Citrus Sinensis ID: 014938

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----

MPASKLSSCLAVAAAVASLSTASNRAFADAPSRFSFFSSSPQPTSSGNDEAEQTADAQKSREPEEPRGSGFDPEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKSVWCS

cccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHccccccHHcccccccccHHHHHHHHHHHccccc

ccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHccHHcccccccccHcccccEEccHHHHHHHHHHHHHHHHHHHcccccHEEEEccccccHHHHHHHHHHHHccccc

MPASKLSSCLAVAAAVASLSTasnrafadapsrfsffssspqptssgndeaeqtadaqksrepeeprgsgfdpEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNrilgqpsliressigkfpwsglLSQAMNKVIRnktsagtagpveaiknngdiilhpSLQRRIQHLAKATAntkihqapfrnmlfygppgtgktMVAREIARKSVWCS

MPASKLSSCLAVAAAVASLSTASNRAFADAPSRFSFFSSSPQPTSSGNDEAEQTAdaqksrepeeprgsgfdpEALERAAKALRefnssrhareaFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQaraqglrnedELARKRlqtdheaqrrhntelvkmqeessirkeqarrsteeqiqaqqrltekeraeierETIRVKAmaeaegraheakltedhnrRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATAntkihqapfrnMLFYGPPGTGKTMVAREIARKSVWCS

MPasklssclavaaavaslstasNRAFADApsrfsffssspqptssGNDEAEQTADAQKSREPEEPRGSGFDPealeraakalreFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKSVWCS

*********LAVAAAV***********************************************************************************************VEKVHYE***************************************************************************************************************************MLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIAR******

*********LAVAAAVAS*************************************************************************************************************************************************************************************************************************************************************LLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQA*********************NNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKSVWC*

**********AVAAAVASLSTASNRAFADAPSRFSFF*********************************FDPEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHR****************EDELARKRLQTDHEAQRRHNTEL********************************RAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKSVWCS

*********************************************************************GFDPEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKSVWCS

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPASKLSSCLAVAAAVASLSTASNRAFADAPSRFSFFSSSPQPTSSGNDEAEQTADAQKSREPEEPRGSGFDPEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERxxxxxxxxxxxxxxxxxxxxxGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSIRKEQAxxxxxxxxxxxxxxxxxxxxxxxxxTIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKSVWCS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		415	2.2.26 [Sep-21-2011]
Q6PAX2		593	ATPase family AAA domain-	N/A	no	0.768	0.537	0.343	4e-40
Q6NVR9		594	ATPase family AAA domain-	yes	no	0.727	0.508	0.344	1e-39
Q58E76		593	ATPase family AAA domain-	N/A	no	0.732	0.512	0.343	1e-39
Q20748		595	ATPase family AAA domain-	yes	no	0.749	0.522	0.354	6e-39
A7YWC4		586	ATPase family AAA domain-	yes	no	0.732	0.518	0.346	2e-37
Q5T9A4		648	ATPase family AAA domain-	yes	no	0.768	0.492	0.352	7e-37
Q3KRE0		591	ATPase family AAA domain-	yes	no	0.809	0.568	0.324	5e-36
Q925I1		591	ATPase family AAA domain-	yes	no	0.761	0.534	0.343	1e-35
Q9NVI7		634	ATPase family AAA domain-	no	no	0.751	0.492	0.293	6e-29
Q5T2N8		411	ATPase family AAA domain-	no	no	0.380	0.384	0.329	4e-20

>sp\|Q6PAX2\|ATD3B_XENLA ATPase family AAA domain-containing protein 3-B OS=Xenopus laevis GN=atad3-b PE=2 SV=1	Back alignment and function desciption

 Score =  166 bits (419), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 182/346 (52%), Gaps = 27/346 (7%)

Query: 69  SGFDPEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVER 128
           S FDP  LERAAKA RE + SRHA+EA ++ + QE+T   E   +   YEA   Q+  E+
Sbjct: 44  SNFDPTGLERAAKAARELDQSRHAKEALNLAKVQEETLQMEQQAKIKEYEAAVEQIKNEQ 103

Query: 129 QRKLAEEHRNLVQQKA---QARAQGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSI 185
            R  +EE R  + ++    QARAQ    +D+LAR+R +     Q+  N E ++ QEES  
Sbjct: 104 IRVQSEEKRKTLNEETKQHQARAQ---YQDKLARQRYEDQLRQQQLQNEENLRRQEESVQ 160

Query: 186 RKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIE 245
           ++E  R++T E              E+  +   ++  AEA  RA   +   D  R  +  
Sbjct: 161 KQEAMRKATVEH-----------EMELRHKNDMLRIEAEAHARAKVERENADIIREQIRL 209

Query: 246 RINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWG 305
           +    R+  L +I T  +   EG R+ ++D +K+  TV G T LA G+YT + G  V   
Sbjct: 210 KAAEHRQTVLESIKTAGTVFGEGFRTFISDWDKVTATVAGLTLLAVGVYTAKNGTGVAGR 269

Query: 306 YVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPS 365
           Y+   LG+PSL+R++S      +      ++K I +K      G          +IL P 
Sbjct: 270 YIEARLGKPSLVRDTSRITVVEAIKHPIKISKRIFSKIQDALEG----------VILSPR 319

Query: 366 LQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKS 411
           L+ R++ +A AT NTK ++  +RN+L YGPPGTGKT+ A+++A  S
Sbjct: 320 LEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHS 365

Xenopus laevis (taxid: 8355)

>sp\|Q6NVR9\|ATAD3_XENTR ATPase family AAA domain-containing protein 3 OS=Xenopus tropicalis GN=atad3 PE=2 SV=1	Back alignment and function description

>sp\|Q58E76\|ATD3A_XENLA ATPase family AAA domain-containing protein 3-A OS=Xenopus laevis GN=atad3-a PE=2 SV=1	Back alignment and function description

>sp\|Q20748\|ATAD3_CAEEL ATPase family AAA domain-containing protein 3 OS=Caenorhabditis elegans GN=atad-3 PE=3 SV=2	Back alignment and function description

>sp\|A7YWC4\|ATAD3_BOVIN ATPase family AAA domain-containing protein 3 OS=Bos taurus GN=ATAD3 PE=2 SV=1	Back alignment and function description

>sp\|Q5T9A4\|ATD3B_HUMAN ATPase family AAA domain-containing protein 3B OS=Homo sapiens GN=ATAD3B PE=1 SV=1	Back alignment and function description

>sp\|Q3KRE0\|ATAD3_RAT ATPase family AAA domain-containing protein 3 OS=Rattus norvegicus GN=Atad3 PE=1 SV=1	Back alignment and function description

>sp\|Q925I1\|ATAD3_MOUSE ATPase family AAA domain-containing protein 3 OS=Mus musculus GN=Atad3 PE=1 SV=1	Back alignment and function description

>sp\|Q9NVI7\|ATD3A_HUMAN ATPase family AAA domain-containing protein 3A OS=Homo sapiens GN=ATAD3A PE=1 SV=2	Back alignment and function description

>sp\|Q5T2N8\|ATD3C_HUMAN ATPase family AAA domain-containing protein 3C OS=Homo sapiens GN=ATAD3C PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		415
297735144		649	unnamed protein product [Vitis vinifera]	0.978	0.625	0.760	1e-164
225430736		627	PREDICTED: ATPase family AAA domain-cont	0.978	0.647	0.760	1e-164
224097014		633	predicted protein [Populus trichocarpa]	0.987	0.647	0.740	1e-164
356538198		631	PREDICTED: ATPase family AAA domain-cont	0.983	0.646	0.724	1e-164
255561118		626	Protein MSP1, putative [Ricinus communis	0.975	0.646	0.745	1e-161
356495406		626	PREDICTED: ATPase family AAA domain-cont	0.985	0.653	0.713	1e-159
449451537		626	PREDICTED: ATPase family AAA domain-cont	0.975	0.646	0.731	1e-158
18398708		636	AAA-type ATPase-like protein [Arabidopsi	0.968	0.632	0.705	1e-155
334187222		632	AAA-type ATPase family protein [Arabidop	0.978	0.642	0.688	1e-153
297832492		633	AAA-type ATPase family protein [Arabidop	0.978	0.641	0.703	1e-150

>gi\|297735144\|emb\|CBI17506.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 314/413 (76%), Positives = 353/413 (85%), Gaps = 7/413 (1%)

Query: 1   MPASKLSSCLAVAAAVASLSTASNRAFADAPSRFSFFSSSPQPTSSGNDEAEQTADAQKS 60
           M AS+LSSC+A+AAAVA  S AS+ A+AD P RFS FSSSP  TS  + E      ++  
Sbjct: 23  MAASRLSSCVAMAAAVAFFSKASSGAYADGPFRFSPFSSSPPQTSQSSVE-----KSEDK 77

Query: 61  REPEEPR--GSGFDPEALERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYE 118
            E +EPR   SGFDPE+LER AKALRE NSS +A++ F+IMRKQEQTRLAEL  EK H E
Sbjct: 78  SEADEPRVSSSGFDPESLERGAKALREINSSPNAKQVFEIMRKQEQTRLAELAAEKAHQE 137

Query: 119 AIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDELARKRLQTDHEAQRRHNTELVK 178
           AIQ+Q D+++QRK+AEE  NLVQQ+AQA+AQ LR EDELARKR+QTDHEAQRRHN ELVK
Sbjct: 138 AIQAQADIDKQRKMAEEQMNLVQQQAQAKAQMLRYEDELARKRMQTDHEAQRRHNVELVK 197

Query: 179 MQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDH 238
           MQEESSIRKEQARR+TEEQIQAQQR TEKERAEIERETIRVKAMAEAEGRAHEAKLTEDH
Sbjct: 198 MQEESSIRKEQARRATEEQIQAQQRQTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDH 257

Query: 239 NRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTRE 298
           NRRMLIER+NGEREKWLAAINT FSHIE G R LLTDRNKL+M +GGATA+AAG+YTTRE
Sbjct: 258 NRRMLIERMNGEREKWLAAINTMFSHIEGGFRVLLTDRNKLLMAIGGATAVAAGVYTTRE 317

Query: 299 GARVTWGYVNRILGQPSLIRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNG 358
           GARVTWGY+NRILGQPSLIRESSI KFPWSG++S+  NKV+   T+AG A P E   + G
Sbjct: 318 GARVTWGYINRILGQPSLIRESSIAKFPWSGMVSRGTNKVLNYSTAAGGARPGENKTSFG 377

Query: 359 DIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPPGTGKTMVAREIARKS 411
           +IILHPSLQRRI+HLA+AT+NTK HQAPFRNMLFYGPPGTGKTMVAREIARKS
Sbjct: 378 NIILHPSLQRRIEHLARATSNTKSHQAPFRNMLFYGPPGTGKTMVAREIARKS 430

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225430736\|ref\|XP_002266534.1\| PREDICTED: ATPase family AAA domain-containing protein 3-A [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224097014\|ref\|XP_002310811.1\| predicted protein [Populus trichocarpa] gi\|222853714\|gb\|EEE91261.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356538198\|ref\|XP_003537591.1\| PREDICTED: ATPase family AAA domain-containing protein 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|255561118\|ref\|XP_002521571.1\| Protein MSP1, putative [Ricinus communis] gi\|223539249\|gb\|EEF40842.1\| Protein MSP1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356495406\|ref\|XP_003516569.1\| PREDICTED: ATPase family AAA domain-containing protein 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|449451537\|ref\|XP_004143518.1\| PREDICTED: ATPase family AAA domain-containing protein 3-like [Cucumis sativus] gi\|449504882\|ref\|XP_004162321.1\| PREDICTED: ATPase family AAA domain-containing protein 3-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|18398708\|ref\|NP_565435.1\| AAA-type ATPase-like protein [Arabidopsis thaliana] gi\|15450828\|gb\|AAK96685.1\| putative AAA-type ATPase [Arabidopsis thaliana] gi\|20197813\|gb\|AAD15504.2\| putative AAA-type ATPase [Arabidopsis thaliana] gi\|20259834\|gb\|AAM13264.1\| putative AAA-type ATPase [Arabidopsis thaliana] gi\|330251663\|gb\|AEC06757.1\| AAA-type ATPase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334187222\|ref\|NP_195376.2\| AAA-type ATPase family protein [Arabidopsis thaliana] gi\|332661274\|gb\|AEE86674.1\| AAA-type ATPase family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297832492\|ref\|XP_002884128.1\| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297329968\|gb\|EFH60387.1\| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		415
TAIR\|locus:2062170		636	AT2G18330 [Arabidopsis thalian	0.927	0.605	0.676	1.6e-134
TAIR\|locus:2148206		644	AT5G16930 [Arabidopsis thalian	0.860	0.554	0.586	3.9e-108
TAIR\|locus:2097690		628	AT3G03060 [Arabidopsis thalian	0.850	0.562	0.582	4.9e-108
RGD\|1305964		591	Atad3a "ATPase family, AAA dom	0.812	0.570	0.339	4.2e-40
UNIPROTKB\|Q3KRE0		591	Atad3 "ATPase family AAA domai	0.812	0.570	0.339	4.2e-40
ZFIN\|ZDB-GENE-040426-1826		621	atad3b "ATPase family, AAA dom	0.775	0.518	0.34	5.2e-40
MGI\|MGI:1919214		591	Atad3a "ATPase family, AAA dom	0.812	0.570	0.339	6.8e-40
UNIPROTKB\|F1RJE4		593	LOC100525876 "Uncharacterized	0.787	0.551	0.344	8.7e-40
UNIPROTKB\|A7YWC4		586	ATAD3 "ATPase family AAA domai	0.809	0.573	0.335	2.3e-39
UNIPROTKB\|Q5T9A4		648	ATAD3B "ATPase family AAA doma	0.787	0.504	0.330	1.5e-38

TAIR\|locus:2062170 AT2G18330 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1318 (469.0 bits), Expect = 1.6e-134, P = 1.6e-134
 Identities = 263/389 (67%), Positives = 310/389 (79%)

Query:    24 NRAFADAXXXXXXXXXXXXXXXXGND-EAEQTADAQKSREPEEPRGSGFDPXXXXXXXXX 82
             NRA+AD+                  D ++   + ++   + +EP+GSGFDP         
Sbjct:    24 NRAYADSRFRFPFFSSSPPAEESPTDHKSSSNSKSETKPDSDEPKGSGFDPESLERGAKA 83

Query:    83 XXXFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQ 142
                 NSS H+++ FD+MRKQE+TRLAEL  EK H EAIQ+  D+ERQRKLAE+ RNLVQQ
Sbjct:    84 LREINSSPHSKQVFDLMRKQEKTRLAELAAEKEHNEAIQASKDIERQRKLAEDQRNLVQQ 143

Query:   143 KAQARAQGLRNEDELARKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQ 202
             +AQA+AQ LR EDELARKR+QTD+EAQRRHN ELV MQE SSIRKE+AR +TEEQIQAQQ
Sbjct:   144 QAQAKAQNLRYEDELARKRMQTDNEAQRRHNAELVSMQEASSIRKEKARIATEEQIQAQQ 203

Query:   203 RLTEKERAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTF 262
             R TEKERAE+ERETIRVKAMAEAEGRAHEAKLTE+ NRRML+++INGEREKWLAAINTTF
Sbjct:   204 RETEKERAELERETIRVKAMAEAEGRAHEAKLTEEQNRRMLLDKINGEREKWLAAINTTF 263

Query:   263 SHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIRESSI 322
             SHIE GVR+LLTDR+KL+MTVGG TALAAG+YTTREGARVTWGY+NRILGQPSLIRESS+
Sbjct:   264 SHIEGGVRTLLTDRSKLIMTVGGVTALAAGVYTTREGARVTWGYINRILGQPSLIRESSM 323

Query:   323 GKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKI 382
             G+FPW+G +SQ  NK+    T+AG A   E  K   ++ILH SL+ RI+ LA+ATANTK 
Sbjct:   324 GRFPWAGSVSQFKNKL---STAAGAAASAEGEKPLENVILHRSLKTRIERLARATANTKS 380

Query:   383 HQAPFRNMLFYGPPGTGKTMVAREIARKS 411
             H+APFRNM+FYGPPGTGKTMVAREIARKS
Sbjct:   381 HKAPFRNMMFYGPPGTGKTMVAREIARKS 409

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005886 "plasma membrane" evidence=ISM

GO:0016887 "ATPase activity" evidence=ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0000741 "karyogamy" evidence=RCA

GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA

GO:0009560 "embryo sac egg cell differentiation" evidence=RCA

GO:0009909 "regulation of flower development" evidence=RCA

GO:0034968 "histone lysine methylation" evidence=RCA

GO:0005739 "mitochondrion" evidence=IDA

TAIR\|locus:2148206 AT5G16930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2097690 AT3G03060 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

RGD\|1305964 Atad3a "ATPase family, AAA domain containing 3A" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3KRE0 Atad3 "ATPase family AAA domain-containing protein 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1826 atad3b "ATPase family, AAA domain containing 3B" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1919214 Atad3a "ATPase family, AAA domain containing 3A" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RJE4 LOC100525876 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|A7YWC4 ATAD3 "ATPase family AAA domain-containing protein 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5T9A4 ATAD3B "ATPase family AAA domain-containing protein 3B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00024916001	SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (627 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00034559001	SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (840 aa)	•	0.420

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		415
pfam12037		276	pfam12037, DUF3523, Domain of unknown function (DU	1e-108
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	1e-07
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	1e-06
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	7e-06
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	3e-05
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	1e-04
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	3e-04
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	5e-04
pfam01078		207	pfam01078, Mg_chelatase, Magnesium chelatase, subu	7e-04
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	7e-04
smart00382		148	smart00382, AAA, ATPases associated with a variety	9e-04
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	0.002
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.002
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.003
PRK13341		725	PRK13341, PRK13341, recombination factor protein R	0.003
TIGR02397		355	TIGR02397, dnaX_nterm, DNA polymerase III, subunit	0.003
pfam07227		446	pfam07227, DUF1423, Protein of unknown function (D	0.003

>gnl\|CDD\|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523)	Back alignment and domain information

 Score =  319 bits (819), Expect = e-108
 Identities = 149/280 (53%), Positives = 185/280 (66%), Gaps = 4/280 (1%)

Query: 39  SSPQPTSSGNDEAEQTADAQKSREPEEPRGSGFDPEALERAAKALREFNSSRHAREAFDI 98
            SP  ++ G D        +          SGFDP ALER AKALRE  SS HA++AF++
Sbjct: 1   PSPPASAGGGDRK----GKRTRNNGPATIASGFDPTALERGAKALRELESSPHAKKAFEL 56

Query: 99  MRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDELA 158
            + QE+TR AEL+ +   YEA Q+Q  +ER R  AEE R  +Q++ Q   Q  + +DELA
Sbjct: 57  SKMQEKTRQAELEAKIKEYEAQQAQAKLERARVEAEERRKTLQEQTQQEQQRAQYQDELA 116

Query: 159 RKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIR 218
           RKR Q + E QRR N EL+KMQEES +R+E  RR+TEE+I   +R T +E AE+ERE IR
Sbjct: 117 RKRYQKELEQQRRQNEELLKMQEESVLRQEAMRRATEEEILEMRRETIEEEAELERENIR 176

Query: 219 VKAMAEAEGRAHEAKLTEDHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNK 278
            K  AEA GRA E +  ED NR ML  + N ERE  L +I TTFSHI  G R+LLTD++K
Sbjct: 177 AKIEAEARGRAKEERENEDINREMLKLKANEERETVLESIKTTFSHIGGGFRALLTDKSK 236

Query: 279 LVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSLIR 318
           L MTVGG TALAAGIYT +EG RVTW Y+ R LG+PSLIR
Sbjct: 237 LTMTVGGLTALAAGIYTAKEGTRVTWRYIERRLGKPSLIR 276

This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with pfam00004. This domain has a conserved LER sequence motif. Length = 276

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|233847 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>gnl\|CDD\|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		415
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	100.0
PF12037		276	DUF3523: Domain of unknown function (DUF3523); Int	100.0
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.96
PF12037		276	DUF3523: Domain of unknown function (DUF3523); Int	99.83
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.47
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.35
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.29
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.28
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.21
PRK10865		857	protein disaggregation chaperone; Provisional	99.16
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.13
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.09
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	99.05
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.02
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	98.96
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	98.96
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	98.95
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	98.95
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	98.92
PRK03992		389	proteasome-activating nucleotidase; Provisional	98.89
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	98.87
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	98.84
KOG0736		953	consensus Peroxisome assembly factor 2 containing	98.83
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	98.83
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	98.82
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	98.82
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	98.81
CHL00195		489	ycf46 Ycf46; Provisional	98.8
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	98.76
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	98.74
CHL00176		638	ftsH cell division protein; Validated	98.73
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	98.72
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	98.72
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	98.71
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	98.7
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.67
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	98.66
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.64
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	98.62
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	98.62
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	98.6
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	98.6
PRK04195		482	replication factor C large subunit; Provisional	98.58
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	98.54
PLN03025		319	replication factor C subunit; Provisional	98.54
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	98.54
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	98.53
CHL00181		287	cbbX CbbX; Provisional	98.52
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	98.45
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	98.43
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	98.41
PRK06620		214	hypothetical protein; Validated	98.4
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	98.39
PRK12402		337	replication factor C small subunit 2; Reviewed	98.38
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	98.38
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	98.37
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	98.37
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	98.37
PRK06893		229	DNA replication initiation factor; Validated	98.35
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	98.34
PRK13342		413	recombination factor protein RarA; Reviewed	98.33
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	98.33
PRK06526		254	transposase; Provisional	98.31
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	98.3
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	98.29
PRK08084		235	DNA replication initiation factor; Provisional	98.29
PRK08181		269	transposase; Validated	98.28
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	98.28
PHA02544		316	44 clamp loader, small subunit; Provisional	98.28
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	98.27
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	98.26
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	98.26
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	98.25
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	98.25
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	98.23
COG0606		490	Predicted ATPase with chaperone activity [Posttran	98.23
PRK08903		227	DnaA regulatory inactivator Hda; Validated	98.22
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	98.22
CHL00095		821	clpC Clp protease ATP binding subunit	98.22
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	98.21
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	98.21
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	98.2
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	98.2
CHL00206		2281	ycf2 Ycf2; Provisional	98.2
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	98.2
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.2
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	98.19
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	98.19
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	98.19
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	98.19
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	98.18
PRK13341		725	recombination factor protein RarA/unknown domain f	98.18
KOG2028		554	consensus ATPase related to the helicase subunit o	98.18
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	98.18
PRK08116		268	hypothetical protein; Validated	98.17
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	98.17
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	98.17
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	98.17
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.16
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	98.14
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	98.14
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	98.14
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	98.14
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	98.14
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	98.12
PRK12377		248	putative replication protein; Provisional	98.11
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	98.11
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.11
PRK14088		440	dnaA chromosomal replication initiation protein; P	98.11
PRK00440		319	rfc replication factor C small subunit; Reviewed	98.11
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	98.1
PRK00149		450	dnaA chromosomal replication initiation protein; R	98.09
PRK09183		259	transposase/IS protein; Provisional	98.08
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	98.07
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	98.07
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	98.07
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	98.06
PRK12422		445	chromosomal replication initiation protein; Provis	98.04
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	98.04
PRK05642		234	DNA replication initiation factor; Validated	98.04
PRK08939		306	primosomal protein DnaI; Reviewed	98.03
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.03
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	98.03
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	98.03
PRK08727		233	hypothetical protein; Validated	98.01
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	98.01
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	98.01
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.01
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	98.0
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	97.99
PRK07952		244	DNA replication protein DnaC; Validated	97.98
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.96
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	97.95
PHA02244		383	ATPase-like protein	97.95
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.95
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	97.9
PRK06835		329	DNA replication protein DnaC; Validated	97.87
PRK09087		226	hypothetical protein; Validated	97.86
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	97.86
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	97.85
PRK06921		266	hypothetical protein; Provisional	97.85
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	97.83
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	97.81
PRK13531		498	regulatory ATPase RavA; Provisional	97.79
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	97.79
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	97.77
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	97.75
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	97.75
PRK14087		450	dnaA chromosomal replication initiation protein; P	97.72
PRK14086		617	dnaA chromosomal replication initiation protein; P	97.71
PRK07471		365	DNA polymerase III subunit delta'; Validated	97.71
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	97.69
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	97.69
PRK10865		857	protein disaggregation chaperone; Provisional	97.67
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	97.65
CHL00095		821	clpC Clp protease ATP binding subunit	97.63
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	97.6
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.6
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	97.6
PRK09112		351	DNA polymerase III subunit delta'; Validated	97.59
PRK13765		637	ATP-dependent protease Lon; Provisional	97.58
PRK00411		394	cdc6 cell division control protein 6; Reviewed	97.58
PRK15455		644	PrkA family serine protein kinase; Provisional	97.57
COG0714		329	MoxR-like ATPases [General function prediction onl	97.56
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	97.55
COG0593		408	DnaA ATPase involved in DNA replication initiation	97.53
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	97.51
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	97.49
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	97.47
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	97.41
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	97.36
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	97.28
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	97.28
PLN02200		234	adenylate kinase family protein	97.25
PTZ00121		2084	MAEBL; Provisional	97.2
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	97.18
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	97.17
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	97.15
KOG1969		877	consensus DNA replication checkpoint protein CHL12	97.13
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	97.09
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	97.07
PHA02624		647	large T antigen; Provisional	97.05
PHA02774		613	E1; Provisional	97.0
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	96.99
PF13245		76	AAA_19: Part of AAA domain	96.98
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	96.98
COG1855		604	ATPase (PilT family) [General function prediction	96.97
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	96.84
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	96.71
PTZ00112		1164	origin recognition complex 1 protein; Provisional	96.6
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	96.56
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	96.56
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	96.55
PLN02199		303	shikimate kinase	96.53
PRK10536		262	hypothetical protein; Provisional	96.5
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	96.45
PRK13764		602	ATPase; Provisional	96.44
PTZ00202		550	tuzin; Provisional	96.43
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	96.37
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.37
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	96.35
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.34
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	96.31
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	96.3
smart00350		509	MCM minichromosome maintenance proteins.	96.21
PRK04220		301	2-phosphoglycerate kinase; Provisional	96.21
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	96.19
TIGR00376		637	DNA helicase, putative. The gene product may repre	96.19
PRK09862		506	putative ATP-dependent protease; Provisional	96.18
PRK08099		399	bifunctional DNA-binding transcriptional repressor	96.18
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	96.17
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	96.17
PLN02165		334	adenylate isopentenyltransferase	96.16
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	96.12
PRK15424		538	propionate catabolism operon regulatory protein Pr	96.12
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	96.06
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	96.04
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.01
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	96.0
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	95.97
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	95.93
TIGR01526		325	nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr	95.89
PRK04132		846	replication factor C small subunit; Provisional	95.89
KOG0736		953	consensus Peroxisome assembly factor 2 containing	95.88
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	95.85
PRK05022		509	anaerobic nitric oxide reductase transcription reg	95.83
PRK12337		475	2-phosphoglycerate kinase; Provisional	95.81
KOG2170		344	consensus ATPase of the AAA+ superfamily [General	95.8
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	95.78
TIGR00064		272	ftsY signal recognition particle-docking protein F	95.76
PRK13851		344	type IV secretion system protein VirB11; Provision	95.71
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	95.7
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	95.69
PRK13833		323	conjugal transfer protein TrbB; Provisional	95.65
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	95.63
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	95.61
PRK10646		153	ADP-binding protein; Provisional	95.6
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	95.59
TIGR02236		310	recomb_radA DNA repair and recombination protein R	95.57
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	95.56
PRK13477		512	bifunctional pantoate ligase/cytidylate kinase; Pr	95.54
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	95.5
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	95.5
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	95.49
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	95.48
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	95.36
PRK10416		318	signal recognition particle-docking protein FtsY;	95.35
COG1221		403	PspF Transcriptional regulators containing an AAA-	95.35
PF00519		432	PPV_E1_C: Papillomavirus helicase; InterPro: IPR00	95.31
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	95.29
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	95.27
PLN03210		1153	Resistant to P. syringae 6; Provisional	95.25
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	95.24
COG2074		299	2-phosphoglycerate kinase [Carbohydrate transport	95.23
PRK05973		237	replicative DNA helicase; Provisional	95.22
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	95.19
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	95.14
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	95.1
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	95.08
PRK12608		380	transcription termination factor Rho; Provisional	95.06
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	95.06
PRK05439		311	pantothenate kinase; Provisional	95.04
PRK09376		416	rho transcription termination factor Rho; Provisio	95.02
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	95.0
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	94.98
PRK04301		317	radA DNA repair and recombination protein RadA; Va	94.96
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	94.95
PRK14974		336	cell division protein FtsY; Provisional	94.94
TIGR02533		486	type_II_gspE general secretory pathway protein E.	94.88
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	94.85
cd00983		325	recA RecA is a bacterial enzyme which has roles in	94.83
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.83
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	94.83
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	94.82
cd03234		226	ABCG_White The White subfamily represents ABC tran	94.8
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	94.64
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	94.61
KOG1803		649	consensus DNA helicase [Replication, recombination	94.6
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	94.59
PRK10867		433	signal recognition particle protein; Provisional	94.57
PTZ00035		337	Rad51 protein; Provisional	94.55
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	94.52
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	94.48
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	94.47
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	94.47
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	94.46
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	94.45
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	94.45
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	94.44
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	94.41
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	94.4
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	94.39
PLN02348		395	phosphoribulokinase	94.38
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	94.35
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	94.34
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	94.34
PRK11823		446	DNA repair protein RadA; Provisional	94.31
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	94.31
KOG0060		659	consensus Long-chain acyl-CoA transporter, ABC sup	94.29
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	94.29
PRK10436		462	hypothetical protein; Provisional	94.29
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	94.28
COG4178		604	ABC-type uncharacterized transport system, permeas	94.28
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	94.26
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	94.25
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	94.25
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	94.23
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	94.2
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	94.19
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	94.15
PF13555		62	AAA_29: P-loop containing region of AAA domain	94.15
TIGR00767		415	rho transcription termination factor Rho. Members	94.13
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	94.12
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	94.11
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	94.09
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	94.08
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	94.07
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	94.06
TIGR00959		428	ffh signal recognition particle protein. This mode	94.05
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	94.04
PRK13546		264	teichoic acids export protein ATP-binding subunit;	94.03
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	94.03
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	94.03
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	94.0
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	94.0
PF01057		271	Parvo_NS1: Parvovirus non-structural protein NS1;	93.98
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	93.98
COG0802		149	Predicted ATPase or kinase [General function predi	93.97
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	93.96
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	93.94
PRK06851		367	hypothetical protein; Provisional	93.94
PRK09354		349	recA recombinase A; Provisional	93.94
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	93.93
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	93.9
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	93.89
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	93.85
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	93.84
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	93.83
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	93.81
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	93.8
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	93.79
PRK12269		863	bifunctional cytidylate kinase/ribosomal protein S	93.79
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	93.77
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	93.73
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	93.68
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	93.66
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	93.66
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	93.65
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	93.58
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	93.57
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	93.57
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	93.52
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	93.5
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	93.48
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	93.43
PRK09435		332	membrane ATPase/protein kinase; Provisional	93.41
PRK11860		661	bifunctional 3-phosphoshikimate 1-carboxyvinyltran	93.41
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	93.35
KOG2383		467	consensus Predicted ATPase [General function predi	93.34
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	93.34
PLN02796		347	D-glycerate 3-kinase	93.33
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	93.33
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	93.32
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	93.32
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	93.31
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	93.25
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	93.24
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	93.2
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	93.19
PRK10875		615	recD exonuclease V subunit alpha; Provisional	93.16
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	93.15
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	93.15
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	93.12
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	93.03
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	93.01
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	92.99
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	92.94
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	92.91
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	92.91
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	92.9
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	92.9
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	92.88
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	92.86
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	92.82
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	92.82
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	92.79
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	92.76
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	92.76
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	92.75
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	92.72
COG1485		367	Predicted ATPase [General function prediction only	92.7
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	92.64
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	92.6
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	92.51
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	92.46
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	92.45
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	92.44
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	92.44
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	92.43
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	92.4
PRK11519		719	tyrosine kinase; Provisional	92.4
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	92.37
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	92.34
PRK13537		306	nodulation ABC transporter NodI; Provisional	92.29
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	92.24
PLN02318		656	phosphoribulokinase/uridine kinase	92.24
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	92.22
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	92.1
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	92.06
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	92.05
PF06431		417	Polyoma_lg_T_C: Polyomavirus large T antigen C-ter	92.02
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	92.01
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	91.95
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	91.94
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	91.94
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	91.9
PRK09302		509	circadian clock protein KaiC; Reviewed	91.83
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	91.82
PRK12678		672	transcription termination factor Rho; Provisional	91.79
KOG3928		461	consensus Mitochondrial ribosome small subunit com	91.7
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	91.66
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	91.62
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	91.58
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	91.55
PRK13536		340	nodulation factor exporter subunit NodI; Provision	91.52
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	91.49
KOG0064		728	consensus Peroxisomal long-chain acyl-CoA transpor	91.37
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	91.29
KOG0979		1072	consensus Structural maintenance of chromosome pro	91.25
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	91.23
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	91.23
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	91.13
PRK15064		530	ABC transporter ATP-binding protein; Provisional	91.11
PF02456		369	Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR	91.11
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	91.01
PRK10522		547	multidrug transporter membrane component/ATP-bindi	90.98
KOG1433		326	consensus DNA repair protein RAD51/RHP55 [Replicat	90.82
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	90.8
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	90.74
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	90.71
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	90.71
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	90.64
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	90.63
PLN03140		1470	ABC transporter G family member; Provisional	90.63
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	90.6
PRK11147		635	ABC transporter ATPase component; Reviewed	90.48
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	90.48
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	90.45
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	90.42
PRK10261		623	glutathione transporter ATP-binding protein; Provi	90.39
COG2204		464	AtoC Response regulator containing CheY-like recei	90.36
COG4778		235	PhnL ABC-type phosphonate transport system, ATPase	90.34
PLN03073		718	ABC transporter F family; Provisional	90.27
TIGR03238		504	dnd_assoc_3 dnd system-associated protein 3. cereu	90.27
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	90.26
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	90.23
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	90.14
PRK10938		490	putative molybdenum transport ATP-binding protein	90.07
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	90.06
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	90.0
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	89.96
PRK10535		648	macrolide transporter ATP-binding /permease protei	89.92
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	89.88
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	89.88
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	89.88
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	89.85
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	89.67
PLN03046		460	D-glycerate 3-kinase; Provisional	89.63
PLN03073		718	ABC transporter F family; Provisional	89.59
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	89.57
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	89.5
PRK15115		444	response regulator GlrR; Provisional	89.47
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	89.43
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	89.39
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	89.32
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	89.32
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	89.3
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	89.28
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	89.19
PRK09519		790	recA DNA recombination protein RecA; Reviewed	89.11
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	89.09
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	89.0
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	88.98
PTZ00491		850	major vault protein; Provisional	88.98
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	88.97
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	88.94
PRK10261		623	glutathione transporter ATP-binding protein; Provi	88.92
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	88.89
PRK00098		298	GTPase RsgA; Reviewed	88.86
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	88.82
PF05272		198	VirE: Virulence-associated protein E; InterPro: IP	88.82
PRK13889		988	conjugal transfer relaxase TraA; Provisional	88.67
TIGR01613		304	primase_Cterm phage/plasmid primase, P4 family, C-	88.6
COG4987		573	CydC ABC-type transport system involved in cytochr	88.6
cd01134		369	V_A-ATPase_A V/A-type ATP synthase catalytic subun	88.54
TIGR00665		434	DnaB replicative DNA helicase. This model describe	88.44
PRK06002		450	fliI flagellum-specific ATP synthase; Validated	88.25
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	88.25
PLN02772		398	guanylate kinase	88.14

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=6.1e-100  Score=752.19  Aligned_cols=407  Identities=56%  Similarity=0.764  Sum_probs=361.2

Q ss_pred             CcccchhhhHHHHHHHHHhhhhhhccccCCCCcCCCCCCCCCCCCCC--CC-chhhhhhhcCCC-CCCCCCCCCCCchhh
Q 014938            1 MPASKLSSCLAVAAAVASLSTASNRAFADAPSRFSFFSSSPQPTSSG--ND-EAEQTADAQKSR-EPEEPRGSGFDPEAL   76 (415)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~--~~-~~~~~~~~~~~~-~~~~~~~~~fdp~~l   76 (415)
                      ||+.+.+  .+.++.+++...+-+.+|+||+|.|++||++|++|-||  |+ |++........| +++...+++|||++|
T Consensus         1 Ma~kc~a--~~i~a~~~S~~~~~nka~ad~~f~~~~fs~sp~~~~pp~~~~~~~s~~~~~~~~p~~~Pk~~~~gFDpeaL   78 (630)
T KOG0742|consen    1 MAQKCAA--GSISALAMSWLFGINKAYADSRFGFPGFSASPPPPLPPAQPGAPGSGDRGEGDRPDPAPKDSWSGFDPEAL   78 (630)
T ss_pred             CchhHHH--HHHHHHHHHHHhccchhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCCCccccccCCChHHH
Confidence            6665333  33344444445555669999999999998876654333  22 222111111111 223344789999999


Q ss_pred             cHHHHHHHHHhcCcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHH
Q 014938           77 ERAAKALREFNSSRHAREAFDIMRKQEQTRLAELDVEKVHYEAIQSQVDVERQRKLAEEHRNLVQQKAQARAQGLRNEDE  156 (415)
Q Consensus        77 er~aka~r~l~~s~~a~~~~~~~~~qe~t~q~e~~~~~~e~~~~~~~~~~~~~~~~~ee~r~~~~~~~~~~~~~a~y~D~  156 (415)
                      ||||||||+||.|||||++|+|+++||+|+|.|++++.++|++++++.+++++|+.+||+||++++|+++++|+++|+|+
T Consensus        79 ERaAKAlrein~s~~aK~vfel~r~qE~Trq~E~~~k~~~~eA~qa~~~~er~r~~~Ee~rk~lq~qaq~k~q~arYqD~  158 (630)
T KOG0742|consen   79 ERAAKALREINHSPYAKDVFELARMQEQTRQAEQQAKTKEYEAAQAQLKSERIRVQAEERRKTLQEETQQKQQRARYQDK  158 (630)
T ss_pred             HHHHHHHHhhccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhchHHHHhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHhhh
Q 014938          157 LARKRLQTDHEAQRRHNTELVKMQEESSIRKEQARRSTEEQIQAQQRLTEKERAEIERETIRVKAMAEAEGRAHEAKLTE  236 (415)
Q Consensus       157 L~rkr~q~ele~~~~~~e~~~~~qees~~rqE~~r~~~e~~~~~~r~~~e~e~~~l~~~~~~~k~~ae~~~r~~~~r~n~  236 (415)
                      |+||||+++++.|+..|+++|++||+|++|||++|+.|+++|++++++||.++++++++|++.|+++|++||+|+++.|+
T Consensus       159 larkr~~~e~e~qr~~n~ElvrmQEeS~irqE~aRraTeE~iqaqrr~tE~erae~EretiRvkA~Aeaegraheakl~e  238 (630)
T KOG0742|consen  159 LARKRYEDELEAQRRLNEELVRMQEESVIRQEQARRATEEQIQAQRRKTEMERAEAERETIRVKAKAEAEGRAHEAKLNE  238 (630)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHhHHHHHHHHHHHHhHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHhhhcchhhhhhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHhhhhHHHHHhhhhhhhhhHHHHHHhhccccceeeeecccceeeeceecccchhhhhhhHHHHHhCCCcc
Q 014938          237 DHNRRMLIERINGEREKWLAAINTTFSHIEEGVRSLLTDRNKLVMTVGGATALAAGIYTTREGARVTWGYVNRILGQPSL  316 (415)
Q Consensus       237 dl~le~i~~ka~e~r~~~le~ik~~~~~lg~gl~all~D~~klv~~v~g~t~Lavgvytak~~~~v~~~~ve~~Lg~psl  316 (415)
                      |++++||+.+++++|++|++.|+++|++||+|++.+|+|++|++++|||+++|++|+||+++|+.|+|+||+++||+|||
T Consensus       239 dvnrr~l~~~~n~eRekwl~aInTtf~higgG~r~~ltD~~Kli~tVgGlTaLAaGvYTtkeg~~V~w~yi~r~LGqPSL  318 (630)
T KOG0742|consen  239 DVNRRQLRLKANEEREKWLEAINTTFTHIGGGLRAFLTDWNKLIATVGGLTALAAGVYTTKEGTLVTWRYIERRLGQPSL  318 (630)
T ss_pred             HHHHHHHHHHhhhHHHHHHHHHhhhHHHhhhHHHHHhhhhHhHHHHhhhHHHHHhhheeccccchhHHHHHHHHcCCchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcccCCCCccchhHHHHHHHhhhcccCCCCCCccccCCCccccCChhHHHHHHHHHHHHHhhhhhcCCCccEEEecCC
Q 014938          317 IRESSIGKFPWSGLLSQAMNKVIRNKTSAGTAGPVEAIKNNGDIILHPSLQRRIQHLAKATANTKIHQAPFRNMLFYGPP  396 (415)
Q Consensus       317 vRetsr~~~p~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~ddvv~~~~l~~~l~~l~~~~~~~k~~~~p~r~vLl~GPP  396 (415)
                      |||+||..|||.+.++...+.+-.     ...........|++||++|.+..+|++|+..+.|++.|..|+|||||||||
T Consensus       319 iREsSrg~~pw~gsls~~k~~i~~-----~~~~s~~gk~pl~~ViL~psLe~Rie~lA~aTaNTK~h~apfRNilfyGPP  393 (630)
T KOG0742|consen  319 IRESSRGRFPWIGSLSALKHPIQG-----SRSASSRGKDPLEGVILHPSLEKRIEDLAIATANTKKHQAPFRNILFYGPP  393 (630)
T ss_pred             hhhhccccCCCcccHHHHhchhhh-----hHhhhhcCCCCcCCeecCHHHHHHHHHHHHHhcccccccchhhheeeeCCC
Confidence            999999999999988776655511     011122334569999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHHHHHHHhCCC
Q 014938          397 GTGKTMVAREIARKSVWC  414 (415)
Q Consensus       397 GTGKT~lAkaLA~~lg~~  414 (415)
                      ||||||+|+-||.++|||
T Consensus       394 GTGKTm~ArelAr~SGlD  411 (630)
T KOG0742|consen  394 GTGKTMFARELARHSGLD  411 (630)
T ss_pred             CCCchHHHHHHHhhcCCc
Confidence            999999999999999998

>PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>PHA02774 E1; Provisional	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PLN02199 shikimate kinase	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only]	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK10646 ADP-binding protein; Provisional	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG0802 Predicted ATPase or kinase [General function prediction only]	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG2383 consensus Predicted ATPase [General function prediction only]	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1485 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PF06431 Polyoma_lg_T_C: Polyomavirus large T antigen C-terminus; InterPro: IPR010932 The group of polyomaviruses is formed by the homonymous murine virus (Py) as well as other representative members such as the simian virus 40 (SV40) and the human BK and JC viruses []	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK12678 transcription termination factor Rho; Provisional	Back alignment and domain information

>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism]	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>KOG1433 consensus DNA repair protein RAD51/RHP55 [Replication, recombination and repair]	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PTZ00491 major vault protein; Provisional	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK06002 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

Homologous Structure Templates