
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.58
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.54
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.54
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.52
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.5
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.46
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.44
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.42
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.4
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.35
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.29
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.26
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.22
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.09
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.07
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.02
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.0
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.9
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.9
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.9
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.82
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.5
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.45
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.41
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.4
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.4
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.33
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.24
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.2
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.11
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.01
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.98
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.89
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.87
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.32
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.25
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.01
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.97
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.94
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 95.85
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.62
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 93.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 91.43
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 90.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.78
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.49
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=99.90  E-value=3.3e-23  Score=207.95  Aligned_cols=179  Identities=20%  Similarity=0.193  Sum_probs=98.6

Q ss_pred             CCCCcHHHHHHHHhCCCCHHHHHHhhccchhHHHhh-ccCCeeeecCCCC---------------------------CCC
Q 014774            1 MDSLPDAIVQYILSHMKNARDVALCNCVSKRWKESI-PYLKSLYFPRNSF---------------------------DNQ   52 (419)
Q Consensus         1 ~~~LPd~ll~~I~~~L~~~~~~~~~~~vsk~w~~~~-~~~~~l~~~~~~~---------------------------~~~   52 (419)
                      ++.||||+|.+||+||+..+|++++++|||+|+.+. ..+..+.+.....                           ...
T Consensus         6 ~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~l~   85 (594)
T 2p1m_B            6 ALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLV   85 (594)
T ss_dssp             ----CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSCHHHHHHHCTTCCEEEEECSCGGGGGTCS
T ss_pred             hhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccCHHHHHhhCCCceEEeccCCCchhhcccc
Confidence            478999999999999998899999999999999873 2233344321000                           000


Q ss_pred             C-C-CCChHHHHHHHHHhCCCcceEEEec-CCCcchHHHHHHHhcCCceEEEEEecCccccccccCCCccccccc-CCCC
Q 014774           53 S-C-DNSPDDIVLKMIYSIVCLEELVVYT-PFSKAGLDSWLMLAGSTLKHLELRMDNLADYQGCLENPSKLDCIS-RAKN  128 (419)
Q Consensus        53 ~-~-~~~~~~~~~~~l~~~~~L~~l~l~~-~~~~~~~~~w~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~l~-~~~~  128 (419)
                      + . .......+..+.....+|++++++. ..+...+. .+....++|++|++....       ..++..+..+. .|++
T Consensus        86 ~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~-~l~~~~~~L~~L~L~~~~-------~~~~~~l~~~~~~~~~  157 (594)
T 2p1m_B           86 PDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLE-LIAKSFKNFKVLVLSSCE-------GFSTDGLAAIAATCRN  157 (594)
T ss_dssp             CTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHH-HHHHHCTTCCEEEEESCE-------EEEHHHHHHHHHHCTT
T ss_pred             cccccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHH-HHHHhCCCCcEEeCCCcC-------CCCHHHHHHHHHhCCC
Confidence            0 0 0111122333334445555655532 22221111 111123556666554221       01122233343 3778


Q ss_pred             ccEEEecCccccCCc-c-----cccCCCccEEEecCee--eChHHHHHHHhcCCCCcEEEccCCCCc
Q 014774          129 LESLKLWGVLMVSSP-K-----WDVFHKLQNLEIVGAR--LEDPALSTALRACPNLTNLLLLGCEGV  187 (419)
Q Consensus       129 L~~L~L~~~~~~~~~-~-----~~~~~~L~~L~L~~~~--~~~~~l~~l~~~~p~L~~L~l~~c~~~  187 (419)
                      |++|++.+|...... .     ...+++|+.|+++++.  +++..+..+..+||+|+.|++.+|...
T Consensus       158 L~~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~  224 (594)
T 2p1m_B          158 LKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPL  224 (594)
T ss_dssp             CCEEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCTTSCH
T ss_pred             CCEEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCCCCcH
Confidence            888888776532211 1     1356788888888775  777777777777888888888877443
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 419
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 8e-04
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.6 bits (80), Expect = 8e-04
 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 2  DSLPDAIVQYILSHMKNARDVALCNCVSKRWKE 34
          DSLPD ++  I S +    ++   + V KRW  
Sbjct: 2  DSLPDELLLGIFSCL-CLPELLKVSGVCKRWYR 33

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.99
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.85
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.59
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.56
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.52
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.42
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.31
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.29
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.16
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.15
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.13
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.97
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.79
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.77
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.64
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.41
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.06
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.37
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.41
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 92.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 89.26
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.46  E-value=4.4e-14  Score=125.54  Aligned_cols=200  Identities=22%  Similarity=0.250  Sum_probs=115.8

Q ss_pred             CCCccEEEecCccccCCc---ccccCCCccEEEecCeeeChHHHHHHHhcCCCCcEEEccCCCCccccccccccccccee
Q 014774          126 AKNLESLKLWGVLMVSSP---KWDVFHKLQNLEIVGARLEDPALSTALRACPNLTNLLLLGCEGVRSVSIELPHLEQCKL  202 (419)
Q Consensus       126 ~~~L~~L~L~~~~~~~~~---~~~~~~~L~~L~L~~~~~~~~~l~~l~~~~p~L~~L~l~~c~~~~~~~~~~~~l~~~~L  202 (419)
                      ..+|++|++++|......   ....|++|+.|++++|.+++..+..+ ..+|+|++|++++|..+++.++...       
T Consensus        45 ~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l-~~~~~L~~L~Ls~c~~itd~~l~~l-------  116 (284)
T d2astb2          45 PFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTL-AKNSNLVRLNLSGCSGFSEFALQTL-------  116 (284)
T ss_dssp             CBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHH-TTCTTCSEEECTTCBSCCHHHHHHH-------
T ss_pred             CCCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHH-hcCCCCcCccccccccccccccchh-------
Confidence            346777777766432221   13567777777777777776666554 4567777777777777666544321       


Q ss_pred             eEecccCceeeecCCCccEEEecCccceeeccCCcCceeEeecccceEEEeccCCCCCcCEeeeCC----CCchHHHHHH
Q 014774          203 DFYGLGNCSLSVSCPKIQFLEVQGCSWIRVQETNCLRNLSISNNAGRVYMVDFGKLAALESLTLRG----VQWCWDAISK  278 (419)
Q Consensus       203 ~~l~~~~~~l~~~~~~L~~L~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~----~~~~~~~l~~  278 (419)
                                ...+|+|++|++++|...        ++-      +. .......+++|++|++.+    +++  .++..
T Consensus       117 ----------~~~~~~L~~L~ls~c~~~--------~~~------~~-~~~~~~~~~~L~~L~l~~~~~~i~~--~~l~~  169 (284)
T d2astb2         117 ----------LSSCSRLDELNLSWCFDF--------TEK------HV-QVAVAHVSETITQLNLSGYRKNLQK--SDLST  169 (284)
T ss_dssp             ----------HHHCTTCCEEECCCCTTC--------CHH------HH-HHHHHHSCTTCCEEECCSCGGGSCH--HHHHH
T ss_pred             ----------hHHHHhcccccccccccc--------ccc------cc-hhhhcccccccchhhhccccccccc--ccccc
Confidence                      123566666666665321        100      00 000001245666666643    344  67788


Q ss_pred             HhccCCcccEEEeee-eecCCCCCCcCCCCcCHHHHhhcCCCeeEEEecCchhHhhhhcccccccccccccccccceeee
Q 014774          279 MLYWASEVKHLYMKV-EFTGDFDTLQPFPEVDFVEFFNNHPKLQKFDIHGAMFAALCQKNSLKNVESGFVIPCLEEVVVT  357 (419)
Q Consensus       279 l~~~~~~L~~L~l~~-~~~~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~l~~l~~~~~~p~L~~l~l~  357 (419)
                      +...||+|++|+++. ...++ ++         ...+..+|+|++|++++|....-.   .+..+   ..+|+|+.|++.
T Consensus       170 l~~~~~~L~~L~L~~~~~itd-~~---------~~~l~~~~~L~~L~L~~C~~i~~~---~l~~L---~~~~~L~~L~l~  233 (284)
T d2astb2         170 LVRRCPNLVHLDLSDSVMLKN-DC---------FQEFFQLNYLQHLSLSRCYDIIPE---TLLEL---GEIPTLKTLQVF  233 (284)
T ss_dssp             HHHHCTTCSEEECTTCTTCCG-GG---------GGGGGGCTTCCEEECTTCTTCCGG---GGGGG---GGCTTCCEEECT
T ss_pred             cccccccccccccccccCCCc-hh---------hhhhcccCcCCEEECCCCCCCChH---HHHHH---hcCCCCCEEeee
Confidence            888899999999964 33444 21         122356899999999886421000   11111   136999999998


Q ss_pred             ccCCCCchhhhhhHHhhhhcccchh
Q 014774          358 VRSPLNAEQKMSTLESLLKYGKNLK  382 (419)
Q Consensus       358 ~~~~~~~~~~~~~l~~ll~~~~~L~  382 (419)
                      +|  ++|+    .++.+.+.+|+|+
T Consensus       234 ~~--~~d~----~l~~l~~~lp~L~  252 (284)
T d2astb2         234 GI--VPDG----TLQLLKEALPHLQ  252 (284)
T ss_dssp             TS--SCTT----CHHHHHHHSTTSE
T ss_pred             CC--CCHH----HHHHHHHhCcccc
Confidence            87  5553    3455566778766
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure