Citrus Sinensis ID: 014843

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MTLMKLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGLDYKL
cccHHcccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccEEEccccccEEEEEcccEEEEcccccEEEEEEEEEccccccHHHHHHHccccccEEEEEcccccccccccccccEEEEccccccccccccEEEEEcccccccccccEEEEEEEcccccccccHHHHHHHHHHHccccccccccccEEEccEEEEccccccccccccccEEEEccccccccccccccccHHHHHcHHHHHHHHHHHHHcccccHHccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccc
ccHHHHHHHHHEEEEccEccccccccccccHcccccHHHHHHHHHHHHHHccccEEccccEEEEEEccccEEEEEccccEEEEEEEEEcccccHHHHHHHHcccccccEccEEEEEEccccccccccEEEEccccccccccccEEEEEEccccccccccEEEEEEEcccccccccHHHHHHHHHHHcHHHccccHHHcEEEEEEEEEccccccccccccccEEEEEccccccccccEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccccccc
MTLMKLQLQNLILIDvdlrgrvksglkTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIrsgrkpdgvclvvgscargfkdnstsdviyssssvkkvgdSEVQLFWEafpagsgpldrttymftyidpqagspkLEELLERYWDlmpeyqgvtldnLEIQRVIYgifptyrdsplpaAFNRILQfgdasgiqspvsfggfgsltrhlgrlstgvyeavrgdfvdsyslsllnpympnlsASWLFQRAMSakqqsdvspdFINELLYVNFQCMqklgdpvlrpflqdvikfgplaktlglvmlnkpqiipsifkqvgipvlvdwSGHFFMLGYYTLLSTFADPVIRSLLnafpprmkYEWNRYLEAWKygsgldykl
MTLMKLQLQNLIlidvdlrgrvKSGLKtfsilefrepakLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGScargfkdnstsdviyssssvKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAwkygsgldykl
MTLMKLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYssssvkkvGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGLDYKL
****KLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMS******VSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGL****
*TLMKLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMSAKQ**DVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGLDYK*
MTLMKLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQR********DVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGLDYKL
*TLMKLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGLDYKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLMKLQLQNLILIDVDLRGRVKSGLKTFSILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYMPNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRMKYEWNRYLEAWKYGSGLDYKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
225447101 583 PREDICTED: uncharacterized protein LOC10 0.911 0.651 0.834 0.0
255568683 583 conserved hypothetical protein [Ricinus 0.913 0.653 0.832 0.0
356554456 584 PREDICTED: uncharacterized protein LOC10 0.913 0.652 0.811 0.0
449453527 591 PREDICTED: uncharacterized protein LOC10 0.913 0.644 0.803 0.0
357141364 593 PREDICTED: uncharacterized protein LOC10 0.911 0.640 0.765 1e-175
308044513 593 uncharacterized protein LOC100502482 [Ze 0.911 0.640 0.736 1e-169
42569568 585 Lycopene beta/epsilon cyclase protein [A 0.913 0.651 0.763 1e-168
115476458 614 Os08g0422000 [Oryza sativa Japonica Grou 0.911 0.618 0.731 1e-163
326507200 611 predicted protein [Hordeum vulgare subsp 0.908 0.620 0.735 1e-163
164564753 522 CM0545.530.nc [Lotus japonicus] 0.764 0.611 0.836 1e-157
>gi|225447101|ref|XP_002273536.1| PREDICTED: uncharacterized protein LOC100241486 [Vitis vinifera] gi|297739195|emb|CBI28846.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/380 (83%), Positives = 354/380 (93%)

Query: 37  PAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPV 96
           P KLIE+VK+RF SLGGVIFEGYSVS+IC YE+AAVL LAEG ILS+ L+IDAMGNFSPV
Sbjct: 203 PVKLIEVVKRRFTSLGGVIFEGYSVSNICIYEDAAVLQLAEGNILSTRLLIDAMGNFSPV 262

Query: 97  VKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGP 156
           VKQ+R GRKPDGVCLVVGSCARGF +NSTSDVIYSSSSVKKVG+SEVQ FWEAFPAGSGP
Sbjct: 263 VKQMRGGRKPDGVCLVVGSCARGFTNNSTSDVIYSSSSVKKVGESEVQYFWEAFPAGSGP 322

Query: 157 LDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPL 216
           +DRTTYMFTY+DPQ   PKLE+LLE YWD+MPEYQGV+L++L+I RV++GIFPTYRDSPL
Sbjct: 323 VDRTTYMFTYVDPQPKCPKLEDLLEDYWDMMPEYQGVSLEDLQILRVVFGIFPTYRDSPL 382

Query: 217 PAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYM 276
           PAAF+RILQFGDASGIQSPVSFGGFGSLTRHL RLSTG+YEA+ G+F+DSY+LSLLNPYM
Sbjct: 383 PAAFDRILQFGDASGIQSPVSFGGFGSLTRHLERLSTGIYEAITGNFLDSYNLSLLNPYM 442

Query: 277 PNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAK 336
           PNLSA+WLFQRAMSAKQQ DVSPDFI+ELLYVNFQ MQ+LGDPVLRPFLQDVI+FGPL K
Sbjct: 443 PNLSAAWLFQRAMSAKQQYDVSPDFISELLYVNFQSMQRLGDPVLRPFLQDVIQFGPLVK 502

Query: 337 TLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRM 396
           TLGLVML+KPQI+PSIFKQVG+PVL+DWSGHF MLGYYT LSTF DP IR L+NAFP +M
Sbjct: 503 TLGLVMLSKPQILPSIFKQVGVPVLLDWSGHFVMLGYYTFLSTFIDPAIRPLINAFPAKM 562

Query: 397 KYEWNRYLEAWKYGSGLDYK 416
           KY+W RYLEAWKYG+GLDYK
Sbjct: 563 KYKWKRYLEAWKYGAGLDYK 582

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255568683|ref|XP_002525313.1| conserved hypothetical protein [Ricinus communis] gi|223535372|gb|EEF37046.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356554456|ref|XP_003545562.1| PREDICTED: uncharacterized protein LOC100784275 [Glycine max] Back     alignment and taxonomy information
>gi|449453527|ref|XP_004144508.1| PREDICTED: uncharacterized protein LOC101203820 [Cucumis sativus] gi|449493152|ref|XP_004159207.1| PREDICTED: uncharacterized LOC101203820 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357141364|ref|XP_003572198.1| PREDICTED: uncharacterized protein LOC100825935 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|308044513|ref|NP_001183889.1| uncharacterized protein LOC100502482 [Zea mays] gi|238015286|gb|ACR38678.1| unknown [Zea mays] gi|413922261|gb|AFW62193.1| hypothetical protein ZEAMMB73_528743 [Zea mays] Back     alignment and taxonomy information
>gi|42569568|ref|NP_180823.3| Lycopene beta/epsilon cyclase protein [Arabidopsis thaliana] gi|110742020|dbj|BAE98947.1| hypothetical protein [Arabidopsis thaliana] gi|330253614|gb|AEC08708.1| Lycopene beta/epsilon cyclase protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115476458|ref|NP_001061825.1| Os08g0422000 [Oryza sativa Japonica Group] gi|37573089|dbj|BAC98659.1| Glycine/D-amino acid oxidases-like [Oryza sativa Japonica Group] gi|113623794|dbj|BAF23739.1| Os08g0422000 [Oryza sativa Japonica Group] gi|215695103|dbj|BAG90294.1| unnamed protein product [Oryza sativa Japonica Group] gi|222640571|gb|EEE68703.1| hypothetical protein OsJ_27354 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326507200|dbj|BAJ95677.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|164564753|dbj|BAF98233.1| CM0545.530.nc [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
TAIR|locus:2046422585 AT2G32640 [Arabidopsis thalian 0.913 0.651 0.748 7e-157
TAIR|locus:2046422 AT2G32640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1529 (543.3 bits), Expect = 7.0e-157, P = 7.0e-157
 Identities = 285/381 (74%), Positives = 326/381 (85%)

Query:    37 PAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPV 96
             PAKL+E VK+RFISLGGVI E  S+SSI  Y + AV+ L++G  LSS L+IDAMGNFSP+
Sbjct:   205 PAKLVETVKQRFISLGGVILEDSSLSSIVIYNDLAVMQLSKGDTLSSRLVIDAMGNFSPI 264

Query:    97 VKQIRSGRKPDGVCLVVGSCARGFKDNSTSDVIYXXXXXXXXGDSEVQLFWEAFPAGSGP 156
             +KQI+ GRKPDG+CLVVGSCA GFK+NS+SDVIY         DS VQLFWEAFPAGSGP
Sbjct:   265 LKQIKRGRKPDGMCLVVGSCAHGFKENSSSDVIYSSSSVTRVADSNVQLFWEAFPAGSGP 324

Query:   157 LDRTTYMFTYIDPQAGSPKLEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPL 216
             LDRTTYMFTY +PQ+ SP LE+LLE YW LMP+YQGV+LD LEI RV+YGIFPTYR+SPL
Sbjct:   325 LDRTTYMFTYTEPQSTSPSLEDLLEEYWKLMPKYQGVSLDELEILRVVYGIFPTYRNSPL 384

Query:   217 PAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLSLLNPYM 276
             PAAF+R+LQFGDASGIQSPVSFGGFGSLTRHLGRLS G+Y+A+ GD +DS SLS LNPYM
Sbjct:   385 PAAFDRVLQFGDASGIQSPVSFGGFGSLTRHLGRLSNGIYDAIDGDLLDSDSLSKLNPYM 444

Query:   277 PNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAK 336
             PNLSASWLFQRAMSAKQQ DVS  F NELL+VNF CMQ+LGDPVLRPFLQD+I+FGPLAK
Sbjct:   445 PNLSASWLFQRAMSAKQQLDVSRGFTNELLHVNFSCMQRLGDPVLRPFLQDIIQFGPLAK 504

Query:   337 TLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVIRSLLNAFPPRM 396
             TLGLVML KPQIIPSIF+QVGIPVL+DWS HFFMLG YTLLS + DP++R  L   P + 
Sbjct:   505 TLGLVMLTKPQIIPSIFRQVGIPVLLDWSVHFFMLGLYTLLSAYIDPLLRPSLEGLPSKT 564

Query:   397 KYEWNRYLEAWKYGSGLDYKL 417
             ++EW R LEAWKYG+GLDY+L
Sbjct:   565 RFEWKRCLEAWKYGAGLDYEL 585


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.323   0.141   0.427    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      417       409   0.00079  118 3  11 22  0.36    34
                                                     34  0.45    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  622 (66 KB)
  Total size of DFA:  258 KB (2137 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  30.98u 0.11s 31.09t   Elapsed:  00:00:02
  Total cpu time:  30.98u 0.11s 31.09t   Elapsed:  00:00:02
  Start:  Mon May 20 22:04:59 2013   End:  Mon May 20 22:05:01 2013
GO:0016117 "carotenoid biosynthetic process" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 417
PLN02463447 lycopene beta cyclase 100.0
PLN02697529 lycopene epsilon cyclase 99.97
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.94
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.94
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.92
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.91
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.91
PRK10015429 oxidoreductase; Provisional 99.9
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.9
PRK10157428 putative oxidoreductase FixC; Provisional 99.87
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.81
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.79
PRK11445351 putative oxidoreductase; Provisional 99.78
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.68
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.63
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.62
PRK09126392 hypothetical protein; Provisional 99.62
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.61
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.61
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.57
PRK06185407 hypothetical protein; Provisional 99.57
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.57
PRK08013400 oxidoreductase; Provisional 99.57
PRK07045388 putative monooxygenase; Reviewed 99.56
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.56
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.56
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.54
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.53
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.5
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.49
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.48
PRK08244493 hypothetical protein; Provisional 99.47
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.43
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.41
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.41
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.36
PRK07190487 hypothetical protein; Provisional 99.36
PRK06753373 hypothetical protein; Provisional 99.35
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.35
PRK07588391 hypothetical protein; Provisional 99.32
PRK06184502 hypothetical protein; Provisional 99.3
PRK06996398 hypothetical protein; Provisional 99.29
PRK08163396 salicylate hydroxylase; Provisional 99.28
PTZ00367567 squalene epoxidase; Provisional 99.28
PRK06834488 hypothetical protein; Provisional 99.27
PRK07538413 hypothetical protein; Provisional 99.26
PRK06847375 hypothetical protein; Provisional 99.25
PRK05868372 hypothetical protein; Validated 99.25
PRK08294634 phenol 2-monooxygenase; Provisional 99.22
PRK08132547 FAD-dependent oxidoreductase; Provisional 99.21
PRK06475400 salicylate hydroxylase; Provisional 99.2
PLN02985514 squalene monooxygenase 99.19
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.16
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.09
PRK06126545 hypothetical protein; Provisional 99.03
PRK07236386 hypothetical protein; Provisional 98.98
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 98.75
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.65
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.24
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.24
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.24
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.11
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.92
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.88
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 97.86
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.76
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.68
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.64
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.64
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.61
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.61
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.48
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 97.44
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.4
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.22
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.11
PRK11728393 hydroxyglutarate oxidase; Provisional 97.08
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 97.0
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.98
COG0579429 Predicted dehydrogenase [General function predicti 96.76
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 96.75
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 96.33
PRK07233434 hypothetical protein; Provisional 96.26
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 96.17
PTZ00383497 malate:quinone oxidoreductase; Provisional 96.09
PRK12416463 protoporphyrinogen oxidase; Provisional 96.09
PF01134392 GIDA: Glucose inhibited division protein A; InterP 95.98
PLN02612567 phytoene desaturase 95.96
PRK05257494 malate:quinone oxidoreductase; Validated 95.78
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 95.74
PLN02676487 polyamine oxidase 95.72
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 95.68
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 95.68
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 95.47
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 95.4
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 95.37
TIGR00275400 flavoprotein, HI0933 family. The model when search 95.17
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 95.13
COG2081408 Predicted flavoproteins [General function predicti 94.87
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 94.7
PRK13339497 malate:quinone oxidoreductase; Reviewed 94.65
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 94.64
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 94.46
PLN02464627 glycerol-3-phosphate dehydrogenase 94.24
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 94.1
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 94.1
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 93.82
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 93.43
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 93.27
PRK11883451 protoporphyrinogen oxidase; Reviewed 93.12
COG1231450 Monoamine oxidase [Amino acid transport and metabo 92.75
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 92.56
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 92.54
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 92.1
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 92.05
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 91.53
PRK09897534 hypothetical protein; Provisional 91.39
PLN02661357 Putative thiazole synthesis 91.12
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 90.98
PRK07804541 L-aspartate oxidase; Provisional 90.77
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 90.77
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 90.44
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 90.29
TIGR02730493 carot_isom carotene isomerase. Members of this fam 90.12
PLN02172461 flavin-containing monooxygenase FMO GS-OX 89.52
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 89.38
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 89.27
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 88.87
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 88.19
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 88.15
COG1233487 Phytoene dehydrogenase and related proteins [Secon 87.94
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 87.87
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 87.51
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 87.08
PRK08274466 tricarballylate dehydrogenase; Validated 86.92
PLN02976 1713 amine oxidase 86.81
PRK06481506 fumarate reductase flavoprotein subunit; Validated 86.58
PRK09231582 fumarate reductase flavoprotein subunit; Validated 86.5
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 86.41
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 86.37
PRK07121492 hypothetical protein; Validated 85.38
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 85.26
PLN02487569 zeta-carotene desaturase 85.18
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 85.16
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 85.09
PLN02576496 protoporphyrinogen oxidase 84.96
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 84.81
PRK06175433 L-aspartate oxidase; Provisional 84.64
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 84.0
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 83.4
PRK08275554 putative oxidoreductase; Provisional 83.16
PRK06116450 glutathione reductase; Validated 83.07
PLN02529738 lysine-specific histone demethylase 1 82.98
PRK12839572 hypothetical protein; Provisional 82.8
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 82.05
PRK10262321 thioredoxin reductase; Provisional 81.98
PRK08401466 L-aspartate oxidase; Provisional 81.81
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 81.79
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 81.78
PLN02328808 lysine-specific histone demethylase 1 homolog 81.08
>PLN02463 lycopene beta cyclase Back     alignment and domain information 
Probab=100.00  E-value=2.9e-33  Score=291.28  Aligned_cols=305  Identities=14%  Similarity=0.136  Sum_probs=221.0

Q ss_pred             ccChHHHHHHHHHHHhhcCcEEEcCceEEEEEEECCeEEEEecCCcEEEEEEEEeccCCCchhhhhhhcCCC--CCceee
Q 014843           34 FREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRK--PDGVCL  111 (417)
Q Consensus        34 ~Vdr~~L~~~L~~ka~~~Gg~i~~~t~v~~i~~~~d~v~V~t~~g~~~~ARlVIDA~G~~Spiarql~~g~~--~~~vc~  111 (417)
                      .|+|..|++.|.++|.+.|+++. .++|++++..++++.|++.+|++++|++||||+|++|++.+.......  +..+..
T Consensus       110 ~V~R~~L~~~Ll~~~~~~GV~~~-~~~V~~I~~~~~~~~V~~~dG~~i~A~lVI~AdG~~s~l~~~~~~~~~g~Q~a~Gi  188 (447)
T PLN02463        110 RVNRKKLKSKMLERCIANGVQFH-QAKVKKVVHEESKSLVVCDDGVKIQASLVLDATGFSRCLVQYDKPFNPGYQVAYGI  188 (447)
T ss_pred             eEEHHHHHHHHHHHHhhcCCEEE-eeEEEEEEEcCCeEEEEECCCCEEEcCEEEECcCCCcCccCCCCCCCccceeeeeE
Confidence            48999999999999999998886 579999999999999999888899999999999999998753111100  001111


Q ss_pred             eeeeeeecCCCCCcce-EEEecccccc--------cCCCCCceeeeecCCCCCCCCceEEEEEeeCCCC--CCC-----C
Q 014843          112 VVGSCARGFKDNSTSD-VIYSSSSVKK--------VGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQA--GSP-----K  175 (417)
Q Consensus       112 ~vg~~a~G~~d~~~ge-i~fs~~~v~~--------~~~~~~qy~We~FP~~dg~~e~ttyLf~y~~~~~--~~p-----s  175 (417)
                      +++.....++   ... ++.++.....        .+..-++|+| +||.+++   . .+    .|+++  .+|     .
T Consensus       189 ~~ev~~~p~d---~~~~vlMD~r~~~~~~~~~~~~~~~~~p~FlY-~~P~~~~---~-~~----vEeT~l~s~~~~~~~~  256 (447)
T PLN02463        189 LAEVDSHPFD---LDKMLFMDWRDSHLGNNPELRARNSKLPTFLY-AMPFSSN---R-IF----LEETSLVARPGLPMDD  256 (447)
T ss_pred             EeecCCCCcc---cccchhhhcChhhccccchhhhccCCCCceEE-EEecCCC---e-EE----EEeeeeecCCCCCHHH
Confidence            1111111121   111 1111111110        0011257999 9999865   1 11    22221  111     4


Q ss_pred             HHHHHHHHHHhCCcccCCCCCccceEEeeeeecCCCCCCCCCCCCCCEEEEcCCCCCCCCccccchhHHHhhHHHHHHHH
Q 014843          176 LEELLERYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGV  255 (417)
Q Consensus       176 L~~l~e~y~~~LP~y~g~~l~~~~~~~~~~G~~P~~~~~p~~~~~driLlvGDAAglvdPlSg~GfGs~lR~l~rla~gI  255 (417)
                      +++.+.+|++.+    |+...  ++.+.+.|.||+..  +.+...+|+++||||||++||.|||||++++++++.+|+.|
T Consensus       257 lk~~L~~~l~~~----Gi~~~--~i~~~E~~~IPmg~--~~~~~~~~~~~~G~aag~v~p~tG~~i~~~~~~~~~~a~~~  328 (447)
T PLN02463        257 IQERMVARLRHL----GIKVK--SVEEDEKCVIPMGG--PLPVIPQRVLGIGGTAGMVHPSTGYMVARTLAAAPIVADAI  328 (447)
T ss_pred             HHHHHHHHHHHC----CCCcc--eeeeeeeeEeeCCC--CCCCCCCCEEEecchhcCcCCCccccHHHHHHHHHHHHHHH
Confidence            444555555433    54333  46888999999954  55667899999999999999999999999999999999999


Q ss_pred             HHHHhCCCC---ChhhHhh-----hcCCCc---cchHHHHHHhhcccccCCCCChhHHHHHHHHHHHHHhhcChhhhccc
Q 014843          256 YEAVRGDFV---DSYSLSL-----LNPYMP---NLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPF  324 (417)
Q Consensus       256 ~~AL~~~~l---sa~~L~~-----l~~Yq~---nl~~~~~lqk~M~~~~~~~~~p~~in~ll~~~F~~~~~Lp~~~~~~f  324 (417)
                      .+||+++..   +..+++.     +-+|+.   .--...++.++|.++..          .++.||.+||+||+++|.+|
T Consensus       329 ~~~~~~~~~~~~~~~~~~~~~w~~lw~~~~~~~~~~~~fg~~~l~~~~~~----------~~~~ff~~ff~l~~~~~~gf  398 (447)
T PLN02463        329 VEYLGSSRSNSFRGDELSAEVWNDLWPIERRRQREFFCFGMDILLKLDLD----------GTRRFFDAFFDLEPHYWHGF  398 (447)
T ss_pred             HHHHhcCCCcCCChHHHHHHHHHHhCCHhHhHhHHHHHhHHHHHHcCChH----------HHHHHHHHHHcCCHHHcccc
Confidence            999997765   3333332     222221   11122489999999998          89999999999999999999


Q ss_pred             ccccCChhHHHHHHHHHHHhCCCChHHHHhhcCchhhhhhhHHHH
Q 014843          325 LQDVIKFGPLAKTLGLVMLNKPQIIPSIFKQVGIPVLVDWSGHFF  369 (417)
Q Consensus       325 l~d~~~~~~l~~~m~~~~~~~P~~v~~~~~~~g~~~~~~w~~~~~  369 (417)
                      |.++++..+|+.+|+++|...|+.+|+.+-..|+.+++.-+++++
T Consensus       399 l~~~~~~~~l~~~~~~~f~~~~~~~r~~~~~~~~~~~~~~~~~~~  443 (447)
T PLN02463        399 LSSRLFLPELLLFGLSLFSHASNTSRLEIMAKGTVPLVKMINNLI  443 (447)
T ss_pred             ccCCCChHHHHHHHHHHHHhCCHHHHHHHHHcCChhHHHHHHHhc
Confidence            999999999999999999999999999999999999999888765

>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 48.3 bits (114), Expect = 4e-06
 Identities = 63/477 (13%), Positives = 123/477 (25%), Gaps = 161/477 (33%)

Query: 9   QNLILIDVDLRGRVKSGLKTF--SILE---------FREPAKLIEIVKKRFISL------ 51
             L L    L  + +  ++ F   +L           +   +   ++ + +I        
Sbjct: 63  GTLRLFWT-LLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYN 121

Query: 52  GGVIFEGYSVSSICTYENAAVLLLAEGKILSSH--LIIDAMGNFSPVVKQIRSGRKPDGV 109
              +F  Y+VS +  Y      LL     L     ++ID +       K           
Sbjct: 122 DNQVFAKYNVSRLQPYLKLRQALLE----LRPAKNVLIDGVLGSG---KT---------- 164

Query: 110 CLVVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGP---LDRTTYMFTY 166
            + +  C               S  V+   D ++  FW      + P   L+    +   
Sbjct: 165 WVALDVC--------------LSYKVQCKMDFKI--FWLNLKNCNSPETVLEMLQKLLYQ 208

Query: 167 IDP-------QAGSPKL--EELLERYWDLMPEYQGVT----LDNLEIQRVIYGIFPTYRD 213
           IDP        + + KL    +      L+           L N++  +           
Sbjct: 209 IDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAW--------- 259

Query: 214 SPLPAAFN---RILQFGDASGIQSPVSFGGFGSLTRHLG---RLSTGVYEAVRGD----- 262
                AFN   +IL           +        TR       LS      +  D     
Sbjct: 260 ----NAFNLSCKIL-----------L-------TTRFKQVTDFLSAATTTHISLDHHSMT 297

Query: 263 FVDSYSLSLLNPYMPNLSASWLFQRAMS-AKQQSDVSP-----------DFIN---ELLY 307
                  SLL          +L  R     ++    +P           D +       +
Sbjct: 298 LTPDEVKSLL--------LKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKH 349

Query: 308 VNF--------QCMQKLGDPVLRP-------FLQDV-IKFGPLAKTLGLVMLN-KPQIIP 350
           VN           +  L     R        F     I   P    L L+  +     + 
Sbjct: 350 VNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHI---P-TILLSLIWFDVIKSDVM 405

Query: 351 SIFKQVGIPVLVDWSGHFFMLGYYTLLSTFADPVI------RSLLNAFPPRMKYEWN 401
            +  ++    LV+       +   ++       +       RS+++ +     ++ +
Sbjct: 406 VVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSD 462
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.93
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.91
3atr_A453 Conserved archaeal protein; saturating double bond 99.86
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.76
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.71
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.65
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.64
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.62
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.6
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.6
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.59
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.59
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.57
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.48
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.47
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.43
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.4
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.4
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.36
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.34
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.34
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.31
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.26
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.21
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.19
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.18
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.93
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.59
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.41
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.38
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.3
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.22
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.21
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.2
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.2
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.13
3dme_A369 Conserved exported protein; structural genomics, P 98.11
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.71
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.69
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.58
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.55
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.33
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.23
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.21
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.21
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.21
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.21
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.13
2cul_A232 Glucose-inhibited division protein A-related PROT 96.9
2gqf_A401 Hypothetical protein HI0933; structural genomics, 96.77
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 96.71
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 96.64
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 96.52
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 96.46
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.31
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 96.19
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 96.18
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.15
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.13
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.11
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 96.04
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.01
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.01
2bry_A497 NEDD9 interacting protein with calponin homology a 95.9
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.83
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 95.74
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 95.56
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 95.5
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 95.35
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 95.32
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 95.24
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 95.23
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 95.16
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 95.14
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.06
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 95.01
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 94.95
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 94.93
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 94.89
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 94.87
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 94.71
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 94.66
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 94.66
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 94.66
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 94.51
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 94.38
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 94.24
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 94.05
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 94.02
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 93.76
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.74
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 93.72
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 93.7
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 93.63
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 93.53
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 93.35
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 93.34
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 92.85
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 92.26
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 92.11
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 91.82
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 91.68
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 91.26
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 91.26
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 90.32
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 89.95
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 89.82
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 89.56
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 89.48
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 88.69
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 88.64
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 88.5
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 88.12
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 87.33
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 87.13
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 87.02
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 86.78
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 86.74
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 86.72
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 86.61
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 85.21
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 85.19
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 84.64
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 83.91
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 83.89
1fec_A490 Trypanothione reductase; redox-active center, oxid 83.83
4fk1_A304 Putative thioredoxin reductase; structural genomic 83.82
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 83.02
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 82.48
4dna_A463 Probable glutathione reductase; structural genomic 81.3
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 81.1
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 80.32
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 80.24
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 80.08
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
Probab=99.93  E-value=1.8e-24  Score=210.76  Aligned_cols=288  Identities=13%  Similarity=0.158  Sum_probs=195.5

Q ss_pred             ceeeccChHHHHHHHHHHHhhcCcEEEcCceEEEEEEECCeEEEEe--cCC--cEEEEEEEEeccCCCchhhhhhhcCC-
Q 014843           30 SILEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLL--AEG--KILSSHLIIDAMGNFSPVVKQIRSGR-  104 (417)
Q Consensus        30 ~~~~~Vdr~~L~~~L~~ka~~~Gg~i~~~t~v~~i~~~~d~v~V~t--~~g--~~~~ARlVIDA~G~~Spiarql~~g~-  104 (417)
                      .....++|..|+++|.++|.+.|++++.+++|+++..+++.++...  .++  .+++|++||+|||.+|.++++++... 
T Consensus        94 ~~~~~i~R~~~~~~L~~~a~~~G~~~~~~~~v~~~~~~~~~~~~v~~~~~~~~~~~~a~~vIgAdG~~S~vr~~~g~~~~  173 (397)
T 3oz2_A           94 EVGYVLERDKFDKHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKMVIAADGFESEFGRWAGLKSV  173 (397)
T ss_dssp             CCEEEECHHHHHHHHHHHHHHHTCEEESSCCEEEEEEETTEEEEEEEEETTEEEEEEEEEEEECCCTTCHHHHHHTCGGG
T ss_pred             ceeEEEEHHHHHHHHHHHHHhcCcEEeeeeeeeeeeeccceeeeeeecccccceEEEEeEEEeCCccccHHHHHcCCCcc
Confidence            3456799999999999999999999999999999999998776432  233  37999999999999999999986542 


Q ss_pred             --CCCceeeeeeeeeecCC-CCCcceEEEecccccccCCCCCceeeeecCCCCCCCCceEEEEEeeCCCCCCCCHHHHHH
Q 014843          105 --KPDGVCLVVGSCARGFK-DNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKLEELLE  181 (417)
Q Consensus       105 --~~~~vc~~vg~~a~G~~-d~~~gei~fs~~~v~~~~~~~~qy~We~FP~~dg~~e~ttyLf~y~~~~~~~psL~~l~e  181 (417)
                        +....+..+.......+ +.+..+  +..+.+.+     .+|+| .||.+++  ..+++++...+....+.++++.++
T Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~-----~g~~~-~~~~~~~--~~~vg~~~~~~~~~~~~~~~~~l~  243 (397)
T 3oz2_A          174 ILARNDIISALQYRMINVDVDPDYTD--FYLGSIAP-----AGYIW-VFPKGEG--MANVGIGSSINWIHNRFELKNYLD  243 (397)
T ss_dssp             CCCGGGEEEEEEEEEESCCCCTTEEE--EECSTTST-----TEEEE-EEEEETT--EEEEEEEEETTTSCSHHHHHHHHH
T ss_pred             cccceeeeeeEEEEeeccccCcccce--eeeeccCC-----CceEE-Eeecccc--eeEEEEeeccchhhhhhhHHHHHH
Confidence              22223322222222222 223333  33444443     68999 8999865  367777754432222226888888


Q ss_pred             HHHHhCCcccCCCCCccceEEeeeeecCCCCCCCCCCCCCCEEEEcCCCCCCCCccccchhHHHhhHHHHHHHHHHHHhC
Q 014843          182 RYWDLMPEYQGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRG  261 (417)
Q Consensus       182 ~y~~~LP~y~g~~l~~~~~~~~~~G~~P~~~~~p~~~~~driLlvGDAAglvdPlSg~GfGs~lR~l~rla~gI~~AL~~  261 (417)
                      ++++..|..+.     .+..+...+.+|..+ ...+...+|++++||||+.++|++|.|+..+++++..+|+.|.+|+++
T Consensus       244 ~~~~~~~~l~~-----~~~~~~~~~~~~~~~-~~~~~~~~~v~lvGDAA~~~~P~~G~Gi~~A~~~g~~~A~~i~~~l~~  317 (397)
T 3oz2_A          244 RFIENHPGLKK-----GQDIQLVTGGVSVSK-VKMPITMPGLMLVGDAARLIDPITGGGIANAIVSGMYAAQVTKEAIES  317 (397)
T ss_dssp             HHHHTCHHHHT-----SEEEEEEEEEEECCC-CCSCCEETTEEECGGGGTCSCTTTCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhCccccc-----cceeeeeeccccccC-cccceeeeeEEEcccccccCCCCcchhHHHHHHHHHHHHHHHHHHHHc
Confidence            88887765443     233455557888865 355788899999999999999999999999999988899999999999


Q ss_pred             CCCChhhHhhhc-----CCCccchHHHHHHhhcccccCCCCChhHHHHHHHHHHHHHhhcChhhhcccccccCChhHHHH
Q 014843          262 DFVDSYSLSLLN-----PYMPNLSASWLFQRAMSAKQQSDVSPDFINELLYVNFQCMQKLGDPVLRPFLQDVIKFGPLAK  336 (417)
Q Consensus       262 ~~lsa~~L~~l~-----~Yq~nl~~~~~lqk~M~~~~~~~~~p~~in~ll~~~F~~~~~Lp~~~~~~fl~d~~~~~~l~~  336 (417)
                      ++.+++.|+.+.     .|......+|.+++.+..     .+++    .++.+|..+.+.       .+ ..+++..+.+
T Consensus       318 ~~~~~~~L~~Ye~~~~~~~~~~~~~~~~~~~~~~~-----~~~~----~~~~~~~~~~~~-------~~-~~~~~~~~~k  380 (397)
T 3oz2_A          318 NDYSPQMMQKYEKLIKERFERKHLRNWVAKEKLAM-----LSDD----TLDKLVDIVSEQ-------VL-TTISVEAILK  380 (397)
T ss_dssp             TCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT-----CCHH----HHHHHHHHHTTS-------CB-CSCSHHHHHH
T ss_pred             CCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-----CCHH----HHHHHHHHHhHH-------Hh-hhcCHHHHHH
Confidence            999998885321     122223334444333321     2333    444455444321       12 2356666655


Q ss_pred             HHHHHHHhCCCChHHHH
Q 014843          337 TLGLVMLNKPQIIPSIF  353 (417)
Q Consensus       337 ~m~~~~~~~P~~v~~~~  353 (417)
                         +++.++|.+++..-
T Consensus       381 ---~~~~~~p~~~~~l~  394 (397)
T 3oz2_A          381 ---AIAEKYPEVVKELE  394 (397)
T ss_dssp             ---HHHHHCGGGGGGGG
T ss_pred             ---HHHHHCHHHHHHHH
Confidence               45789999887653
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.77
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.66
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.57
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.53
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.5
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.97
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 96.62
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 96.53
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.27
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 96.13
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.92
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.84
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 95.78
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.77
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 94.75
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.22
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.04
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 93.83
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.13
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 93.04
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 92.44
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 92.3
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.46
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.27
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.54
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.35
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 86.77
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 84.94
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 83.59
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.53
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 83.26
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 81.21
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 80.86
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 80.45
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 80.12
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=98.77  E-value=6.8e-09  Score=102.15  Aligned_cols=180  Identities=17%  Similarity=0.279  Sum_probs=115.0

Q ss_pred             eeccChHHHHHHHHHHHhhcCcEEEcCceEEEEEEECCeEEEEecCCcEEEEEEEEeccCCCchhhhhhhcCCCCCceee
Q 014843           32 LEFREPAKLIEIVKKRFISLGGVIFEGYSVSSICTYENAAVLLLAEGKILSSHLIIDAMGNFSPVVKQIRSGRKPDGVCL  111 (417)
Q Consensus        32 ~~~Vdr~~L~~~L~~ka~~~Gg~i~~~t~v~~i~~~~d~v~V~t~~g~~~~ARlVIDA~G~~Spiarql~~g~~~~~vc~  111 (417)
                      ...+.+..++.++.++|.+.|+++..++.+..+...+++++.....+     -..++..+..            .+    
T Consensus       135 ~~~~~~~~~~~~l~~~Ae~~g~~~~~~~~~~~~l~~~~g~~~~~~~~-----~~~~~~~~~~------------~~----  193 (380)
T d2gmha1         135 NYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATN-----DVGIQKDGAP------------KT----  193 (380)
T ss_dssp             CEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSEEEEEEC-----CEEECTTSCE------------EE----
T ss_pred             ceeehhhHHHHHHHHHHhhccceeeeecceeeeeeccCCceeecccc-----cccccccccc------------cc----
Confidence            44589999999999999999999999999999998887766543211     1122222211            11    


Q ss_pred             eeeeeeecCCCCCcceEEEecccccccCCCCCceeeeecCCCCCCCCceEEEEEeeCCCCCCCCH-HHHHHHHHHhCCcc
Q 014843          112 VVGSCARGFKDNSTSDVIYSSSSVKKVGDSEVQLFWEAFPAGSGPLDRTTYMFTYIDPQAGSPKL-EELLERYWDLMPEY  190 (417)
Q Consensus       112 ~vg~~a~G~~d~~~gei~fs~~~v~~~~~~~~qy~We~FP~~dg~~e~ttyLf~y~~~~~~~psL-~~l~e~y~~~LP~y  190 (417)
                         ....+.      +.              ....| .|..+..                  .++ +++.+.+    +..
T Consensus       194 ---~~~~~~------~~--------------~~~~~-v~~~G~~------------------G~l~k~li~~~----~l~  227 (380)
T d2gmha1         194 ---TFERGL------EL--------------HAKVT-IFAEGCH------------------GHLAKQLYKKF----DLR  227 (380)
T ss_dssp             ---EEECCC------EE--------------ECSEE-EECCCTT------------------CHHHHHHHHHT----TTT
T ss_pred             ---cccccc------cc--------------cccEE-EEeeeCC------------------CcchHHHHhhh----hhc
Confidence               110011      10              12334 5544310                  122 2333222    111


Q ss_pred             cCCCCCccceEEeeeeecCCCCCCCCCCCCCCEEEEcCCCCCCCCccccchhHHHhhHHHHHHHHHHHHhCCCCChhhHh
Q 014843          191 QGVTLDNLEIQRVIYGIFPTYRDSPLPAAFNRILQFGDASGIQSPVSFGGFGSLTRHLGRLSTGVYEAVRGDFVDSYSLS  270 (417)
Q Consensus       191 ~g~~l~~~~~~~~~~G~~P~~~~~p~~~~~driLlvGDAAglvdPlSg~GfGs~lR~l~rla~gI~~AL~~~~lsa~~L~  270 (417)
                      ...       . +    ...+...| +..+++++++|||||++||++++||..+|.+.-.+|+.|.+||+.++.+++.++
T Consensus       228 ~~~-------~-~----~~G~~sip-~l~~~G~lLVGDAAG~vnP~~g~GI~~Am~SG~lAAeai~~al~~~~~~~~~~~  294 (380)
T d2gmha1         228 ANC-------E-P----QGGFQSIP-KLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIG  294 (380)
T ss_dssp             TTS-------C-C----CCGGGGCC-CCEETTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHTCCCCCCSSSS
T ss_pred             ccc-------c-c----cccccccc-ccccCCeeEEeccccccchhhcCCeeeeeccHHHHHHHHHHHHHcCCcccchhh
Confidence            111       0 1    11222233 567899999999999999999999999999977799999999999999999886


Q ss_pred             h-hcCCCccchHHHHHHhhccc
Q 014843          271 L-LNPYMPNLSASWLFQRAMSA  291 (417)
Q Consensus       271 ~-l~~Yq~nl~~~~~lqk~M~~  291 (417)
                      . +..|+..+.-||..+-+-.+
T Consensus       295 ~~~~~y~~~~~~s~~~~eL~~~  316 (380)
T d2gmha1         295 LHVTEYEDNLKNSWVWKELYSV  316 (380)
T ss_dssp             CCCTHHHHHHHTSHHHHHHHHT
T ss_pred             hhhhhHHHHHHhhHHHHHHHHh
Confidence            4 34677777778875544433
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure