Citrus Sinensis ID: 015988

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MDRATDNLSTASSSSDTNPDTPRACSPSSSSSFSSSSSSASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPADLPIASVTSEVSSK
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
ccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccHHccHHEcccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHccHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
mdratdnlstassssdtnpdtpracspsssssfssssssaSSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLmlrapdsdHESALLALLNLAVKdeknkikiveagalepiisflqspdlNLQEYAAAALLTLSassvnkpfisasgaIPLLVEILRYGSQQAKFDAVMALSnlsthpdnlsiilgtnpipsIVDLLIFCKKSSKTAEKCTSLIESLvgfdegrivltseegGVLAVVEVLENGSLQAREHAVGALLMMCQsdrckyrepilregvipglleltiqgtpksQTKARTLLQLlrdspyprselqpdtlENIVCNIIsqidgdeqsGKAKKMLAEMVQVSMEQSLRHLQQRALvctpadlpiasvtsevssk
mdratdnlstassssdtnpdtpRACSPSSSSSFSSSSSSASSAVHRALHliqsddpdlKLEAAREIRRltktsqrcRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLEltiqgtpksqTKARTLLQLLRDSPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVctpadlpiasvtsevssk
MDRATDNLSTASSSSDTNPDTPRACspsssssfssssssassAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYaaaalltlsassVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSeeggvlavvevleNGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPADLPIASVTSEVSSK
*****************************************************************************RQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQG***********L****************TLENIVCNIISQI*****************************QRALVCTPAD*************
*DRATDN**********************************SAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRD***********************************MLAEMV**************ALVCT****************
********************************************HRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPADLPIASVTSEVSSK
MDRATDNLSTASSSSDT*********************SASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSP********DTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPADLP***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRATDNLSTASSSSDTNPDTPRACSPSSSSSFSSSSSSASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLRAPDSDHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPADLPIASVTSEVSSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
O22193826 U-box domain-containing p no no 0.700 0.336 0.337 2e-32
Q5XEZ8707 U-box domain-containing p no no 0.707 0.397 0.347 9e-30
Q8GWV5760 U-box domain-containing p no no 0.680 0.355 0.346 9e-28
Q5VRH9611 U-box domain-containing p no no 0.675 0.438 0.322 1e-22
Q9C7R6729 U-box domain-containing p no no 0.639 0.348 0.353 6e-22
Q9C9A6628 U-box domain-containing p no no 0.647 0.409 0.328 7e-22
Q9CAG5782 U-box domain-containing p no no 0.662 0.336 0.313 2e-21
O48700771 U-box domain-containing p no no 0.566 0.291 0.323 3e-21
Q9ZV31654 U-box domain-containing p no no 0.649 0.394 0.321 5e-18
Q0IMG9694 E3 ubiquitin-protein liga no no 0.763 0.436 0.298 1e-17
>sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 Back     alignment and function desciption
 Score =  140 bits (352), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 165/287 (57%), Gaps = 9/287 (3%)

Query: 38  SSASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQ--AVQPLVLMLRAPD 95
           S   + V + +  ++S   D + +A  E+R L K +   R  +    A+  LV +L + D
Sbjct: 537 SEVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTD 596

Query: 96  S-DHESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASS 154
           S   E+A+ ALLNL++ D  NK  I +AGA+EP+I  L++     +E +AA L +LS   
Sbjct: 597 SATQENAVTALLNLSIND-NNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIE 655

Query: 155 VNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLL 214
            NK  I  SGAI  LV++L  G+ + K DA  AL NLS H +N ++I+ +  +  ++DL+
Sbjct: 656 ENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLM 715

Query: 215 IFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALL 274
                ++   +K  +++ +L    EGR  +  +EGG+  +VEV+E GS + +E+A  ALL
Sbjct: 716 ---DPAAGMVDKAVAVLANLATIPEGRNAI-GQEGGIPLLVEVVELGSARGKENAAAALL 771

Query: 275 MMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRD 321
            +  ++  ++   +L+EG +P L+ L+  GTP+++ KA+ LL   R+
Sbjct: 772 QLS-TNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRN 817
Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7R6|PUB17_ARATH U-box domain-containing protein 17 OS=Arabidopsis thaliana GN=PUB17 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabidopsis thaliana GN=PUB7 PE=2 SV=1 Back     alignment and function description
>sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabidopsis thaliana GN=PUB6 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
224077306389 predicted protein [Populus trichocarpa] 0.947 0.966 0.812 1e-164
356569539384 PREDICTED: U-box domain-containing prote 0.916 0.947 0.815 1e-158
225453144378 PREDICTED: U-box domain-containing prote 0.929 0.976 0.755 1e-157
356539844392 PREDICTED: U-box domain-containing prote 0.921 0.933 0.802 1e-156
449445088381 PREDICTED: U-box domain-containing prote 0.937 0.976 0.776 1e-151
356501045371 PREDICTED: U-box domain-containing prote 0.919 0.983 0.776 1e-151
224069326379 predicted protein [Populus trichocarpa] 0.866 0.907 0.816 1e-148
356553848371 PREDICTED: U-box domain-containing prote 0.919 0.983 0.768 1e-148
357492179375 U-box domain-containing protein [Medicag 0.901 0.954 0.720 1e-134
297828824408 armadillo/beta-catenin repeat family pro 0.836 0.813 0.734 1e-120
>gi|224077306|ref|XP_002305204.1| predicted protein [Populus trichocarpa] gi|222848168|gb|EEE85715.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 313/385 (81%), Positives = 338/385 (87%), Gaps = 9/385 (2%)

Query: 22  PRACSPSSSSSFSSSSS----SASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCR 77
           P +CS + + S SSS++    S S+AV RAL LIQSDD  LK+EAA+EIRRLTKTSQRCR
Sbjct: 5   PSSCSSALTHSTSSSNTDTPPSPSAAVCRALLLIQSDDLSLKIEAAKEIRRLTKTSQRCR 64

Query: 78  RQLAQAVQPLVLMLRAPDSD---HESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQS 134
           RQLA AV+PLV MLR  D D   +ESALLALLNLAVKDEKNKI IVEAGALE IISFLQS
Sbjct: 65  RQLADAVKPLVCMLRVGDDDSVENESALLALLNLAVKDEKNKISIVEAGALESIISFLQS 124

Query: 135 PDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTH 194
            +  LQEYA A+LLTLSAS++NKP ISA GAIPLLVEILR G  QAK DAVMALSNLSTH
Sbjct: 125 QNSILQEYATASLLTLSASTINKPVISACGAIPLLVEILRNGITQAKVDAVMALSNLSTH 184

Query: 195 PDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAV 254
            DNL IIL TNPIPSIV LL  CKKSSKTAEKC +LIESLVGFDEGRI LTSEEGG+LAV
Sbjct: 185 SDNLDIILKTNPIPSIVSLLKTCKKSSKTAEKCCALIESLVGFDEGRIALTSEEGGILAV 244

Query: 255 VEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKART 314
           +EVLENGSLQ+REHAVGALL +CQSDRCKYREPILREGVIPGLLELT+QGTPKSQ+KA+T
Sbjct: 245 IEVLENGSLQSREHAVGALLTLCQSDRCKYREPILREGVIPGLLELTVQGTPKSQSKAQT 304

Query: 315 LLQLLRDSPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQ 374
           LL+LLRD+PYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQ
Sbjct: 305 LLRLLRDTPYPRSELQPDTLENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQ 364

Query: 375 QRALVCTPA--DLPIASVTSEVSSK 397
           QRALVCTP   DLPI+S TSEVSSK
Sbjct: 365 QRALVCTPTPNDLPISSCTSEVSSK 389

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356569539|ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|225453144|ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356539844|ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449445088|ref|XP_004140305.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449479860|ref|XP_004155730.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356501045|ref|XP_003519339.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|224069326|ref|XP_002302956.1| predicted protein [Populus trichocarpa] gi|222844682|gb|EEE82229.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553848|ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|357492179|ref|XP_003616378.1| U-box domain-containing protein [Medicago truncatula] gi|355517713|gb|AES99336.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297828824|ref|XP_002882294.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328134|gb|EFH58553.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2099634408 AT3G03440 "AT3G03440" [Arabido 0.843 0.821 0.656 4.4e-107
TAIR|locus:2135788402 AT4G12710 [Arabidopsis thalian 0.869 0.858 0.428 7.1e-61
TAIR|locus:2145653327 AT5G14510 [Arabidopsis thalian 0.763 0.926 0.335 1.3e-34
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.685 0.328 0.298 2.5e-25
TAIR|locus:2096687355 AT3G01400 [Arabidopsis thalian 0.790 0.884 0.282 2.9e-25
TAIR|locus:2040214468 AT2G25130 [Arabidopsis thalian 0.798 0.677 0.282 6.7e-25
TAIR|locus:2178818357 AT5G58680 "AT5G58680" [Arabido 0.687 0.764 0.303 3.8e-23
TAIR|locus:2102455760 AT3G54790 [Arabidopsis thalian 0.667 0.348 0.312 4.8e-23
TAIR|locus:2116792518 AT4G31890 "AT4G31890" [Arabido 0.783 0.600 0.293 8.2e-23
TAIR|locus:2130699472 AT4G16490 "AT4G16490" [Arabido 0.680 0.572 0.300 9.5e-23
TAIR|locus:2099634 AT3G03440 "AT3G03440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1059 (377.8 bits), Expect = 4.4e-107, P = 4.4e-107
 Identities = 222/338 (65%), Positives = 262/338 (77%)

Query:    43 AVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQAVQPLVLMLR--APDSDHES 100
             ++ R L LI+S+D D +L AA+EIRRLTKTS RCRR  +QAV+PLV MLR  +P+S HE+
Sbjct:    65 SIQRVLSLIRSEDCDSRLFAAKEIRRLTKTSHRCRRHFSQAVEPLVSMLRFDSPESHHEA 124

Query:   101 ALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYXXXXXXXXXXXXVNKPFI 160
             ALLALLNLAVKDEKNK+ I+EAGALEPII+FLQS    LQEY             NKP I
Sbjct:   125 ALLALLNLAVKDEKNKVSIIEAGALEPIINFLQSNSPTLQEYASASLLTLSASANNKPII 184

Query:   161 SASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDNLSIILGTNPIPSIVDLLIFCKKS 220
              A+G +PLLV+++++GS QAK DAVMALSNLST PDNLS+IL T P+  I++LL   KKS
Sbjct:   185 GANGVVPLLVKVIKHGSPQAKADAVMALSNLSTLPDNLSMILATKPLSPILNLLKSSKKS 244

Query:   221 SKTAEKCTSLIESL-VGFDEGRIVLTSXXXXXXXXXXXXXNGSLQAREHAVGALLMMCQS 279
             SKT+EKC SLIE+L V  +E R  L S             NGSLQAREHAVG LL +CQS
Sbjct:   245 SKTSEKCCSLIEALMVSGEEARTGLVSDEGGVLAVVEVLENGSLQAREHAVGVLLTLCQS 304

Query:   280 DRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSPYPRSELQPDTLENIVC 339
             DR KYREPILREGVIPGLLELT+QGT KS+ KA+ LL LLR+S  PRSE+QPDT+ENIV 
Sbjct:   305 DRSKYREPILREGVIPGLLELTVQGTSKSRIKAQRLLCLLRNSESPRSEVQPDTIENIVS 364

Query:   340 NIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRA 377
             ++IS IDGD+QSGKAKKMLAEMVQVSME+SLRHLQ+RA
Sbjct:   365 SLISHIDGDDQSGKAKKMLAEMVQVSMEKSLRHLQERA 402
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2135788 AT4G12710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145653 AT5G14510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096687 AT3G01400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040214 AT2G25130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178818 AT5G58680 "AT5G58680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102455 AT3G54790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116792 AT4G31890 "AT4G31890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130699 AT4G16490 "AT4G16490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-14
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-12
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-12
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 2e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 7e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 1e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 2e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-05
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 6e-05
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-04
COG5064 526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 2e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.003
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information 
 Score = 68.5 bits (168), Expect = 3e-14
 Identities = 32/115 (27%), Positives = 64/115 (55%), Gaps = 3/115 (2%)

Query: 41  SSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQL--AQAVQPLVLMLRAPDSD- 97
           +  +   + L+ S D +++ EAA  +  L+  +    + +  A  +  LV +L++ D + 
Sbjct: 6   AGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEV 65

Query: 98  HESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSA 152
            ++AL AL NLA   E NK+ ++EAG +  +++ L S + ++Q+ A  AL  L++
Sbjct: 66  VKAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLAS 120

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.97
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.97
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.97
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.96
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.96
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.95
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.93
KOG1048717 consensus Neural adherens junction protein Plakoph 99.88
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.88
PF05804708 KAP: Kinesin-associated protein (KAP) 99.86
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.79
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.77
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.75
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.73
KOG1048717 consensus Neural adherens junction protein Plakoph 99.68
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.67
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.65
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.64
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.53
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.46
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.41
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.39
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.37
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.33
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.29
PRK09687280 putative lyase; Provisional 99.2
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.19
PRK09687280 putative lyase; Provisional 99.18
KOG3678 832 consensus SARM protein (with sterile alpha and arm 99.12
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.1
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 99.09
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.06
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.04
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.0
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.96
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.95
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.9
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.89
KOG1293 678 consensus Proteins containing armadillo/beta-caten 98.88
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.86
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.85
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.84
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.78
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.72
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.72
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.71
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.63
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.55
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.55
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.52
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.52
PTZ00429 746 beta-adaptin; Provisional 98.39
KOG4646173 consensus Uncharacterized conserved protein, conta 98.35
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.35
PF05536 543 Neurochondrin: Neurochondrin 98.28
KOG4413 524 consensus 26S proteasome regulatory complex, subun 98.26
KOG4646173 consensus Uncharacterized conserved protein, conta 98.21
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.19
PTZ00429 746 beta-adaptin; Provisional 98.18
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.14
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 98.13
COG5369743 Uncharacterized conserved protein [Function unknow 98.11
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 98.08
KOG0212 675 consensus Uncharacterized conserved protein [Funct 98.08
PF05536 543 Neurochondrin: Neurochondrin 98.06
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.03
TIGR02270410 conserved hypothetical protein. Members are found 98.01
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.98
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 97.92
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.92
COG5369743 Uncharacterized conserved protein [Function unknow 97.89
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.89
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.86
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.81
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.73
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.73
KOG4413524 consensus 26S proteasome regulatory complex, subun 97.71
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.71
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.7
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.65
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.62
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.61
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 97.56
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.52
TIGR02270410 conserved hypothetical protein. Members are found 97.51
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.47
KOG1242569 consensus Protein containing adaptin N-terminal re 97.45
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.45
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 97.45
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.4
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 97.39
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.35
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.34
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.32
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.3
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.25
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.2
KOG1824 1233 consensus TATA-binding protein-interacting protein 97.18
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 97.11
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.11
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.1
PF05004309 IFRD: Interferon-related developmental regulator ( 97.09
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 97.09
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 97.05
KOG1242569 consensus Protein containing adaptin N-terminal re 97.04
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 97.04
KOG3036293 consensus Protein involved in cell differentiation 96.92
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.84
KOG2259 823 consensus Uncharacterized conserved protein [Funct 96.81
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.73
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.63
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.58
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 96.51
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.46
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.44
KOG3036293 consensus Protein involved in cell differentiation 96.42
PRK14707 2710 hypothetical protein; Provisional 96.41
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.38
KOG2259 823 consensus Uncharacterized conserved protein [Funct 96.37
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.34
KOG1824 1233 consensus TATA-binding protein-interacting protein 96.24
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 96.2
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.19
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 96.16
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.14
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.11
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 96.09
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.05
KOG0567289 consensus HEAT repeat-containing protein [General 95.99
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.95
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.9
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 95.9
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.81
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.81
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.76
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.71
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 95.68
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.64
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 95.59
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.54
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 95.38
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 95.35
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 95.32
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.31
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 95.29
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.28
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 95.23
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 95.23
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 95.22
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.16
KOG2032533 consensus Uncharacterized conserved protein [Funct 95.07
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.0
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.95
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.9
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 94.9
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 94.82
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 94.79
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 94.79
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 94.75
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 94.58
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.49
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.42
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 94.37
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 94.3
PF05004309 IFRD: Interferon-related developmental regulator ( 94.27
COG5096 757 Vesicle coat complex, various subunits [Intracellu 94.2
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.92
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 93.9
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 93.81
KOG4653982 consensus Uncharacterized conserved protein [Funct 93.66
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 93.65
KOG2032533 consensus Uncharacterized conserved protein [Funct 93.62
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 93.59
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 93.45
PF07814361 WAPL: Wings apart-like protein regulation of heter 93.3
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 93.24
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.04
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 93.02
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 92.9
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 92.83
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 92.73
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.7
KOG4653982 consensus Uncharacterized conserved protein [Funct 92.56
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 92.5
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 92.48
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 92.44
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 92.29
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 92.17
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 92.15
PRK14707 2710 hypothetical protein; Provisional 91.99
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 91.76
KOG2933334 consensus Uncharacterized conserved protein [Funct 91.31
COG5209315 RCD1 Uncharacterized protein involved in cell diff 91.15
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 91.1
KOG04141251 consensus Chromosome condensation complex Condensi 90.76
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 90.62
KOG0567289 consensus HEAT repeat-containing protein [General 90.3
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 90.16
KOG0301745 consensus Phospholipase A2-activating protein (con 90.09
KOG2137700 consensus Protein kinase [Signal transduction mech 89.71
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 89.64
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 88.89
KOG4535728 consensus HEAT and armadillo repeat-containing pro 88.77
KOG2137700 consensus Protein kinase [Signal transduction mech 88.72
KOG0301745 consensus Phospholipase A2-activating protein (con 88.55
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 87.91
cd03561133 VHS VHS domain family; The VHS domain is present i 87.8
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 87.76
PF1036392 DUF2435: Protein of unknown function (DUF2435) 87.51
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 87.37
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 87.22
KOG0414 1251 consensus Chromosome condensation complex Condensi 87.17
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 87.03
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 86.84
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 86.38
PF08167165 RIX1: rRNA processing/ribosome biogenesis 86.19
COG50981128 Chromosome condensation complex Condensin, subunit 86.0
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 85.81
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 85.79
KOG2933334 consensus Uncharacterized conserved protein [Funct 85.36
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 84.77
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 84.6
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 84.03
KOG2956516 consensus CLIP-associating protein [General functi 83.8
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 83.8
COG5209315 RCD1 Uncharacterized protein involved in cell diff 83.79
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 83.57
PF08167165 RIX1: rRNA processing/ribosome biogenesis 83.56
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 83.33
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 83.14
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 83.09
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 82.92
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 82.03
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 81.72
KOG1566342 consensus Conserved protein Mo25 [Function unknown 81.68
KOG2956516 consensus CLIP-associating protein [General functi 80.37
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=99.97  E-value=2.4e-29  Score=271.15  Aligned_cols=325  Identities=19%  Similarity=0.237  Sum_probs=276.9

Q ss_pred             cchhhhHHHHHHHhcCCCHHHHHHHHHHHHHHhhhChHHHHHHHHh--HHHHHHhhcC-CChhHHHHHHHHHHhhhcChh
Q 015988           38 SSASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQA--VQPLVLMLRA-PDSDHESALLALLNLAVKDEK  114 (397)
Q Consensus        38 ~~~~~~l~~lv~lL~s~~~~~~~~a~~~L~~l~~~~~~~~~~l~~~--v~~Lv~lL~~-~~~~~~~a~~~L~~L~~~~~~  114 (397)
                      +.+.++++.|+.+|...+.++|..+++.|+.++.++.+.+..+.+.  ++.|+++|++ ....++.|++.|.+++.++++
T Consensus       400 L~~~daik~LV~LL~~~~~evQ~~Av~aL~~L~~~~~e~~~aIi~~ggIp~LV~LL~s~s~~iQ~~A~~~L~nLa~~nde  479 (2102)
T PLN03200        400 LNHAEAKKVLVGLITMATADVQEELIRALSSLCCGKGGLWEALGGREGVQLLISLLGLSSEQQQEYAVALLAILTDEVDE  479 (2102)
T ss_pred             HHhccchhhhhhhhccCCHHHHHHHHHHHHHHhCCCHHHHHHHHHcCcHHHHHHHHcCCCHHHHHHHHHHHHHHHcCCHH
Confidence            3456788899999999999999999999999999887888877764  9999999998 334699999999999998889


Q ss_pred             hHHHHHHcCChHHHHHhhCCCCHHHHHHHHHHHHHHhcCCCCchh-hhhcCCHHHHHHHHhcCCHHHHHHHHHHHHhhcC
Q 015988          115 NKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSVNKPF-ISASGAIPLLVEILRYGSQQAKFDAVMALSNLST  193 (397)
Q Consensus       115 ~~~~i~~~g~i~~L~~lL~~~~~~~~~~a~~~L~nLs~~~~~~~~-i~~~g~i~~L~~lL~~~~~~~~~~a~~aL~nLs~  193 (397)
                      ++..++++|++|+|+++|.+++..+++.|+++|+|++.++++... +.+.|+++.|+++|++++.+++..|+++|.||+.
T Consensus       480 nr~aIieaGaIP~LV~LL~s~~~~iqeeAawAL~NLa~~~~qir~iV~~aGAIppLV~LL~sgd~~~q~~Aa~AL~nLi~  559 (2102)
T PLN03200        480 SKWAITAAGGIPPLVQLLETGSQKAKEDSATVLWNLCCHSEDIRACVESAGAVPALLWLLKNGGPKGQEIAAKTLTKLVR  559 (2102)
T ss_pred             HHHHHHHCCCHHHHHHHHcCCCHHHHHHHHHHHHHHhCCcHHHHHHHHHCCCHHHHHHHHhCCCHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999997765555 4478999999999999999999999999999964


Q ss_pred             CchhH-------------------------------------HH-HHhCCChHHHHHHhhhcccChHHHHHHHHHHHHhc
Q 015988          194 HPDNL-------------------------------------SI-ILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLV  235 (397)
Q Consensus       194 ~~~~~-------------------------------------~~-i~~~g~i~~Lv~ll~~~~~~~~~~~~a~~~L~nL~  235 (397)
                      ..++.                                     .. ....|+++.|+++++++  +..+++.|+++|.|++
T Consensus       560 ~~d~~~I~~Lv~LLlsdd~~~~~~aL~vLgnIlsl~~~~d~~~~g~~~~ggL~~Lv~LL~sg--s~~ikk~Aa~iLsnL~  637 (2102)
T PLN03200        560 TADAATISQLTALLLGDLPESKVHVLDVLGHVLSVASLEDLVREGSAANDALRTLIQLLSSS--KEETQEKAASVLADIF  637 (2102)
T ss_pred             ccchhHHHHHHHHhcCCChhHHHHHHHHHHHHHhhcchhHHHHHhhhccccHHHHHHHHcCC--CHHHHHHHHHHHHHHh
Confidence            32110                                     11 11368999999999986  3578899999999998


Q ss_pred             CCcccchhhhhccCcHHHHHHHHhcCCHHHHHHHHHHHHHHhccCchhhHHHHHHcCChHHHHHHhhcCCHHHHHHHHHH
Q 015988          236 GFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTL  315 (397)
Q Consensus       236 ~~~~~~~~~~~~~g~i~~Lv~lL~~~~~~v~~~a~~~L~~L~~~~~~~~r~~i~~~g~v~~L~~ll~~~~~~~~~~A~~~  315 (397)
                      .+.......+...|+|++|+.+|.+++.+++..++++|.|++....++.+..+++.|+++.|++++.+.+..+.+.|+.+
T Consensus       638 a~~~d~~~avv~agaIpPLV~LLss~~~~v~keAA~AL~nL~~~~~~~q~~~~v~~GaV~pL~~LL~~~d~~v~e~Al~A  717 (2102)
T PLN03200        638 SSRQDLCESLATDEIINPCIKLLTNNTEAVATQSARALAALSRSIKENRKVSYAAEDAIKPLIKLAKSSSIEVAEQAVCA  717 (2102)
T ss_pred             cCChHHHHHHHHcCCHHHHHHHHhcCChHHHHHHHHHHHHHHhCCCHHHHHHHHHcCCHHHHHHHHhCCChHHHHHHHHH
Confidence            76665433344899999999999999999999999999999986644556778899999999999999999999999999


Q ss_pred             HHHhhcCCC-CCcccCcCchHHHHHHhhccCccchhh-HHHHHHHHHHHHHhHH
Q 015988          316 LQLLRDSPY-PRSELQPDTLENIVCNIISQIDGDEQS-GKAKKMLAEMVQVSME  367 (397)
Q Consensus       316 L~~l~~~~~-~~~~~~~~~~~~ll~~l~~~~~~~~~~-~~A~~~L~~l~~~~~~  367 (397)
                      |.++...++ ..++..++++++++.-|.   +|++++ +.|..+|..|++....
T Consensus       718 LanLl~~~e~~~ei~~~~~I~~Lv~lLr---~G~~~~k~~Aa~AL~~L~~~~~~  768 (2102)
T PLN03200        718 LANLLSDPEVAAEALAEDIILPLTRVLR---EGTLEGKRNAARALAQLLKHFPV  768 (2102)
T ss_pred             HHHHHcCchHHHHHHhcCcHHHHHHHHH---hCChHHHHHHHHHHHHHHhCCCh
Confidence            999998887 445667889999887664   677777 8899999888876553

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 6e-06
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 2e-05
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 4e-04
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 4e-04
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 4e-04
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 85/177 (48%), Gaps = 7/177 (3%)
Query: 44  VHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQL--AQAVQPLVLMLRAPDSD-HES 100
           V + + L+ S D + + EAAR++  +        + +  A  V+ LV +L + DS+  + 
Sbjct: 4   VEKLVKLLTSTDSETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQKE 63
Query: 101 ALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYXXXXXXXXXXX--XVNKP 158
           A  AL N+A   ++    IV+AG +E ++  L S D  +Q+                 K 
Sbjct: 64  AARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKA 123
Query: 159 FISASGAIPLLVEILRYGSQQAKFDAVMALSNLSTHPDN-LSIILGTNPIPSIVDLL 214
            + A G + +LV++L     + + +A  AL+N+++ PD  +  I+    +  +V LL
Sbjct: 124 IVDAGG-VEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 179
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-44
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-25
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-25
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-39
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-36
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-30
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-29
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-26
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-39
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-38
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-32
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-29
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-27
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-19
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-37
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-32
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 9e-20
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-18
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-36
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-33
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-30
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-20
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-18
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 6e-13
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-34
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-29
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-27
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-23
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-16
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-32
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-31
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-06
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-32
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-31
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-18
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 8e-32
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-25
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-22
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 4e-17
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-09
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-27
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-22
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 9e-18
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 9e-18
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 7e-13
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-25
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 8e-22
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 4e-13
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-04
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-24
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-15
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-11
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-22
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 4e-22
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-14
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-09
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-09
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-19
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-18
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-12
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-10
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-08
3grl_A 651 General vesicular transport factor P115; vesicle t 5e-07
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-05
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 3e-04
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 8e-04
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 8e-04
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
 Score =  152 bits (387), Expect = 4e-44
 Identities = 48/235 (20%), Positives = 111/235 (47%), Gaps = 7/235 (2%)

Query: 48  LHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQA--VQPLVLMLRAPDSD-HESALLA 104
              + SDD   +L A R+  ++        + +  A  +  LV +L +P+    + AL A
Sbjct: 18  TQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 77

Query: 105 LLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSA-SSVNKPFISAS 163
           L N+A    +    +++AGAL  ++  L SP+  + + A  AL  +++  +     +  +
Sbjct: 78  LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDA 137

Query: 164 GAIPLLVEILRYGSQQAKFDAVMALSNLSTH-PDNLSIILGTNPIPSIVDLLIFCKKSSK 222
           GA+P LV++L   ++Q   +A+ ALSN+++   + +  ++    +P++V LL     + +
Sbjct: 138 GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLS--SPNEQ 195

Query: 223 TAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAVGALLMMC 277
             ++    + ++      +     E G +  + ++  + + + ++ A  AL  + 
Sbjct: 196 ILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQ 250
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.98
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.98
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.98
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.97
3nmz_A458 APC variant protein; protein-protein complex, arma 99.97
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.97
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.97
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.97
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.96
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.96
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.95
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.95
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.95
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.95
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.95
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.94
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.93
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.93
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.92
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.91
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.9
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.87
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.85
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.85
3grl_A 651 General vesicular transport factor P115; vesicle t 99.64
3grl_A 651 General vesicular transport factor P115; vesicle t 99.61
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.41
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.34
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.32
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.3
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.27
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.19
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.19
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 99.17
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.14
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.1
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.08
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.06
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.05
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.99
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.92
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.9
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.9
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.83
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.75
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.7
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.69
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.67
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.66
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.63
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.63
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.53
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.4
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.27
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.26
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.23
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.14
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.09
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.98
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.93
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.92
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.85
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.84
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.84
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.8
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.78
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.77
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.74
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.58
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.52
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.32
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.22
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.82
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.73
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.35
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.3
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 96.22
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.03
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 95.69
2x19_B963 Importin-13; nuclear transport, protein transport; 95.48
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.47
2x1g_F971 Cadmus; transport protein, developmental protein, 95.35
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 94.93
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 94.46
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.34
2x1g_F 971 Cadmus; transport protein, developmental protein, 93.96
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 93.96
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 93.89
2x19_B 963 Importin-13; nuclear transport, protein transport; 93.76
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 93.66
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 93.63
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 93.55
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 93.53
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 92.93
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 92.7
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 92.0
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 91.67
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 91.59
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 91.25
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 91.13
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 91.02
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 89.52
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 89.34
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 88.77
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 88.02
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 87.92
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 87.8
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 87.45
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 86.01
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 85.27
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 83.52
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 82.66
3g2s_A149 C-terminal fragment of sortilin-related receptor; 82.56
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 81.91
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 81.49
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 81.49
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 80.44
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
Probab=100.00  E-value=1.1e-33  Score=281.03  Aligned_cols=327  Identities=17%  Similarity=0.214  Sum_probs=271.2

Q ss_pred             cchhhhHHHHHHHhcCCCHHHHHHHHHHHHHHhhhChHHHHHHHHh--HHHHHHhhcCCC-hhHHHHHHHHHHhhhc-Ch
Q 015988           38 SSASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQA--VQPLVLMLRAPD-SDHESALLALLNLAVK-DE  113 (397)
Q Consensus        38 ~~~~~~l~~lv~lL~s~~~~~~~~a~~~L~~l~~~~~~~~~~l~~~--v~~Lv~lL~~~~-~~~~~a~~~L~~L~~~-~~  113 (397)
                      ....+.++.+|++|.++++.+|..|+++|.+++..++++|..+.+.  ||.||++|++++ .+++.|+++|.||+.+ ++
T Consensus        44 ~~~~~~i~~LV~~L~s~~~~~q~~Aa~~L~~La~~~~~~k~~V~~~G~Ip~LV~LL~s~~~~vq~~Aa~AL~nLa~~~~~  123 (584)
T 3l6x_A           44 NWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQ  123 (584)
T ss_dssp             CCCCCCHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHHHHHTSSSCH
T ss_pred             CcccccHHHHHHHHCCCCHHHHHHHHHHHHHHHcCChHHHHHHHHcCCcHHHHHHHCCCCHHHHHHHHHHHHHHHccCCH
Confidence            3467789999999999999999999999999999888999988875  999999999944 3799999999999985 68


Q ss_pred             hhHHHHHHcCChHHHHHhhCC-CCHHHHHHHHHHHHHHhcCCCCchhhhhcCCHHHHHHHHh------------------
Q 015988          114 KNKIKIVEAGALEPIISFLQS-PDLNLQEYAAAALLTLSASSVNKPFISASGAIPLLVEILR------------------  174 (397)
Q Consensus       114 ~~~~~i~~~g~i~~L~~lL~~-~~~~~~~~a~~~L~nLs~~~~~~~~i~~~g~i~~L~~lL~------------------  174 (397)
                      ++|..|++.|+|++|+.+|++ .+.++++.++.+||||+.++++|..|++ ++++.|++++.                  
T Consensus       124 ~nk~~I~~~GaIp~LV~LL~s~~~~~~~e~aa~aL~nLS~~~~~k~~I~~-~alp~Lv~LL~~p~sg~~~~~~~~~k~~~  202 (584)
T 3l6x_A          124 DNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVD-HALHALTDEVIIPHSGWEREPNEDCKPRH  202 (584)
T ss_dssp             HHHHHHHHTTHHHHHHHHHHHCCSHHHHHHHHHHHHHHTTSGGGHHHHHH-HTHHHHHHHTHHHHHCCC----------C
T ss_pred             HHHHHHHHcCCHHHHHHHHcCCCCHHHHHHHHHHHHHHhCCchhhHHHHh-ccHHHHHHHHhcccccccccccccccccc
Confidence            999999999999999999997 5788999999999999999899999985 57999999872                  


Q ss_pred             cCCHHHHHHHHHHHHhhcCCch-hHHHHHh-CCChHHHHHHhhhc----ccChHHHHHHHHHHHHhcCCc----------
Q 015988          175 YGSQQAKFDAVMALSNLSTHPD-NLSIILG-TNPIPSIVDLLIFC----KKSSKTAEKCTSLIESLVGFD----------  238 (397)
Q Consensus       175 ~~~~~~~~~a~~aL~nLs~~~~-~~~~i~~-~g~i~~Lv~ll~~~----~~~~~~~~~a~~~L~nL~~~~----------  238 (397)
                      ..+++++++|+++|+||+...+ +++.+++ .|+++.|++++++.    ..+.+.++.|+++|+||+...          
T Consensus       203 ~~d~~V~~nAa~~L~NLs~~~~~~R~~i~~~~Gli~~LV~~L~~~~~~~~~~~~~~enav~aL~NLs~~~~~e~~~~~~~  282 (584)
T 3l6x_A          203 IEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY  282 (584)
T ss_dssp             CCCHHHHHHHHHHHHHHTSSCHHHHHHHHHSTTHHHHHHHHHHHHHHTTCCSCHHHHHHHHHHHHHHTTHHHHSTTCCC-
T ss_pred             cccHHHHHHHHHHHHHHhcCCHHHHHHHHHcCCcHHHHHHHHHHhhcccCccHHHHHHHHHHHHHhhccccccccchhhh
Confidence            2357999999999999999764 5888888 46678999999863    234678999999999998652          


Q ss_pred             ----------------ccchhhhhccCcHHHHHHHHh-cCCHHHHHHHHHHHHHHhccCc---hhhHHHHHHcCChHHHH
Q 015988          239 ----------------EGRIVLTSEEGGVLAVVEVLE-NGSLQAREHAVGALLMMCQSDR---CKYREPILREGVIPGLL  298 (397)
Q Consensus       239 ----------------~~~~~~~~~~g~i~~Lv~lL~-~~~~~v~~~a~~~L~~L~~~~~---~~~r~~i~~~g~v~~L~  298 (397)
                                      .+...++ +.++++.|+.+|. +.++.+++.|+++|.|||.+..   ...+..+.+.|++|.|+
T Consensus       283 ~~~~~~~~~~~~~~~~~Gve~L~-~~~~v~~Ll~LL~~s~~~~v~E~Aa~AL~nL~ag~~~~~~~~~~~v~~~~glp~Lv  361 (584)
T 3l6x_A          283 QEAAPNVANNTGTSPARGYELLF-QPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIA  361 (584)
T ss_dssp             -------------CCCCGGGGGG-SHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSSCSHHHHHHHHHHTSHHHHHHHH
T ss_pred             hhhcccccccccccCchhHHHHh-cccHHHHHHHHHccCCCHHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCcHHHHH
Confidence                            1222223 4566888999996 4579999999999999998652   13455556689999999


Q ss_pred             HHhhcCCHHHHHHHHHHHHHhhcCCCCCcccCcCchHHHHHHhhccCcc-----chhh-HHHHHHHHHHHHHhH
Q 015988          299 ELTIQGTPKSQTKARTLLQLLRDSPYPRSELQPDTLENIVCNIISQIDG-----DEQS-GKAKKMLAEMVQVSM  366 (397)
Q Consensus       299 ~ll~~~~~~~~~~A~~~L~~l~~~~~~~~~~~~~~~~~ll~~l~~~~~~-----~~~~-~~A~~~L~~l~~~~~  366 (397)
                      ++|.++++.+++.|+++|++|+.++..+..+..++++.++..|......     .+.. ..|+..|.+|+..+.
T Consensus       362 ~LL~s~~~~v~~~A~~aL~nLs~~~~~~~~I~~g~ip~LV~LL~~~~~~~~~~~s~~v~~~a~~tL~NL~a~~~  435 (584)
T 3l6x_A          362 DLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENL  435 (584)
T ss_dssp             HGGGCSCHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTSSSSSCSGGGTCCHHHHHHHHHHHHHHHTTCH
T ss_pred             HHHcCCCHHHHHHHHHHHHHHhCChhHHHHHHhCCHHHHHHHhcCCcccccccchHHHHHHHHHHHHHHhcCCH
Confidence            9999999999999999999999998888888889999999766432111     2233 778899999987654
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 9e-16
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-15
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-11
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-11
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-09
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-15
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-13
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-09
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-07
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-05
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-12
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 7e-12
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-06
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-10
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-10
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 4e-05
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 6e-04
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.5 bits (186), Expect = 9e-16
 Identities = 32/184 (17%), Positives = 71/184 (38%), Gaps = 7/184 (3%)

Query: 40  ASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLA--QAVQPLVLMLRAPDSD 97
           A+ A+     L+  +D  +  +AA  + +L+K        +   Q V  +V  ++  +  
Sbjct: 15  ATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDV 74

Query: 98  --HESALLALLNLAVKDEKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSV 155
                    L NL+    +  + I ++G +  ++  L SP  ++  YA   L  L     
Sbjct: 75  ETARCTAGTLHNLS-HHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQE 133

Query: 156 NKPFISA-SGAIPLLVEILRYGSQQAKFDAVMALSNL-STHPDNLSIILGTNPIPSIVDL 213
                   +G +  +V +L   + +        L  L   + ++  IIL +    ++V++
Sbjct: 134 GAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNI 193

Query: 214 LIFC 217
           +   
Sbjct: 194 MRTY 197
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.94
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.94
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.94
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.93
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.79
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.79
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.87
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.82
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.73
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.71
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.71
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.67
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.67
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.43
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.22
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.05
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.97
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.95
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.95
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.95
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.74
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.62
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.56
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.38
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.6
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 95.62
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 92.41
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 92.38
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 92.01
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 90.68
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 89.82
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 85.79
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 84.09
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 83.83
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 82.15
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 80.35
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=9.1e-28  Score=237.70  Aligned_cols=318  Identities=18%  Similarity=0.198  Sum_probs=264.9

Q ss_pred             cchhhhHHHHHHHhcCCCHHHHHHHHHHHHHHhhhChHHHHHHHH--h-HHHHHHhhcC-CCh-hHHHHHHHHHHhhhcC
Q 015988           38 SSASSAVHRALHLIQSDDPDLKLEAAREIRRLTKTSQRCRRQLAQ--A-VQPLVLMLRA-PDS-DHESALLALLNLAVKD  112 (397)
Q Consensus        38 ~~~~~~l~~lv~lL~s~~~~~~~~a~~~L~~l~~~~~~~~~~l~~--~-v~~Lv~lL~~-~~~-~~~~a~~~L~~L~~~~  112 (397)
                      ....+.+|.|+++|++++..++..|+..|.+++.++ ..+..+..  . ++.|+.+|+. .+. +++.|+.+|.+++. +
T Consensus        13 ~~~~~aip~L~~lL~~~~~~v~~~A~~~l~~l~~~~-~~~~~~~~~~~~v~~l~~~L~~~~~~~~~~~a~~~L~~l~~-~   90 (529)
T d1jdha_          13 ELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKE-ASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSH-H   90 (529)
T ss_dssp             ----CHHHHHHHHHTCSCHHHHHHHHHHHHHHHTSH-HHHHHHHTCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHTT-S
T ss_pred             HHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcc-HHHHHHHHhhhHHHHHHHHHcCCCCHHHHHHHHHHHHHHhC-C
Confidence            345688999999999999999999999999999765 55555443  2 9999999976 443 68899999999997 7


Q ss_pred             hhhHHHHHHcCChHHHHHhhCCCCHHHHHHHHHHHHHHhcCCC-CchhhhhcCCHHHHHHHHhcCCHHHHHHHHHHHHhh
Q 015988          113 EKNKIKIVEAGALEPIISFLQSPDLNLQEYAAAALLTLSASSV-NKPFISASGAIPLLVEILRYGSQQAKFDAVMALSNL  191 (397)
Q Consensus       113 ~~~~~~i~~~g~i~~L~~lL~~~~~~~~~~a~~~L~nLs~~~~-~~~~i~~~g~i~~L~~lL~~~~~~~~~~a~~aL~nL  191 (397)
                      ++++..+++.|++++|+.+|++++++++..|+++|+|++.+.+ .+..+.+.|+++.|+.+|++++++++..++++|.++
T Consensus        91 ~~~~~~i~~~g~i~~Li~lL~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~~~~~~a~~~L~~l  170 (529)
T d1jdha_          91 REGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQIL  170 (529)
T ss_dssp             HHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCTTHHHHHHHHTHHHHHHHGGGCCCHHHHHHHHHHHHHH
T ss_pred             chhHHHHHHCCCHHHHHHHhCCCCHHHHHHHHHHHHHhhcccchhhhHHHhcCCchHHHHHHHccChHHHHHHHHHHHHH
Confidence            8999999999999999999999999999999999999998765 566777999999999999999999999999999999


Q ss_pred             cCC-chhHHHHHhCCChHHHHHHhhhcccChHHHHHHHHHHHHhcCCcccchhhhhccCcHHHHHHHHhcCCHHHHHHHH
Q 015988          192 STH-PDNLSIILGTNPIPSIVDLLIFCKKSSKTAEKCTSLIESLVGFDEGRIVLTSEEGGVLAVVEVLENGSLQAREHAV  270 (397)
Q Consensus       192 s~~-~~~~~~i~~~g~i~~Lv~ll~~~~~~~~~~~~a~~~L~nL~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~~v~~~a~  270 (397)
                      +.. .+++..+.+.|+++.|+.+++..+ ...++..+.+++.+++.+++++..++ +.|+++.|+.++.++++.++..++
T Consensus       171 ~~~~~~~~~~~~~~~~~~~L~~ll~~~~-~~~~~~~~~~~l~~ls~~~~~~~~~~-~~g~~~~L~~ll~~~~~~~~~~a~  248 (529)
T d1jdha_         171 AYGNQESKLIILASGGPQALVNIMRTYT-YEKLLWTTSRVLKVLSVCSSNKPAIV-EAGGMQALGLHLTDPSQRLVQNCL  248 (529)
T ss_dssp             HTTCHHHHHHHHHTTHHHHHHHHHHHCC-CHHHHHHHHHHHHHHTTSTTHHHHHH-HTTHHHHHHTTTTSSCHHHHHHHH
T ss_pred             hhhhhHHHHHHHhcccchHHHHHHHhhh-hHHHHHHHHHHHhhhhccccccchhh-hhhhhhhHHHHhcccchhhhhhhh
Confidence            975 556677788999999999998863 46788999999999999999998887 889999999999999999999999


Q ss_pred             HHHHHHhccCchhhHHHHHHcCChHHHHHHhhcCCHHHHHHHHHHHHHhhcCCC-C-CcccCcCchHHHHHHhhccCccc
Q 015988          271 GALLMMCQSDRCKYREPILREGVIPGLLELTIQGTPKSQTKARTLLQLLRDSPY-P-RSELQPDTLENIVCNIISQIDGD  348 (397)
Q Consensus       271 ~~L~~L~~~~~~~~r~~i~~~g~v~~L~~ll~~~~~~~~~~A~~~L~~l~~~~~-~-~~~~~~~~~~~ll~~l~~~~~~~  348 (397)
                      ++|.+++...    +......|+++.|++++.++++.+++.|+++|.+++.+.. . ..+.+.++++.++..+....+..
T Consensus       249 ~~l~~ls~~~----~~~~~~~~~i~~Lv~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~Li~~l~~~~~~~  324 (529)
T d1jdha_         249 WTLRNLSDAA----TKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDRE  324 (529)
T ss_dssp             HHHHHHHTTC----TTCSCCHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTTTCHHHHHHHHHTTHHHHHHHHHHHHTTCH
T ss_pred             hHHHhccccc----cchhhhhhcchhhhhhcccccHHHHHHHHHHHHhhccchhHHHHHHHHhhhHHHHHHHHHhhhcch
Confidence            9999998654    2223346789999999999999999999999999976543 3 33456688888886664322333


Q ss_pred             hhhHHHHHHHHHHHH
Q 015988          349 EQSGKAKKMLAEMVQ  363 (397)
Q Consensus       349 ~~~~~A~~~L~~l~~  363 (397)
                      +..+.|...|+++..
T Consensus       325 ~~~~~a~~aL~~l~~  339 (529)
T d1jdha_         325 DITEPAICALRHLTS  339 (529)
T ss_dssp             HHHHHHHHHHHHHTS
T ss_pred             hHHHHHHHHhhcccc
Confidence            333778888888863
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure