Citrus Sinensis ID: 015010


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MGLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE
cccccccEEEEEEccccccEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEccccccccccHHHHHHHHcccccccccccccccccEEEEcccccccEEEEEEEEccccHHHHHHHHHHHHccEEEEEEEEEEcccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEcccccccccccEEccEEEEcccccccHHHHHHHHHHccEEEEEEEEEEEEEEccEEEEEEEEEcccccccccHHHHHHHHHHHHcccc
cccccccEEEEEccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHcccHccccccccccHccccccccccHHHEEEEcccccccHHHHHHHHHHHcccEEEEEEEEEcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEcccccccEEEEEEEccccccHHHHHHHHHHccEEEEEEEEEEcccccEEEEEEEEEccccEcccHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEccEEEcccccccHHHHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHcccc
MGLMYEDVVVISqaekpgdctvitvncpdktglgcdLCRIILLFGLsisrgdlskdgkwcYLVFWVVGKPTTRWSLLKNrllevcpsyfstSRIYSYrlenqqqpkppdvflLKFWCfqdrkgllHDVTEVLCELELTIKRVkvsttpdgrvmdLFFITDTRELLHTRKRREETIHHLEAVLGKTLISceielpgpeitacchgssflpsaitdemfslelpaeqpngflasapvsiavdnsfspshTLIQILGQDHKGLIYDMMRTLKDYNtqvsygrffakprgncevdLFIMqadgkkivdpskqDALCSRLRMELLRPLRVAVVnrgpdaellvanpvelsgrgrplvFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDeadgnleprnKIEDLVRKILMGWE
MGLMYEDVVVIsqaekpgdctVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTikrvkvsttpdgrvmdlffITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQAdgkkivdpsKQDALCSRLRMELLRPLRVAVVnrgpdaellvanpvelsgrgRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLdeadgnleprnkiEDLVRKILMGWE
MGLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE
***MYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLEN******PDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILM***
****YEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVC************************VFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCE*****************************************SAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLR************AELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGW*
MGLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE
*GLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQ***F*ASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q5FPT6949 [Protein-PII] uridylyltra yes no 0.432 0.188 0.258 5e-06
Q8RQD1933 [Protein-PII] uridylyltra yes no 0.210 0.093 0.3 0.0003
Q2RNG2936 [Protein-PII] uridylyltra yes no 0.178 0.079 0.363 0.0007
>sp|Q5FPT6|GLND_GLUOX [Protein-PII] uridylyltransferase OS=Gluconobacter oxydans (strain 621H) GN=glnD PE=3 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 85/213 (39%), Gaps = 34/213 (15%)

Query: 120 DRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHL- 178
           D  GL   +   L     +I   ++ T  DG  +D F++ D          +   ++HL 
Sbjct: 764 DHPGLFSQIAGALAVSGASIVDARIHTLSDGMALDTFWVQDGEGCSFEEPHQLGRLNHLV 823

Query: 179 -EAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSI 237
            +A+ G+  I   IE       A  H +S    AI                     P  +
Sbjct: 824 EQALSGRLDIRKGIE------DASHHSTSRRMRAI-------------------HVPPRV 858

Query: 238 AVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLF-IMQ 296
            +DN+ S  HT+I++ G+D  GL++D+   L   + Q+S         G   VD+F +  
Sbjct: 859 VIDNTASDRHTVIEVNGRDRPGLLHDVTSALSSASLQISSAHITTY--GMRAVDVFYVRD 916

Query: 297 ADGKKIVDPSKQDALCSRLRMELLRPLRVAVVN 329
             G KI DP +     +RLR  LL  L  A V 
Sbjct: 917 LLGMKITDPVR----LARLRETLLASLTSAPVT 945




Modifies, by uridylylation or deuridylylation the PII (GlnB) regulatory protein.
Gluconobacter oxydans (strain 621H) (taxid: 290633)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 5EC: 9
>sp|Q8RQD1|GLND_AZOBR [Protein-PII] uridylyltransferase OS=Azospirillum brasilense GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q2RNG2|GLND_RHORT [Protein-PII] uridylyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=glnD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
255585359413 amino acid binding protein, putative [Ri 0.997 1.0 0.799 0.0
224109832411 predicted protein [Populus trichocarpa] 0.992 1.0 0.787 0.0
224100729412 predicted protein [Populus trichocarpa] 0.995 1.0 0.777 0.0
225448926416 PREDICTED: uncharacterized protein LOC10 1.0 0.995 0.757 0.0
225448928416 PREDICTED: uncharacterized protein LOC10 0.997 0.992 0.734 1e-175
449449320412 PREDICTED: uncharacterized protein LOC10 0.995 1.0 0.731 1e-173
356572480412 PREDICTED: uncharacterized protein LOC10 0.995 1.0 0.727 1e-172
225441177411 PREDICTED: uncharacterized protein LOC10 0.990 0.997 0.715 1e-170
356548347412 PREDICTED: uncharacterized protein LOC10 0.995 1.0 0.712 1e-169
356533259411 PREDICTED: uncharacterized protein LOC10 0.992 1.0 0.714 1e-168
>gi|255585359|ref|XP_002533376.1| amino acid binding protein, putative [Ricinus communis] gi|223526783|gb|EEF29007.1| amino acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/414 (79%), Positives = 366/414 (88%), Gaps = 1/414 (0%)

Query: 1   MGLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWC 60
           MG++YEDVVVISQAEKPGD TVITVNCPDKTGLGCDLCRIILLFGLSISRGDL  DGKWC
Sbjct: 1   MGMLYEDVVVISQAEKPGDSTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLQTDGKWC 60

Query: 61  YLVFWVVGKPTTRWSLLKNRLLEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQD 120
           Y+V WVVGKP+TRWSLLK RLLEVCPSYFSTS I  YR ++QQ PK PDVFLLKFWC  D
Sbjct: 61  YIVLWVVGKPSTRWSLLKMRLLEVCPSYFSTSEISYYRPKDQQ-PKKPDVFLLKFWCSYD 119

Query: 121 RKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEA 180
           R+GLLHDVTEVLCELELTIKRVKVST PDGRVMDLFFITDTRELLHT+ R+EETIH+L+ 
Sbjct: 120 REGLLHDVTEVLCELELTIKRVKVSTAPDGRVMDLFFITDTRELLHTKHRQEETIHYLKD 179

Query: 181 VLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVD 240
           VLG  LISCEIE  G E+TAC  GSS LPSAIT++MF++ELP +Q  GFL   PVS+++D
Sbjct: 180 VLGDALISCEIESAGAEVTACSQGSSLLPSAITEDMFNMELPDKQRKGFLTPNPVSVSMD 239

Query: 241 NSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQADGK 300
           N+ S SHTL+Q L +DHKGL+YD+MRTLKDYN Q+SYGRF+A P+G+CEVDLFIMQADGK
Sbjct: 240 NTLSRSHTLLQFLCKDHKGLMYDIMRTLKDYNIQISYGRFYATPKGHCEVDLFIMQADGK 299

Query: 301 KIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDITLAL 360
           KI+D  KQDALCSRLRMELLRPLRVAVV+RGPD ELLVANPVELS RGRPLVFYDITLAL
Sbjct: 300 KIIDSYKQDALCSRLRMELLRPLRVAVVSRGPDTELLVANPVELSERGRPLVFYDITLAL 359

Query: 361 KILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE 414
           KIL+  IFSVEIGR+MIHDREWEVYRILLDE DG   PRNKIE+ VRK LMGW+
Sbjct: 360 KILNTRIFSVEIGRHMIHDREWEVYRILLDEGDGFTVPRNKIEESVRKRLMGWD 413




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224109832|ref|XP_002315327.1| predicted protein [Populus trichocarpa] gi|222864367|gb|EEF01498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224100729|ref|XP_002311991.1| predicted protein [Populus trichocarpa] gi|222851811|gb|EEE89358.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448926|ref|XP_002266940.1| PREDICTED: uncharacterized protein LOC100266711 [Vitis vinifera] gi|296085960|emb|CBI31401.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225448928|ref|XP_002271915.1| PREDICTED: uncharacterized protein LOC100259822 [Vitis vinifera] gi|296085961|emb|CBI31402.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449320|ref|XP_004142413.1| PREDICTED: uncharacterized protein LOC101203151 [Cucumis sativus] gi|449487252|ref|XP_004157538.1| PREDICTED: uncharacterized protein LOC101230856 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356572480|ref|XP_003554396.1| PREDICTED: uncharacterized protein LOC100818216 [Glycine max] Back     alignment and taxonomy information
>gi|225441177|ref|XP_002268949.1| PREDICTED: uncharacterized protein LOC100265834 [Vitis vinifera] gi|297739971|emb|CBI30153.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548347|ref|XP_003542564.1| PREDICTED: uncharacterized protein LOC100816138 [Glycine max] Back     alignment and taxonomy information
>gi|356533259|ref|XP_003535183.1| PREDICTED: uncharacterized protein LOC100789465 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2057936410 ACR10 "ACT domain repeats 10" 0.983 0.992 0.616 1.8e-133
TAIR|locus:2039782411 ACR9 "ACT domain repeats 9" [A 0.966 0.973 0.542 2.2e-114
TAIR|locus:2078678433 ACR6 "ACT domain repeat 6" [Ar 0.722 0.690 0.219 0.00017
TAIR|locus:2033223 455 ACR4 "ACT domain repeat 4" [Ar 0.456 0.415 0.225 0.0004
TAIR|locus:2057936 ACR10 "ACT domain repeats 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1308 (465.5 bits), Expect = 1.8e-133, P = 1.8e-133
 Identities = 257/417 (61%), Positives = 319/417 (76%)

Query:     1 MGLMYEDVVVISQAEKPGDCTVITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWC 60
             MG++ +DVV+ISQ+EK GD +VIT+NCPDKTGLGCDLCRI+L FGL+I RGD+S DGKWC
Sbjct:     1 MGILSDDVVIISQSEKEGDPSVITINCPDKTGLGCDLCRILLFFGLNIVRGDVSTDGKWC 60

Query:    61 YLVFWVVGKPTTRWSLLKNRLLEVCPSY---FSTSRIYSYRLENQQQPKPPDVFLLKFWC 117
             YLVFWV+GKP TRW+LLK RL+E  PS+   F  SR Y    E+Q  PK PD+FLLK  C
Sbjct:    61 YLVFWVIGKPNTRWNLLKMRLVEASPSFSWAFGISRCYLSDSESQP-PKLPDLFLLKLAC 119

Query:   118 FQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHH 177
               DR GLL+DVTEVL +LE+ I++VK+STTPDG+VMDLFF+TDTRELL T KRR E   +
Sbjct:   120 -SDRTGLLYDVTEVLYKLEINIEKVKISTTPDGKVMDLFFVTDTRELLGTVKRRNEVYEY 178

Query:   178 LEAVLGKTLISCEIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSI 237
             L   +G ++IS +IEL GPEITAC   SS     + + +FS ++  E  +G   S+ VSI
Sbjct:   179 LRDAIGDSMISYDIELVGPEITACSTSSS-----VAETLFSSDVSGEHSSGLHTSSNVSI 233

Query:   238 AVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQA 297
             AVDNS S +HTLI I  QDHKGL+YD+MRT KD+N Q+SYGRF  K   NCE+DLFI+Q+
Sbjct:   234 AVDNSLSSAHTLIHITCQDHKGLLYDIMRTFKDFNIQISYGRFTIKLGKNCEIDLFIVQS 293

Query:   298 DGKKIVDPSKQDALCSRLRMELLRPLRVAVVNRGPDAELLVANPVELSGRGRPLVFYDIT 357
             DG+KI+D SK +AL +RLR EL +PLRV ++NRGPD ELLV NPVELSG+GRP VF+DI 
Sbjct:   294 DGRKILDSSKLNALITRLRAELQQPLRVVMMNRGPDTELLVTNPVELSGKGRPQVFHDIA 353

Query:   358 LALKILSISIFSVEIGRYMIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMGWE 414
             LALK +   IFS EIGR++  DREWEVY++L++E D    PR+KIE+ V K LMGWE
Sbjct:   354 LALKKIDTCIFSAEIGRHVTGDREWEVYKVLINEEDSLPIPRSKIEEEVWKTLMGWE 410




GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2039782 ACR9 "ACT domain repeats 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
cd0492776 cd04927, ACT_ACR-like_2, Second ACT domain, of a n 2e-38
cd0489675 cd04896, ACT_ACR-like_3, ACT domain-containing pro 2e-37
cd0489469 cd04894, ACT_ACR-like_1, ACT domain-containing pro 6e-36
cd0489877 cd04898, ACT_ACR-like_4, ACT domain-containing pro 4e-30
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 1e-14
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 1e-12
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 1e-09
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 2e-08
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 3e-08
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 4e-08
cd0490073 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU 3e-06
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 2e-05
cd0492672 cd04926, ACT_ACR_4, C-terminal ACT domain, of a no 2e-05
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 5e-05
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 1e-04
cd0211660 cd02116, ACT, ACT domains are commonly involved in 2e-04
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 3e-04
PRK01759854 PRK01759, glnD, PII uridylyl-transferase; Provisio 3e-04
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 0.001
pfam0184266 pfam01842, ACT, ACT domain 0.002
>gnl|CDD|153199 cd04927, ACT_ACR-like_2, Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
 Score =  132 bits (334), Expect = 2e-38
 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 1/77 (1%)

Query: 111 FLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKR 170
           FLLK +C  DRKGLLHDVTEVL ELELTI+RVKVSTTPDGRV+DLFFITD RELLHT+KR
Sbjct: 1   FLLKLFCS-DRKGLLHDVTEVLYELELTIERVKVSTTPDGRVLDLFFITDARELLHTKKR 59

Query: 171 REETIHHLEAVLGKTLI 187
           REET  +L AVLG ++I
Sbjct: 60  REETYDYLRAVLGDSMI 76


This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 76

>gnl|CDD|153168 cd04896, ACT_ACR-like_3, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153166 cd04894, ACT_ACR-like_1, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153170 cd04898, ACT_ACR-like_4, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|234980 PRK01759, glnD, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|190133 pfam01842, ACT, ACT domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.96
PRK05007884 PII uridylyl-transferase; Provisional 99.96
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.95
PRK05007884 PII uridylyl-transferase; Provisional 99.95
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.95
PRK03059856 PII uridylyl-transferase; Provisional 99.94
PRK04374869 PII uridylyl-transferase; Provisional 99.94
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.94
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.93
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.93
PRK05092931 PII uridylyl-transferase; Provisional 99.93
PRK04374869 PII uridylyl-transferase; Provisional 99.92
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.92
PRK03381774 PII uridylyl-transferase; Provisional 99.92
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.91
PRK05092931 PII uridylyl-transferase; Provisional 99.91
PRK03381774 PII uridylyl-transferase; Provisional 99.91
PRK03059856 PII uridylyl-transferase; Provisional 99.91
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.84
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.83
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 99.82
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.79
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.78
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.74
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.69
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.64
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.61
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.57
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.56
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.56
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 99.55
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.53
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.47
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 99.44
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.4
PRK00227693 glnD PII uridylyl-transferase; Provisional 99.31
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.3
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.3
PRK00227693 glnD PII uridylyl-transferase; Provisional 99.29
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 99.24
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.24
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.13
COG2716176 GcvR Glycine cleavage system regulatory protein [A 99.01
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.92
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.8
COG2716176 GcvR Glycine cleavage system regulatory protein [A 98.78
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.67
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 98.43
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.39
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.36
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.25
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.21
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 98.14
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.1
COG4747142 ACT domain-containing protein [General function pr 97.97
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.97
PRK0019490 hypothetical protein; Validated 97.91
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.9
COG4747142 ACT domain-containing protein [General function pr 97.9
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.85
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.84
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.73
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.7
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.68
PRK0019490 hypothetical protein; Validated 97.62
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.58
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.55
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.53
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.46
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 97.41
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 97.27
COG383090 ACT domain-containing protein [Signal transduction 97.25
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 97.19
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 97.18
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 97.18
PRK07431587 aspartate kinase; Provisional 97.12
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.11
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 97.09
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 97.06
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 97.06
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 97.05
COG383090 ACT domain-containing protein [Signal transduction 97.0
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.99
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.97
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.94
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 96.92
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 96.92
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.91
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 96.87
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 96.87
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 96.83
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.78
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.77
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.75
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.71
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 96.66
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 96.62
PRK08577136 hypothetical protein; Provisional 96.62
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 96.62
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.59
CHL00100174 ilvH acetohydroxyacid synthase small subunit 96.58
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.57
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.55
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 96.52
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.48
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.48
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.44
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 96.43
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.42
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 96.41
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.37
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 96.32
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 96.29
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 96.28
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.27
CHL00100174 ilvH acetohydroxyacid synthase small subunit 96.27
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 96.2
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 96.19
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 96.15
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 96.14
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 96.09
PRK04435147 hypothetical protein; Provisional 96.08
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 96.06
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 96.04
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 96.03
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 96.03
PRK08577136 hypothetical protein; Provisional 96.0
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 95.97
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.86
cd0211660 ACT ACT domains are commonly involved in specifica 95.8
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 95.78
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 95.74
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 95.72
PRK07431587 aspartate kinase; Provisional 95.58
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 95.58
PRK04435147 hypothetical protein; Provisional 95.52
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 95.51
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 95.46
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.45
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 95.42
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 95.4
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 95.4
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 95.18
PRK11899279 prephenate dehydratase; Provisional 95.17
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 95.15
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 95.1
cd0211660 ACT ACT domains are commonly involved in specifica 95.08
PRK07334403 threonine dehydratase; Provisional 95.05
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 94.91
PRK07334403 threonine dehydratase; Provisional 94.86
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 94.83
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 94.75
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 94.72
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 94.4
PRK06635404 aspartate kinase; Reviewed 93.97
COG1707218 ACT domain-containing protein [General function pr 93.97
PRK11899279 prephenate dehydratase; Provisional 93.63
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 93.61
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 93.59
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 93.35
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 93.31
COG1707218 ACT domain-containing protein [General function pr 93.2
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 93.1
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 92.75
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 92.65
PRK06635404 aspartate kinase; Reviewed 92.62
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 92.37
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 92.27
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 92.06
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 91.92
COG0077279 PheA Prephenate dehydratase [Amino acid transport 91.81
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 91.54
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 91.14
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 91.0
PRK06291465 aspartate kinase; Provisional 90.99
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 90.96
COG0077279 PheA Prephenate dehydratase [Amino acid transport 90.75
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 90.74
PRK06382406 threonine dehydratase; Provisional 90.66
COG0527447 LysC Aspartokinases [Amino acid transport and meta 90.33
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 90.02
PRK08210403 aspartate kinase I; Reviewed 89.62
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 89.47
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 89.18
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 89.17
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 88.86
PLN02551521 aspartokinase 88.79
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 88.61
COG2150167 Predicted regulator of amino acid metabolism, cont 88.17
KOG2663309 consensus Acetolactate synthase, small subunit [Am 88.08
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 87.57
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 87.42
PRK06382406 threonine dehydratase; Provisional 87.01
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 86.77
PRK08818370 prephenate dehydrogenase; Provisional 86.36
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 85.65
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 85.19
PRK12483521 threonine dehydratase; Reviewed 85.1
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 85.03
PRK08198404 threonine dehydratase; Provisional 84.64
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 84.58
PRK11898283 prephenate dehydratase; Provisional 83.83
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 83.55
PRK08210403 aspartate kinase I; Reviewed 83.49
PRK09084448 aspartate kinase III; Validated 83.39
PRK09181475 aspartate kinase; Validated 83.37
TIGR00657441 asp_kinases aspartate kinase. The Lys-sensitive en 83.2
PRK09034454 aspartate kinase; Reviewed 83.12
PRK06291465 aspartate kinase; Provisional 83.07
PLN02317382 arogenate dehydratase 82.95
PRK06545359 prephenate dehydrogenase; Validated 82.77
COG4492150 PheB ACT domain-containing protein [General functi 82.31
TIGR01270 464 Trp_5_monoox tryptophan 5-monooxygenase, tetrameri 82.01
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- 81.91
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 81.74
PLN02551521 aspartokinase 81.55
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 80.34
PLN02317382 arogenate dehydratase 80.34
PRK09181475 aspartate kinase; Validated 80.19
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
Probab=99.96  E-value=2.1e-28  Score=267.82  Aligned_cols=174  Identities=17%  Similarity=0.237  Sum_probs=152.4

Q ss_pred             CCCeEEEEecCCCCCeEEEEEEecCcccHHHHHHHHHHhCCceEEeEEEEEeeCCCEEEEEEEEe-cCCCCCCChHHHHH
Q 015010          232 SAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLKDYNTQVSYGRFFAKPRGNCEVDLFIMQ-ADGKKIVDPSKQDA  310 (414)
Q Consensus       232 ~~~~~V~v~~~~~~~~t~v~V~~~DrpGLL~~i~~~L~~~~l~I~~A~I~t~t~g~~~~D~F~v~-~~g~~~~~~~~~~~  310 (414)
                      ..+|.|.+++.++.++|+|+|+++||||||++|+++|+.+|+||.+|+|+|+ .++++.|+|+|. .+|.++. ++++++
T Consensus       662 ~~~~~V~i~~~~~~~~t~V~V~~~DrpGLfa~Ia~~L~~~~L~I~~A~I~T~-~~g~alD~F~V~d~~g~~~~-~~~~~~  739 (854)
T PRK01759        662 RGDLLVKISNRFSRGGTEIFIYCQDQANLFLKVVSTIGAKKLSIHDAQIITS-QDGYVLDSFIVTELNGKLLE-FDRRRQ  739 (854)
T ss_pred             CCCCEEEEEecCCCCeEEEEEEecCCccHHHHHHHHHHHCCCeEEEEEEEEc-cCCEEEEEEEEeCCCCCCCC-HHHHHH
Confidence            4567888999999999999999999999999999999999999999999964 666999999995 8888884 678899


Q ss_pred             HHHHHHHHHcCCcceee---ecC-----CCCceeeee-------eeEEEEeCCccchHHHHHHHHHhCCceEEEEEEecc
Q 015010          311 LCSRLRMELLRPLRVAV---VNR-----GPDAELLVA-------NPVELSGRGRPLVFYDITLALKILSISIFSVEIGRY  375 (414)
Q Consensus       311 l~~~L~~~l~~~~~~~~---~~~-----~~~~~v~~~-------~~lev~~~DRpGLL~dIt~~l~~~gl~I~~A~I~T~  375 (414)
                      |++.|+++|.++.....   .++     ..+|+|.|+       |+|||.|.|||||||+|+++|.++|++|++|||+| 
T Consensus       740 l~~~L~~aL~~~~~~~~~~~~~~~~~~~~~~~~V~~dn~~s~~~T~iev~a~DrpGLL~~I~~~l~~~~l~i~~AkI~T-  818 (854)
T PRK01759        740 LEQALTKALNTNKLKKLNLEENHKLQHFHVKTEVRFLNEEKQEQTEMELFALDRAGLLAQVSQVFSELNLNLLNAKITT-  818 (854)
T ss_pred             HHHHHHHHHcCCCCcchhccccccccCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCCEEEEEEEcc-
Confidence            99999999987653221   111     236888875       59999999999999999999999999999999999 


Q ss_pred             eeCceeeEEEEEEEEcCCCCCCCchHHHHHHHHHHcc
Q 015010          376 MIHDREWEVYRILLDEADGNLEPRNKIEDLVRKILMG  412 (414)
Q Consensus       376 ~~g~~~~~~d~Fyv~d~~g~~l~~~~~~~~i~~~L~~  412 (414)
                       .|++  ++|+|||+|.+|.|+++++ .++|+++|+.
T Consensus       819 -~ger--v~D~Fyv~~~~g~~l~~~~-~~~l~~~L~~  851 (854)
T PRK01759        819 -IGEK--AEDFFILTNQQGQALDEEE-RKALKSRLLS  851 (854)
T ss_pred             -cCce--EEEEEEEECCCCCcCChHH-HHHHHHHHHH
Confidence             9999  9999999999999999764 4999988864



>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PLN02317 arogenate dehydratase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02317 arogenate dehydratase Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1u8s_A192 Glycine cleavage system transcriptional repressor, 2e-07
2nyi_A195 Unknown protein; protein structure initiative, PSI 6e-05
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Length = 192 Back     alignment and structure
 Score = 50.1 bits (119), Expect = 2e-07
 Identities = 21/141 (14%), Positives = 52/141 (36%), Gaps = 7/141 (4%)

Query: 22  VITVNCPDKTGLGCDLCRIILLFGLSISRGDLSKDGKWCYLVFWVVGKPTTRWSLLKNRL 81
           VIT    D+ G+  ++ R++   G +I    ++  GK   L+  + G   +  + ++  L
Sbjct: 8   VITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISG-SPSNITRVETTL 66

Query: 82  LEVCPSYFSTSRIYSYRLENQQQPKPPDVFLLKFWCFQDRKGLLHDVTEVLCELELTIKR 141
             +   +   + +      + Q         +      D+ GL    T+   + ++ +  
Sbjct: 67  PLLGQQHDLITMMKRTSPHDHQTHAYT--VEVYVES-DDKLGLTEKFTQFFAQRQIGMAS 123

Query: 142 VKVSTTPDGRVM---DLFFIT 159
           +   T    ++    + F I 
Sbjct: 124 LSAQTISKDKLHSEQNQFHIA 144


>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.69
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.67
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.63
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.6
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 98.69
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 98.54
2f06_A144 Conserved hypothetical protein; structural genomic 98.07
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 98.06
2f06_A144 Conserved hypothetical protein; structural genomic 98.02
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.8
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.76
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.72
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 97.38
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 97.3
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 97.29
2re1_A167 Aspartokinase, alpha and beta subunits; structural 97.29
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 97.27
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 97.22
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 97.19
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 97.17
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 97.14
2pc6_A165 Probable acetolactate synthase isozyme III (small; 97.03
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 97.0
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 96.98
2re1_A167 Aspartokinase, alpha and beta subunits; structural 96.97
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 96.93
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 96.78
2pc6_A165 Probable acetolactate synthase isozyme III (small; 96.74
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 96.73
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 96.66
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 96.63
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 96.61
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 96.37
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 96.37
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 96.27
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 96.14
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 96.08
1y7p_A223 Hypothetical protein AF1403; structural genomics, 96.05
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 95.97
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 95.88
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 95.76
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 95.68
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 95.47
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 94.71
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 94.52
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 94.28
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 93.26
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 92.78
3luy_A329 Probable chorismate mutase; structural genomics, A 90.68
3luy_A329 Probable chorismate mutase; structural genomics, A 90.61
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 90.54
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 90.13
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 89.64
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 89.31
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 89.27
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 88.51
3tvi_A446 Aspartokinase; structural genomics, ACT domains, r 88.19
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 87.74
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 87.41
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 84.26
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 83.3
3tvi_A446 Aspartokinase; structural genomics, ACT domains, r 83.06
2cdq_A510 Aspartokinase; aspartate kinase, amino acid metabo 82.83
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
Probab=99.69  E-value=1.3e-16  Score=145.03  Aligned_cols=158  Identities=13%  Similarity=0.115  Sum_probs=108.8

Q ss_pred             eEEEEEEEecCCcchHHHHHHHHHhCCCeEEEEEEEeCCCCeEEEEEEEecCCCCCCCHHHHHHHHHHHHHHHccccccc
Q 015010          110 VFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVLGKTLISC  189 (414)
Q Consensus       110 ~~~i~v~~~~Dr~GLl~~i~~~L~~~glnI~~A~i~T~~~g~~~d~f~V~~~~~~~~~~~~~~~i~~~L~~~l~~~~~~~  189 (414)
                      .++|+|+| +||||||++|+++|+++||||++|++++..+++++ .|.|..+..  ..+.++++|++.|..++.+..   
T Consensus         5 ~~~ltv~~-~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m-~~~v~~~~~--~~~~~~~~l~~~L~~~~~~~~---   77 (195)
T 2nyi_A            5 SFVVSVAG-SDRVGIVHDFSWALKNISANVESSRMACLGGDFAM-IVLVSLNAK--DGKLIQSALESALPGFQISTR---   77 (195)
T ss_dssp             EEEEEEEE-ECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEE-EEEEEESSS--SSHHHHHHHHHHSTTCEEEEE---
T ss_pred             EEEEEEEe-CCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEE-EEEEEecCc--cchhHHHHHHHHHHHHHHhcC---
Confidence            67999999 99999999999999999999999999996766666 777865321  123355666555554332200   


Q ss_pred             cccCCCCccccccCCCCCCchhhHhhhhccCCCCCCCCCCCCCCCeEEEEecCCCCCeEEEEEEecCcccHHHHHHHHHH
Q 015010          190 EIELPGPEITACCHGSSFLPSAITDEMFSLELPAEQPNGFLASAPVSIAVDNSFSPSHTLIQILGQDHKGLIYDMMRTLK  269 (414)
Q Consensus       190 ~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~V~v~~~~~~~~t~v~V~~~DrpGLL~~i~~~L~  269 (414)
                            ...            .+.            .       .+    . ......++|+|.|+|||||+++|+++|+
T Consensus        78 ------~~~------------~~~------------~-------~~----~-~~~~~~~iltv~g~DrpGiva~Vt~~La  115 (195)
T 2nyi_A           78 ------RAS------------SVA------------E-------RH----V-SPDTREYELYVEGPDSEGIVEAVTAVLA  115 (195)
T ss_dssp             ------ECC------------CC---------------------------C-CTTEEEEEEEEEEECCTTHHHHHHHHHH
T ss_pred             ------CeE------------EEE------------e-------CC----c-CCCCcEEEEEEEeCCCcCHHHHHHHHHH
Confidence                  000            000            0       00    0 2334568999999999999999999999


Q ss_pred             hCCceEEeEEEEEeeCCCEEEEEEEEe-cCCCCCCChHHHHHHHHHHHHHH
Q 015010          270 DYNTQVSYGRFFAKPRGNCEVDLFIMQ-ADGKKIVDPSKQDALCSRLRMEL  319 (414)
Q Consensus       270 ~~~l~I~~A~I~t~t~g~~~~D~F~v~-~~g~~~~~~~~~~~l~~~L~~~l  319 (414)
                      ++|+||.+++..+....++..+.|++. ..+.+  ++.. +.|++.|....
T Consensus       116 ~~g~nI~~~~~~t~~~~~~~~~~F~m~~~~~~~--~~~~-~~l~~~l~~~a  163 (195)
T 2nyi_A          116 KKGANIVELETETLPAPFAGFTLFRMGSRVAFP--FPLY-QEVVTALSRVE  163 (195)
T ss_dssp             HTTCEEEEEEEEEEECSSTTCEEEEEEEEEEEE--GGGH-HHHHHHHHHHH
T ss_pred             HcCCCEEEceeeecccccCCCCeEEEEEEEEcC--CCcc-HHHHHHHHHHH
Confidence            999999999998543124456888874 22222  2334 77888876544



>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.71
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.42
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.31
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.19
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.88
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.69
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.57
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.52
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.48
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.4
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.31
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.16
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.15
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.13
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.13
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 97.12
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 97.11
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 97.09
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 96.99
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 96.96
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 96.9
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 96.6
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 96.23
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 95.83
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 95.69
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 89.25
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 82.81
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Glycine cleavage system transcriptional repressor
domain: putative transcriptional repressor VC2159
species: Vibrio cholerae [TaxId: 666]
Probab=98.71  E-value=4.8e-08  Score=74.54  Aligned_cols=66  Identities=12%  Similarity=0.161  Sum_probs=54.3

Q ss_pred             CeEEEEEEEecCCcchHHHHHHHHHhCCCeEEEEEEEeCCCCeEEEEEEEecCCCCCCCHHHHHHHHHHHHHHH
Q 015010          109 DVFLLKFWCFQDRKGLLHDVTEVLCELELTIKRVKVSTTPDGRVMDLFFITDTRELLHTRKRREETIHHLEAVL  182 (414)
Q Consensus       109 ~~~~i~v~~~~Dr~GLl~~i~~~L~~~glnI~~A~i~T~~~g~~~d~f~V~~~~~~~~~~~~~~~i~~~L~~~l  182 (414)
                      .++.|++.| +||||++++++++|+++||||.+++.++ .++...-.+.|..      ++...+++++.|+..-
T Consensus         4 ~~~vitv~G-~DrpGiva~vt~~l~~~g~NI~d~~~~~-~~~~~~~~~~v~~------~~~~~~~l~~~L~~l~   69 (86)
T d1u8sa1           4 QHLVITAVG-TDRPGICNEVVRLVTQAGCNIIDSRIAM-FGKEFTLLMLISG------SPSNITRVETTLPLLG   69 (86)
T ss_dssp             EEEEEEEEE-ECCTTHHHHHHHHHHHTTCEEEEEEEEE-ETTEEEEEEEEEE------CHHHHHHHHHHHHHHH
T ss_pred             cEEEEEEEe-CCCChHHHHHHHHHHHCCCeEEEeEeEE-ECCeeEEEEEEEc------CcccHHHHHHHHHHHH
Confidence            478999999 9999999999999999999999999999 6777666777764      3445677777666644



>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure