Citrus Sinensis ID: 015679

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---
MAKYNIPLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQPSSSAANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR
ccccccccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccEEEEEccccccccccccccEEccccccHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccHHccccccHHHHHHHccccccccEEEEEEEcccc
ccccccccccccccccEEEEcHHHHHHHcccHHHHHHHHccHcHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHEEEccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEEEEEcccccccccccccccccccEEHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccccHHHHHccccHHHHcccccccccccEEEEEEccccc
makyniplkfsgfFCRFVFVelpeirkdvqcpiclgiiKKTRTVMECLHRFCRECIDKsmrlgnnecpacrthcasrrslrddpnydALISALypdidkyeEEELAFHEEERTRNKQIQASIAKIFQRQSEALvkrrtpgkdtaspfmtrpqrnprtahlrrrrnsrgtehqgsednedenddnggkdsssndersaevrprrrkrrsgirssqpsssaansdggciendlevgresrgispglvwnpemlawgrggtrsntrhgsasgcnskssrsTRLNKLVEYLRSLQENNDELDVRLMLVSAdtqcapslqqpylccqpslsvkQLCEYVslqtplqaEEVEILMVKERldakgnqstpipttdqlqILEGQETLaglrvnhtsnTDHLILAYRQKQSR
makyniplkfsgfFCRFVFVElpeirkdvqcpiCLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCasrrslrddpnYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQrqsealvkrrtpgkdtaspfmtrpqrnprtahlrrrrnsrgtehqgsednedenddnggkdsssndersaevrprrrkrrsgirssqpsssaansdggcIENDLEVGRESRGISPGLVWNPEMLAWGRGGtrsntrhgsasgcnskssrstRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLdakgnqstpipttdqlqILEGQETLAGLRVNHTSNTDHLILAYRQKQSR
MAKYNIPLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYeeeelafheeeRTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQgsednedenddnggkdsssndersaevrprrrkrrsgirssqpsssaansDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR
***YNIPLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYE******************************************************************************************************************************************ISPGLVWNPEMLAWG****************************LVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKE******************QILEGQETLAGLRVNHTSNTDHLILAY******
********KFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEE***************************************************************************************************************************************************************************************************DVRLMLVSAD*****SLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGN*S********LQILEGQETLAGLRVNHTSNTDHLILAYRQK***
MAKYNIPLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELA**********QIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQ************************************************************************GCIENDLEVGRESRGISPGLVWNPEMLAWGRGGT*******************TRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR
*************FCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEAL***************************************************************************************************V*RESRGISPGLVWNPEMLAWGRG********************STRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERL************TDQLQILEGQETLAGLRVNHTSNTDHLILAYRQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKYNIPLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQPSSSAANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRxxxxxxxxxxxxxxxxxxxxxLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query403 2.2.26 [Sep-21-2011]
Q9FKW0522 Putative E3 ubiquitin-pro yes no 0.970 0.749 0.590 1e-122
Q0WX00460 Putative E3 ubiquitin-pro no no 0.913 0.8 0.547 1e-100
Q66J69344 E3 ubiquitin-protein liga N/A no 0.560 0.656 0.328 7e-23
Q7ZWM8343 E3 ubiquitin-protein liga N/A no 0.424 0.498 0.338 1e-22
Q99496336 E3 ubiquitin-protein liga yes no 0.208 0.25 0.523 6e-22
Q5R9J5336 E3 ubiquitin-protein liga yes no 0.208 0.25 0.523 7e-22
Q9CQJ4336 E3 ubiquitin-protein liga yes no 0.208 0.25 0.523 7e-22
Q4KLY4308 E3 ubiquitin-protein liga yes no 0.215 0.282 0.505 7e-22
Q803I4336 E3 ubiquitin-protein liga yes no 0.191 0.229 0.558 8e-22
O35730406 E3 ubiquitin-protein liga no no 0.292 0.290 0.430 9e-22
>sp|Q9FKW0|RNG1A_ARATH Putative E3 ubiquitin-protein ligase RING1a OS=Arabidopsis thaliana GN=RING1A PE=1 SV=2 Back     alignment and function desciption
 Score =  438 bits (1127), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 245/415 (59%), Positives = 307/415 (73%), Gaps = 24/415 (5%)

Query: 7   PLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNE 66
           P   SG    F+ ++L EIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNE
Sbjct: 112 PSSISGDQSEFMEIDLGEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNE 171

Query: 67  CPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIF 126
           CPACR HCASRRSLRDDP +DALI+AL+ +ID YEEEELAFHE+E  RNKQIQASIA+I 
Sbjct: 172 CPACRKHCASRRSLRDDPKFDALIAALFTNIDSYEEEELAFHEDEMARNKQIQASIAQIS 231

Query: 127 QRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQ--GSEDNEDENDDN 184
           QRQSEALVKRR+ GK+ A        R+PR A   RRR +     Q   SE +ED+++D+
Sbjct: 232 QRQSEALVKRRSLGKEAAVLM-----RSPRIASGSRRRRNSRNMEQQNASEAHEDDDNDD 286

Query: 185 ----GGKDSSSNDERSAEVRPRRRKRRSGIRSSQ-PSSSAAN-SDGGCIENDLEVGRESR 238
               G    SS+DER  EVR ++R++RS  RS+Q PSSS AN ++G C +ND EV R+++
Sbjct: 287 NNNRGRDKDSSSDERGTEVRQKKRRKRSTSRSTQHPSSSGANKNNGNCADNDTEVYRDTK 346

Query: 239 GISPGLVWNPEMLAWGRGGTRSNTRHG-SASGCNSKSSRSTRLNKLVEYLR-SLQENNDE 296
           GISPGLVWNPE+LAWGRGGTRSNTRHG + SG +SKS R+ R+NKLVEYLR S+  ++ E
Sbjct: 347 GISPGLVWNPEILAWGRGGTRSNTRHGNNTSGGSSKSVRNARVNKLVEYLRSSVDGSSVE 406

Query: 297 LDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLD- 355
           LD+ + LVS DT+C P L QPYLCC+P+L VKQL E+V+LQ  L+ EEVE+L+ + R+  
Sbjct: 407 LDIHVKLVSLDTKCIPDLPQPYLCCRPTLLVKQLREFVALQIHLKTEEVELLVTRRRVGE 466

Query: 356 --AKGNQSTPIPTT-----DQLQILEGQETLAGLRVNH-TSNTDHLILAYRQKQS 402
             A  N     P +     D++  LE  ETL+ L+++  +S+  HLI+AYR+KQ+
Sbjct: 467 DAAIENLPAVTPASAAASKDEMLSLEDNETLSRLKIDFISSHEQHLIIAYRKKQT 521
As part of the PRC1-like complex, repress class I KNOX gene expression. PcG PRC1 complex maintains the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q0WX00|RNG1B_ARATH Putative E3 ubiquitin-protein ligase RING1b OS=Arabidopsis thaliana GN=RING1B PE=1 SV=1 Back     alignment and function description
>sp|Q66J69|RNG2A_XENLA E3 ubiquitin-protein ligase RING2-A OS=Xenopus laevis GN=rnf2-a PE=2 SV=1 Back     alignment and function description
>sp|Q7ZWM8|RNG2B_XENLA E3 ubiquitin-protein ligase RING2-B OS=Xenopus laevis GN=rnf2-b PE=2 SV=2 Back     alignment and function description
>sp|Q99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens GN=RNF2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9J5|RING2_PONAB E3 ubiquitin-protein ligase RING2 OS=Pongo abelii GN=RNF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQJ4|RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus GN=Rnf2 PE=1 SV=1 Back     alignment and function description
>sp|Q4KLY4|RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus GN=Rnf2 PE=2 SV=1 Back     alignment and function description
>sp|Q803I4|RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio GN=rnf2 PE=2 SV=1 Back     alignment and function description
>sp|O35730|RING1_MOUSE E3 ubiquitin-protein ligase RING1 OS=Mus musculus GN=Ring1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
302143319 568 unnamed protein product [Vitis vinifera] 0.952 0.676 0.749 1e-155
359485403412 PREDICTED: putative E3 ubiquitin-protein 0.952 0.932 0.749 1e-155
224133478497 predicted protein [Populus trichocarpa] 0.930 0.754 0.735 1e-143
297740412433 unnamed protein product [Vitis vinifera] 0.947 0.882 0.675 1e-138
359483484 534 PREDICTED: putative E3 ubiquitin-protein 0.947 0.715 0.672 1e-138
449463098495 PREDICTED: putative E3 ubiquitin-protein 0.950 0.773 0.674 1e-134
224125396445 predicted protein [Populus trichocarpa] 0.918 0.831 0.603 1e-129
449531613424 PREDICTED: putative E3 ubiquitin-protein 0.952 0.905 0.638 1e-123
224079177463 predicted protein [Populus trichocarpa] 0.935 0.814 0.629 1e-123
255553681342 ring finger protein, putative [Ricinus c 0.799 0.941 0.679 1e-122
>gi|302143319|emb|CBI21880.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 299/399 (74%), Positives = 338/399 (84%), Gaps = 15/399 (3%)

Query: 17  FVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCAS 76
           FVFV LP+IRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCAS
Sbjct: 167 FVFVGLPDIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCAS 226

Query: 77  RRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKR 136
           RRSLRDDPNYDALI+ALYPDIDKYEEEELAFHEEE+TRNKQIQASIA+I QRQSEAL ++
Sbjct: 227 RRSLRDDPNYDALIAALYPDIDKYEEEELAFHEEEQTRNKQIQASIAQILQRQSEALNRK 286

Query: 137 RTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERS 196
           RT GKD A PFMTR QRN R A+ RRR+N RG++ QGS+DNEDEND++GGK SSS +ERS
Sbjct: 287 RTLGKDIAGPFMTRSQRNYRNAYSRRRKNGRGSDLQGSDDNEDENDNDGGKGSSSAEERS 346

Query: 197 AEVRPRRRKRRSGIRSSQPSSSA-ANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGR 255
            EV+ RR KRR+GIR  QPSSS+ ANSDGGCIENDLEV RESRG SPGLVWNPEMLAWGR
Sbjct: 347 TEVKRRRYKRRAGIRLIQPSSSSVANSDGGCIENDLEVNRESRGFSPGLVWNPEMLAWGR 406

Query: 256 GGTRSNTRHGSASGCNSKSSRSTRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQ 315
           GG RS+TRHGS+SGCN KS+RSTRL+KLV+YLRSL EN++ELDV LML+S D +  PSLQ
Sbjct: 407 GGARSHTRHGSSSGCNHKSARSTRLSKLVDYLRSLGENDNELDVHLMLISLDKESTPSLQ 466

Query: 316 QPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVK---ERLDAKGNQSTPI-------- 364
           +PYLCC+P+LSV+ LCEYV+LQTPL+AEEVEIL+VK          N ST +        
Sbjct: 467 EPYLCCRPTLSVRHLCEYVALQTPLRAEEVEILVVKGCHNDYQPFPNPSTSVDDLNPDPI 526

Query: 365 ---PTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQK 400
              P+ D+LQILEGQETL GL+ N TS  + L+LAYRQK
Sbjct: 527 VIDPSKDELQILEGQETLVGLQANGTSCRNQLVLAYRQK 565

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359485403|ref|XP_002274885.2| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133478|ref|XP_002328052.1| predicted protein [Populus trichocarpa] gi|222837461|gb|EEE75840.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740412|emb|CBI30594.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483484|ref|XP_002273941.2| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449463098|ref|XP_004149271.1| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224125396|ref|XP_002329795.1| predicted protein [Populus trichocarpa] gi|222870857|gb|EEF07988.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449531613|ref|XP_004172780.1| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224079177|ref|XP_002305782.1| predicted protein [Populus trichocarpa] gi|222848746|gb|EEE86293.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255553681|ref|XP_002517881.1| ring finger protein, putative [Ricinus communis] gi|223542863|gb|EEF44399.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
TAIR|locus:2158705525 RING1A "RING 1A" [Arabidopsis 0.446 0.342 0.539 1.7e-84
FB|FBgn0003330435 Sce "Sex combs extra" [Drosoph 0.287 0.266 0.428 6.1e-23
UNIPROTKB|F1MUV0382 RING1 "Uncharacterized protein 0.292 0.308 0.422 2.1e-22
UNIPROTKB|A1YER5377 RING1 "E3 ubiquitin-protein li 0.292 0.312 0.422 2.1e-22
UNIPROTKB|A1YFY1377 RING1 "E3 ubiquitin-protein li 0.292 0.312 0.422 2.1e-22
UNIPROTKB|A2T6X5377 RING1 "E3 ubiquitin-protein li 0.292 0.312 0.422 2.1e-22
UNIPROTKB|Q8WMN5377 RING1 "E3 ubiquitin-protein li 0.292 0.312 0.422 2.1e-22
MGI|MGI:1101770406 Ring1 "ring finger protein 1" 0.300 0.298 0.425 2.5e-22
UNIPROTKB|Q5TJF3406 RING1 "E3 ubiquitin-protein li 0.292 0.290 0.422 3.3e-22
UNIPROTKB|Q06587406 RING1 "E3 ubiquitin-protein li 0.292 0.290 0.422 3.3e-22
TAIR|locus:2158705 RING1A "RING 1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 492 (178.3 bits), Expect = 1.7e-84, Sum P(2) = 1.7e-84
 Identities = 103/191 (53%), Positives = 139/191 (72%)

Query:   223 DGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGS-ASGCNSKSSRSTRLN 281
             +G C +ND EV R+++GISPGLVWNPE+LAWGRGGTRSNTRHG+  SG +SKS R+ R+N
Sbjct:   334 NGNCADNDTEVYRDTKGISPGLVWNPEILAWGRGGTRSNTRHGNNTSGGSSKSVRNARVN 393

Query:   282 KLVEYLRSLQENND-ELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPL 340
             KLVEYLRS  + +  ELD+ + LVS DT+C P L QPYLCC+P+L VKQL E+V+LQ  L
Sbjct:   394 KLVEYLRSSVDGSSVELDIHVKLVSLDTKCIPDLPQPYLCCRPTLLVKQLREFVALQIHL 453

Query:   341 QAEEVEILMVKERL--DAK-GNQSTPIPTT-----DQLQILEGQETLAGLRVNH-TSNTD 391
             + EEVE+L+ + R+  DA   N     P +     D++  LE  ETL+ L+++  +S+  
Sbjct:   454 KTEEVELLVTRRRVGEDAAIENLPAVTPASAAASKDEMLSLEDNETLSRLKIDFISSHEQ 513

Query:   392 HLILAYRQKQS 402
             HLI+AYR+KQ+
Sbjct:   514 HLIIAYRKKQT 524
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0001709 "cell fate determination" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0010076 "maintenance of floral meristem identity" evidence=IMP
GO:0010077 "maintenance of inflorescence meristem identity" evidence=IMP
GO:0010492 "maintenance of shoot apical meristem identity" evidence=IMP
GO:0035102 "PRC1 complex" evidence=IPI
GO:0045814 "negative regulation of gene expression, epigenetic" evidence=IGI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IGI
FB|FBgn0003330 Sce "Sex combs extra" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUV0 RING1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A1YER5 RING1 "E3 ubiquitin-protein ligase RING1" [Gorilla gorilla gorilla (taxid:9595)] Back     alignment and assigned GO terms
UNIPROTKB|A1YFY1 RING1 "E3 ubiquitin-protein ligase RING1" [Pan paniscus (taxid:9597)] Back     alignment and assigned GO terms
UNIPROTKB|A2T6X5 RING1 "E3 ubiquitin-protein ligase RING1" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WMN5 RING1 "E3 ubiquitin-protein ligase RING1" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
MGI|MGI:1101770 Ring1 "ring finger protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TJF3 RING1 "E3 ubiquitin-protein ligase RING1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q06587 RING1 "E3 ubiquitin-protein ligase RING1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKW0RNG1A_ARATH6, ., 3, ., 2, ., -0.59030.97020.7490yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018617001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (560 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-13
smart0018440 smart00184, RING, Ring finger 1e-10
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-09
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-08
COG5222427 COG5222, COG5222, Uncharacterized conserved protei 1e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 1e-04
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-04
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 0.004
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 63.2 bits (154), Expect = 3e-13
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 30 QCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHC 74
          +CPICL   ++   ++ C H FCR CIDK ++ G N CP CRT  
Sbjct: 1  ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45

Length = 45
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 403
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.19
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 99.15
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.1
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 99.05
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.97
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.96
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.96
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.87
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.81
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.79
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.76
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.73
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.72
PHA02929238 N1R/p28-like protein; Provisional 98.71
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.66
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.66
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.65
KOG2660331 consensus Locus-specific chromosome binding protei 98.63
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.59
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.54
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.49
PHA02926242 zinc finger-like protein; Provisional 98.45
PF1463444 zf-RING_5: zinc-RING finger domain 98.42
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.42
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.4
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.32
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.24
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.08
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.02
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.99
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.89
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
COG5152259 Uncharacterized conserved protein, contains RING a 97.72
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.67
KOG0297391 consensus TNF receptor-associated factor [Signal t 97.63
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.61
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.6
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.59
COG5222427 Uncharacterized conserved protein, contains RING Z 97.57
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.01
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.93
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.88
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.58
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.31
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.3
KOG4739233 consensus Uncharacterized protein involved in syna 96.25
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.22
COG52191525 Uncharacterized conserved protein, contains RING Z 96.15
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.09
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.05
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.75
PF04641260 Rtf2: Rtf2 RING-finger 95.71
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.69
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 95.55
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.53
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.5
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.49
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.06
PF11816331 DUF3337: Domain of unknown function (DUF3337); Int 95.04
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 94.77
KOG4445368 consensus Uncharacterized conserved protein, conta 94.71
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.39
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.36
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.12
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.96
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 93.8
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.69
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.68
KOG1941518 consensus Acetylcholine receptor-associated protei 93.6
COG5175480 MOT2 Transcriptional repressor [Transcription] 93.57
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 93.19
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.94
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 92.55
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 92.26
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 92.1
cd0161287 APG12_C Ubiquitin-like domain of APG12. APG12_C Th 91.72
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.71
cd01611112 GABARAP Ubiquitin domain of GABA-receptor-associat 91.29
KOG3002299 consensus Zn finger protein [General function pred 90.79
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 90.68
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 90.63
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.61
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 90.58
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 90.25
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 90.23
KOG3039303 consensus Uncharacterized conserved protein [Funct 89.28
PHA03096284 p28-like protein; Provisional 89.22
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 88.83
COG5236493 Uncharacterized conserved protein, contains RING Z 88.39
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 88.3
KOG02981394 consensus DEAD box-containing helicase-like transc 88.12
PF02991104 Atg8: Autophagy protein Atg8 ubiquitin like; Inter 87.69
PF0411087 APG12: Ubiquitin-like autophagy protein Apg12 ; In 83.9
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 83.06
KOG1940276 consensus Zn-finger protein [General function pred 82.41
KOG2660331 consensus Locus-specific chromosome binding protei 80.68
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 80.36
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.5e-38  Score=306.40  Aligned_cols=346  Identities=40%  Similarity=0.597  Sum_probs=275.4

Q ss_pred             CCCccccccccccccccccccccccccccccccccccccCCCCCcccHHHHhhhhhcCCCCCCCCcccccCCCCCCCChh
Q 015679            6 IPLKFSGFFCRFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPN   85 (403)
Q Consensus         6 ~~~~s~g~~~e~v~v~~~~l~eel~CpIClel~~dPvtll~CgH~FC~~CI~~~l~~~~~~CP~CR~~~~~~~~l~~n~~   85 (403)
                      +|++..+...+ +.+.+..++-++.||||+++++..++...|+|.||..||...+..+++.||.||+.+.+.+.+++++.
T Consensus        22 ~p~~~~~d~~E-i~~~l~~~~~~v~c~icl~llk~tmttkeClhrfc~~ci~~a~r~gn~ecptcRk~l~SkrsLr~Dp~  100 (381)
T KOG0311|consen   22 SPSSYNGDPSE-IMVDLAMFDIQVICPICLSLLKKTMTTKECLHRFCFDCIWKALRSGNNECPTCRKKLVSKRSLRIDPN  100 (381)
T ss_pred             ChhhhcCCchh-heecHHHhhhhhccHHHHHHHHhhcccHHHHHHHHHHHHHHHHHhcCCCCchHHhhccccccCCCCcc
Confidence            34455566666 56888999999999999999999999788999999999999999899999999999999999999999


Q ss_pred             hhHHHHhHhhhhhhhHHHHHhccHHHHHHHHH-HHHHHHHHHHHHHHHHHHhcccchhcccccccccccCCCccccCccc
Q 015679           86 YDALISALYPDIDKYEEEELAFHEEERTRNKQ-IQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRR  164 (403)
Q Consensus        86 L~~lI~~l~~~c~~~eeel~~fceede~~kek-Lq~~L~~L~q~q~e~L~k~k~~~k~~~~a~~~r~rr~~r~~~~R~Rr  164 (403)
                      +++||.++++.+..++.....|.+.+.....+ |+..+++.++.+...+.+.+...+.       +..+..  .++|+++
T Consensus       101 fdaLis~i~~sie~~e~~q~~~~ekd~~~~~q~i~~si~~~~~~qs~~~~kr~a~~~~-------~s~r~g--~Gs~~~g  171 (381)
T KOG0311|consen  101 FDALISKIYPSIEEYEAPQPRFMEKDDSAQIQYIKTSINAAVDHQSSYLTKRKALEEL-------RSIRWG--GGSRRRG  171 (381)
T ss_pred             HHHHHHHHhccHHHHhccchhHHhhHHHHhHHHHhhhHHHHHhhhhhhhhhhhccccc-------cccccc--CCCCCCC
Confidence            99999999999999999999999998887777 9999998867777777666553333       333333  3678899


Q ss_pred             cCCCCCCCCC----CCccCcCCCCCCCCCCCCCcCCcccccchhcccCCCCCCC-CCCCCCC-CCCCccccccccccccc
Q 015679          165 NSRGTEHQGS----EDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQ-PSSSAAN-SDGGCIENDLEVGRESR  238 (403)
Q Consensus       165 ~~r~~~~~~~----e~~~de~~~~~~~~~s~~d~~s~~~~~~~~~rr~~~r~~~-~~~~~~~-~~~~~~~~~~~~~~~~~  238 (403)
                      +.++.+....    +++..++.+.-++ .++-|+.    +...++.++.-+..+ |+++.++ .+..++.+|.+..+++.
T Consensus       172 n~r~~~~s~~~a~~ea~~~~~~n~rg~-~ss~d~~----~~~~~~~~S~d~~~~~~~~s~as~~~~~~~~a~te~~~~~~  246 (381)
T KOG0311|consen  172 NVRNVEQSKKSAPKEADGNDDENDRGK-DSSSDEL----MDFPREIRSSDREQTHPSSSGASMNDSNCAGADTEDVRDSS  246 (381)
T ss_pred             CcccchhccccCCccCCCccccccccc-ccccccc----ccccccccccccccCCCCccccccCCCcccCCCCccccccc
Confidence            9999876643    2222222222223 3333444    444444444444333 5556565 58899999999889999


Q ss_pred             CCCCCcccCcccccccCCCCCCcccCCCCC-CCccCccchhhHHHHHHHHHhhhcccccceeEEEEeecCCCCCCCCCCC
Q 015679          239 GISPGLVWNPEMLAWGRGGTRSNTRHGSAS-GCNSKSSRSTRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQP  317 (403)
Q Consensus       239 ~~s~~~~~~~~~~~~g~~g~rs~~r~g~~~-~~~~~~~r~~~~~kl~~~l~~~~~~~~e~~~~l~l~~~d~~~~p~l~~p  317 (403)
                      ++++.+||+.|..+||++|+|+.||+|++. |.-..++|.++..++++|+...+...+                      
T Consensus       247 ~i~r~~v~~~e~~~s~r~~~~~~t~n~~~~~~~k~~~vr~a~~~~~~e~~~~~~G~S~----------------------  304 (381)
T KOG0311|consen  247 TISRTLVWNRESSESGRGGTRSNTRNGNNKMGRKSLAVRNALEVRLSEYDGSVEGTSN----------------------  304 (381)
T ss_pred             ccccccccccccchhccCCccccccccccccccchhhhhHHHHHHhhhhccccccccc----------------------
Confidence            999999999999999999999999999953 344566799999999999997666666                      


Q ss_pred             cccccCcchHHHHHHHhhhccCCcccceEEEEEecc--cCccCCCCC--CCCChhhhhhccccchhhcccccccCCCCce
Q 015679          318 YLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKER--LDAKGNQST--PIPTTDQLQILEGQETLAGLRVNHTSNTDHL  393 (403)
Q Consensus       318 ~l~c~pt~~v~~l~~~va~~~~~~~~e~e~~~~~~~--~~~~~~~~~--~~~~~~~~~~l~~~~~~~~l~~~~~~~~~~l  393 (403)
                                    +|||.+.++..+++|+++....  ..++.+..+  .++.+|++..|++.+||+.++.+||..++.+
T Consensus       305 --------------~~~~~~~~~~~~~~~~~~~~~~~~d~~~enn~~iy~a~~~~~~~~Lng~~Tls~v~~df~kvn~~m  370 (381)
T KOG0311|consen  305 --------------IKVAKKKPLKREEVELLVELIHPLDTASENNYTIYIATSKDQFTSLNGDETLSLVKEDFWKVNEPM  370 (381)
T ss_pred             --------------ccccccCCcccccccccccccccccccccccceeEeecCCCceEEecccchHHHHhhhhhhcccch
Confidence                          8999999999999999998873  223333222  3599999999999999999999999999999


Q ss_pred             eehhhhhhc
Q 015679          394 ILAYRQKQS  402 (403)
Q Consensus       394 ~~~y~~~~~  402 (403)
                      +|-|..|.|
T Consensus       371 ~l~~~~kk~  379 (381)
T KOG0311|consen  371 ELSYHEKKI  379 (381)
T ss_pred             hhhhchhcc
Confidence            999998875

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>cd01612 APG12_C Ubiquitin-like domain of APG12 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules Back     alignment and domain information
>PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
2ckl_B165 Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 1e-21
3rpg_C121 Bmi1RING1B-Ubch5c Complex Structure Length = 121 4e-20
2h0d_B100 Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti 7e-19
2ckl_A108 Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 2e-04
2h0d_A97 Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti 2e-04
3rpg_B117 Bmi1RING1B-Ubch5c Complex Structure Length = 117 2e-04
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 2e-04
3hct_A118 Crystal Structure Of Traf6 In Complex With Ubc13 In 5e-04
2djb_A72 Solution Structure Of The Ring Domain Of The Human 7e-04
>pdb|2CKL|B Chain B, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 165 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 56/83 (67%)
Query: 18  VFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASR 77
           + V    +  ++ CPICL ++K T T  ECLHRFC +CI  ++R GN ECP CR    S+
Sbjct: 44  IVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSK 103
Query: 78  RSLRDDPNYDALISALYPDIDKY 100
           RSLR DPN+DALIS +YP  D+Y
Sbjct: 104 RSLRPDPNFDALISKIYPSRDEY 126
>pdb|3RPG|C Chain C, Bmi1RING1B-Ubch5c Complex Structure Length = 121 Back     alignment and structure
>pdb|2H0D|B Chain B, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 100 Back     alignment and structure
>pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 Back     alignment and structure
>pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 Back     alignment and structure
>pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 Back     alignment and structure
>pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 Back     alignment and structure
>pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 Back     alignment and structure
>pdb|2DJB|A Chain A, Solution Structure Of The Ring Domain Of The Human Polycomb Group Ring Finger Protein 6 Length = 72 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 1e-31
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-21
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-16
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-15
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-15
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-14
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-14
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 5e-13
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 6e-12
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 9e-12
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-11
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 8e-11
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 5e-10
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 4e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 4e-09
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 7e-09
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 1e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 5e-08
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 7e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-08
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-07
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 8e-07
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 1e-06
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-06
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 4e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 8e-06
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 1e-05
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 2e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 4e-05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 4e-05
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 4e-04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 8e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 9e-04
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
 Score =  117 bits (294), Expect = 1e-31
 Identities = 50/119 (42%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 20  VELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRS 79
           V    +  ++ CPICL ++K T T  ECLHRFC +CI  ++R GN ECP CR    S+RS
Sbjct: 46  VSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRS 105

Query: 80  LRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQ--IQASIAKIFQRQSEALVKR 136
           LR DPN+DALIS +YP  D+YE  +          N Q  +  SI +  + Q+   ++R
Sbjct: 106 LRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQR 164
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.5
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.5
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.5
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.48
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.45
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.43
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.43
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.43
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.42
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.41
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.4
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.4
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.39
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.39
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.36
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.35
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.34
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.34
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.33
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.32
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.31
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.31
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.29
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.29
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.26
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.25
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.25
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.24
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.21
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.18
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.15
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.14
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.14
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.13
2ect_A78 Ring finger protein 126; metal binding protein, st 99.07
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.03
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.03
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.02
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.02
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.98
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.98
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.98
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.97
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.96
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.9
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.9
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.85
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.81
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.73
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.63
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.61
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.6
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.59
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.54
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.53
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.49
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.41
2ea5_A68 Cell growth regulator with ring finger domain prot 98.38
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.24
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.06
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.93
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.31
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.28
3nw0_A238 Non-structural maintenance of chromosomes element 96.23
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.74
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 95.3
3rui_B118 Autophagy-related protein 8; autophagosome formati 93.83
3h9d_A119 ATG8, microtubule-associated protein 1A/1B, light 93.66
3m95_A125 Autophagy related protein ATG8; alpha slash beta, 92.36
2r2q_A110 Gamma-aminobutyric acid receptor-associated protei 91.19
1wz3_A96 Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla 90.92
1eo6_A117 GATE-16, golgi-associated ATPase enhancer of 16 KD 90.04
2zjd_A130 Microtubule-associated proteins 1A/1B light chain 89.13
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 89.12
3gs2_A111 E3 ubiquitin-protein ligase RING2; RING1B, CBOX, C 89.11
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 88.83
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 88.44
4gdk_A91 Ubiquitin-like protein ATG12; protein-protein conj 87.4
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 85.12
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 81.96
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
Probab=99.50  E-value=8.1e-15  Score=125.16  Aligned_cols=74  Identities=24%  Similarity=0.652  Sum_probs=66.1

Q ss_pred             ccccccccccccccccccccccCCCCCcccHHHHhhhhhcCCCCCCCCcccccCCCCCCCChhhhHHHHhHhhhh
Q 015679           23 PEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDI   97 (403)
Q Consensus        23 ~~l~eel~CpIClel~~dPvtll~CgH~FC~~CI~~~l~~~~~~CP~CR~~~~~~~~l~~n~~L~~lI~~l~~~c   97 (403)
                      ..+.+++.||||+++|.+|++ ++|||+||..||..|+......||.||..+.....+.+|..+.+++..+++..
T Consensus        47 ~~~~~~~~C~IC~~~~~~p~~-~~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~p~~  120 (124)
T 3fl2_A           47 SKVEETFQCICCQELVFRPIT-TVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGY  120 (124)
T ss_dssp             HHHHHHTBCTTTSSBCSSEEE-CTTSCEEEHHHHHHHHHTTCCBCTTTCCBCCTTCCCCCCHHHHHHHHHHSTTT
T ss_pred             HhCccCCCCCcCChHHcCcEE-eeCCCcccHHHHHHHHhHCcCCCCCCCccCCCCCCCCCCHHHHHHHHHHcccc
Confidence            566788999999999999997 89999999999999998666699999999987678899999999999888753
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Back     alignment and structure
>3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 Back     alignment and structure
>3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 Back     alignment and structure
>2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Back     alignment and structure
>1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 Back     alignment and structure
>1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Back     alignment and structure
>2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Back     alignment and structure
>3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 403
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 9e-12
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-11
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 8e-11
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-09
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 8e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 9e-07
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 2e-06
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 3e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 1e-04
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 6e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 7e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 8e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.004
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 58.4 bits (141), Expect = 9e-12
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 20 VELPE-IRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASR 77
          V+ P    K + C IC  I+        C H FCR CI + +++  + CP+CR  C   
Sbjct: 14 VDFPAHFVKSISCQICEHILA-DPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPT 71
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.49
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.48
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.47
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.45
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.44
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.32
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.17
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.12
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.12
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.07
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.06
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.06
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.83
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.61
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.4
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.83
d3d32a1118 GABA(A) receptor associated protein GABARAP {Human 89.17
d2zjda1119 Microtubule-associated proteins 1A/1B light chain 86.77
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.38
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 82.77
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.49  E-value=6.8e-15  Score=114.60  Aligned_cols=68  Identities=22%  Similarity=0.402  Sum_probs=60.4

Q ss_pred             cccccccccccccccccccccCCCCCcccHHHHhhhhhcCCCCCCCCcccccCCCCCCCChhhhHHHHhH
Q 015679           24 EIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISAL   93 (403)
Q Consensus        24 ~l~eel~CpIClel~~dPvtll~CgH~FC~~CI~~~l~~~~~~CP~CR~~~~~~~~l~~n~~L~~lI~~l   93 (403)
                      ++.++|.||||+++|.+||+ ++|||+||+.||.+|+..+...||.|+..+.. ..+.+|..|.++|+.+
T Consensus         4 eiP~~l~CpIc~~~m~dPV~-~~cgh~fc~~ci~~~~~~~~~~cP~~~~~l~~-~~l~pN~~L~~~I~~~   71 (78)
T d1t1ha_           4 EFPEYFRCPISLELMKDPVI-VSTGQTYERSSIQKWLDAGHKTCPKSQETLLH-AGLTPNYVLKSLIALW   71 (78)
T ss_dssp             CCSSSSSCTTTSCCCSSEEE-ETTTEEEEHHHHHHHHTTTCCBCTTTCCBCSS-CCCEECTTTHHHHHHH
T ss_pred             CCCccCCCcCcCchhhCceE-ccCCCcchHHHHHHHHHHCCCCCCcccccCCc-ccccchHHHHHHHHHH
Confidence            45578999999999999997 89999999999999998666789999999886 6788999999998755
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure