Citrus Sinensis ID: 016032

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCGKADKKQKHKFGDESEDSDDDTSKLKRKNVRSKKSRKS
ccccEEccccEEEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEccccccEEEEEcccccEEEEEccccEEEEEEcccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccEEEEcccccEEEEEEEccccccEEEEEEccccEEEEEccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEccccccccccEEEEEcccccEEEEEEEccccccccccEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEEEcccccEEEEEccccEEEEEcccccEEEEEccccEEEEEEEcccccccccccccccccccEEEEccccccccccccc
cccEEEEccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEccccccEEEEcccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEcccccccccccccccEEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEEEccccccEEEEEccccEEEEEEccccccEEEEEcccccccEEEEEEcccccEEEEcccccEEEEEEccccccccccccEcccccccEEEEEEEEEEcccccEEEEEEEccccccEEEcccccEEEEEEcccccEEEEccccccccEEEEEEEcccccEEEEccccEEEEEEcccccEcEEEcccccccEEEEEEcccccEEEEccccccccccHHccccccccccccc
mkpahvipdqvncavIRYHsrrvtclefhptnnhillsgdkkgqvgvwDFYKVSEKIVYGNIHSCIVnnirfnptndgtvyaassdgtvsctdLETGLALSLmnvnpngwhgprtwrmlygmdinpekgVVLVADNFGFLYLVDartnsrsgeAILIHrkgskvvglhcnpiqpelllscgndhfarIWDIRRleagsslcdlphkrvvnsayfspsgskilttsqdnrLRIWDSIfgnldspsreivhshdfnrhltpfraewdpkdpsesLAVIGRYIsenyngaalhpidfiditTGQLVAevmdpnittispvnklhprddvlasgssrsifiwrpkeksELVEQKEEMKIIVCgkadkkqkhkfgdesedsdddtsklkrknvrskksrks
mkpahvipdqvncAVIRYHSRRVTCLEFhptnnhillsgdkkgqvGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVvnsayfspsgskilttsqdnrLRIWDSIFGNLDSPSREIVHSHDFNRHLTpfraewdpkdpSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNIttispvnklhprddvlasgssrsifiwrpkekselveQKEEMKIivcgkadkkqkhkfgdesedsdddtsklkrknvrskksrks
MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCGKADKKQKHKFGdesedsdddTsklkrknvrskksrks
*****VIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEW*******SLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLA****RSIFIWR**************KIIVC**************************************
MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCGKADKKQKHKFG**SEDSDDDTSKLKR***********
MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCGKA***********************************
MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCGKADKKQKHKFGDESEDSDDDTSKLKR***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCGKADKKQKHKFGDESEDSDDDTSKLKRKNVRSKKSRKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
Q6NQ88557 Protein DAMAGED DNA-BINDI yes no 0.904 0.642 0.777 1e-170
Q5ZJL7507 DNA damage-binding protei yes no 0.881 0.688 0.328 5e-42
Q66JG1501 DNA damage-binding protei yes no 0.803 0.634 0.318 1e-39
Q99J79432 DNA damage-binding protei yes no 0.772 0.708 0.305 5e-37
Q0VBY8426 DNA damage-binding protei yes no 0.770 0.715 0.304 1e-36
Q92466427 DNA damage-binding protei yes no 0.770 0.714 0.298 6e-36
Q2YDS1496 DNA damage-binding protei no no 0.808 0.645 0.290 5e-30
B2KIQ4630 WD repeat-containing prot N/A no 0.714 0.449 0.306 5e-21
Q4KLQ5580 WD repeat-containing prot N/A no 0.719 0.491 0.28 1e-20
A6PWY4622 WD repeat-containing prot no no 0.727 0.463 0.279 9e-20
>sp|Q6NQ88|DDB2_ARATH Protein DAMAGED DNA-BINDING 2 OS=Arabidopsis thaliana GN=DDB2 PE=1 SV=1 Back     alignment and function desciption
 Score =  598 bits (1543), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 279/359 (77%), Positives = 322/359 (89%), Gaps = 1/359 (0%)

Query: 1   MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYG 60
           +KP +VIPDQV+CAVIRYHSRRVTCLEFHPT N+ILLSGDKKGQ+GVWDF KV EK VYG
Sbjct: 152 IKPKYVIPDQVHCAVIRYHSRRVTCLEFHPTKNNILLSGDKKGQIGVWDFGKVYEKNVYG 211

Query: 61  NIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLY 120
           NIHS  VNN+RF+PTND  VY+ASSDGT+  TDLETG + +L+N+NP+GW G  +W+MLY
Sbjct: 212 NIHSVQVNNMRFSPTNDDMVYSASSDGTIGYTDLETGTSSTLLNLNPDGWQGANSWKMLY 271

Query: 121 GMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSC 180
           GMDIN EKGVVL ADNFGFL+++D RTN+ +GE ILIH++GSKV GL CNP+QPELLLSC
Sbjct: 272 GMDINSEKGVVLAADNFGFLHMIDHRTNNSTGEPILIHKQGSKVCGLDCNPVQPELLLSC 331

Query: 181 GNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSP-SGSKILTTSQDNRLRIWDSIFGN 239
           GNDHFARIWD+R+L+  +SL DL HKRVVNSAYFSP SG+KILTT QDNR+RIWDSIFGN
Sbjct: 332 GNDHFARIWDMRKLQPKASLHDLAHKRVVNSAYFSPSSGTKILTTCQDNRIRIWDSIFGN 391

Query: 240 LDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITT 299
           LD PSREIVHS+DFNRHLTPF+AEWDPKD SESL VIGRYISENYNG ALHPIDFID + 
Sbjct: 392 LDLPSREIVHSNDFNRHLTPFKAEWDPKDTSESLIVIGRYISENYNGTALHPIDFIDASN 451

Query: 300 GQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVC 358
           GQLVAEVMDPNITTI+PVNKLHPRDDVLASGSSRS+FIWRP++ +E+VE+K++ KII+C
Sbjct: 452 GQLVAEVMDPNITTITPVNKLHPRDDVLASGSSRSLFIWRPQDNTEMVEEKKDKKIIIC 510
May function as the substrate recognition module for a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex including DDB1A and CUL4 (By similarity). Required for DNA repair. Binds to DDB1A to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZJL7|DDB2_CHICK DNA damage-binding protein 2 OS=Gallus gallus GN=DDB2 PE=2 SV=1 Back     alignment and function description
>sp|Q66JG1|DDB2_XENTR DNA damage-binding protein 2 OS=Xenopus tropicalis GN=ddb2 PE=2 SV=1 Back     alignment and function description
>sp|Q99J79|DDB2_MOUSE DNA damage-binding protein 2 OS=Mus musculus GN=Ddb2 PE=1 SV=1 Back     alignment and function description
>sp|Q0VBY8|DDB2_BOVIN DNA damage-binding protein 2 OS=Bos taurus GN=DDB2 PE=2 SV=1 Back     alignment and function description
>sp|Q92466|DDB2_HUMAN DNA damage-binding protein 2 OS=Homo sapiens GN=DDB2 PE=1 SV=1 Back     alignment and function description
>sp|Q2YDS1|DDB2_DANRE DNA damage-binding protein 2 OS=Danio rerio GN=ddb2 PE=1 SV=2 Back     alignment and function description
>sp|B2KIQ4|WDR76_RHIFE WD repeat-containing protein 76 OS=Rhinolophus ferrumequinum GN=WDR76 PE=3 SV=2 Back     alignment and function description
>sp|Q4KLQ5|WDR76_XENLA WD repeat-containing protein 76 OS=Xenopus laevis GN=wdr76 PE=2 SV=1 Back     alignment and function description
>sp|A6PWY4|WDR76_MOUSE WD repeat-containing protein 76 OS=Mus musculus GN=Wdr76 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
224059298 557 predicted protein [Populus trichocarpa] 0.931 0.662 0.862 0.0
449450810 562 PREDICTED: protein DAMAGED DNA-BINDING 2 0.989 0.697 0.795 0.0
255569337 558 DNA damage-binding protein, putative [Ri 0.939 0.666 0.825 0.0
449496579 562 PREDICTED: LOW QUALITY PROTEIN: protein 0.989 0.697 0.793 0.0
225434600 559 PREDICTED: protein DAMAGED DNA-BINDING 2 0.987 0.699 0.805 0.0
356553072 561 PREDICTED: protein DAMAGED DNA-BINDING 2 0.954 0.673 0.807 0.0
356500862 556 PREDICTED: protein DAMAGED DNA-BINDING 2 0.954 0.679 0.8 0.0
357490691 571 DAMAGED DNA-BINDING protein [Medicago tr 0.992 0.688 0.779 0.0
297796811 559 damaged DNA-binding 2 [Arabidopsis lyrat 0.994 0.704 0.745 1e-169
42568637 557 DNA damage-binding protein 2 [Arabidopsi 0.904 0.642 0.777 1e-168
>gi|224059298|ref|XP_002299813.1| predicted protein [Populus trichocarpa] gi|222847071|gb|EEE84618.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/370 (86%), Positives = 346/370 (93%), Gaps = 1/370 (0%)

Query: 1   MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYG 60
           +KPA+VIPDQV CAVIRYHSRRVTCLEFHPT N+ILLSGDKKGQVGVWDF KV E++VY 
Sbjct: 150 IKPAYVIPDQVCCAVIRYHSRRVTCLEFHPTKNNILLSGDKKGQVGVWDFDKVHERMVYQ 209

Query: 61  NIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLY 120
           NIH+CIVNN+RF  TNDG VYAASSDGT+S TDLETG++ SLMN+NPNGW GP  WRMLY
Sbjct: 210 NIHTCIVNNMRFKSTNDGMVYAASSDGTISSTDLETGMSSSLMNLNPNGWQGPSNWRMLY 269

Query: 121 GMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSC 180
           GMDIN EKGVVLVADNFGFLY+VD R+NS+ GEAILIH+KGSKVVGLHCNP+QPELLLSC
Sbjct: 270 GMDINSEKGVVLVADNFGFLYMVDTRSNSKIGEAILIHKKGSKVVGLHCNPVQPELLLSC 329

Query: 181 GNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSP-SGSKILTTSQDNRLRIWDSIFGN 239
           GNDHFARIWD+R+L+AGSSL DL HKRVVNSAYFSP SGSKILTTSQDNRLRIWDSIFGN
Sbjct: 330 GNDHFARIWDMRQLKAGSSLSDLAHKRVVNSAYFSPLSGSKILTTSQDNRLRIWDSIFGN 389

Query: 240 LDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITT 299
           LDSPSREIVHSHDFNRHLTPFRAEWDPKDP+ESLAVIGRYISENYNGAALHPIDFIDI+T
Sbjct: 390 LDSPSREIVHSHDFNRHLTPFRAEWDPKDPTESLAVIGRYISENYNGAALHPIDFIDIST 449

Query: 300 GQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVCG 359
           GQLVAEVMDPNITTISPVNKLHPRDD+LASGSSRS+FIWRPKEKSE VE+K+E KII+CG
Sbjct: 450 GQLVAEVMDPNITTISPVNKLHPRDDILASGSSRSLFIWRPKEKSEPVEKKDESKIIICG 509

Query: 360 KADKKQKHKF 369
            A KK+K KF
Sbjct: 510 GAMKKRKGKF 519

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449450810|ref|XP_004143155.1| PREDICTED: protein DAMAGED DNA-BINDING 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255569337|ref|XP_002525636.1| DNA damage-binding protein, putative [Ricinus communis] gi|223535072|gb|EEF36754.1| DNA damage-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449496579|ref|XP_004160170.1| PREDICTED: LOW QUALITY PROTEIN: protein DAMAGED DNA-BINDING 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225434600|ref|XP_002279214.1| PREDICTED: protein DAMAGED DNA-BINDING 2 [Vitis vinifera] gi|147833025|emb|CAN61895.1| hypothetical protein VITISV_028792 [Vitis vinifera] gi|297745903|emb|CBI15959.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553072|ref|XP_003544882.1| PREDICTED: protein DAMAGED DNA-BINDING 2 [Glycine max] Back     alignment and taxonomy information
>gi|356500862|ref|XP_003519249.1| PREDICTED: protein DAMAGED DNA-BINDING 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357490691|ref|XP_003615633.1| DAMAGED DNA-BINDING protein [Medicago truncatula] gi|355516968|gb|AES98591.1| DAMAGED DNA-BINDING protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297796811|ref|XP_002866290.1| damaged DNA-binding 2 [Arabidopsis lyrata subsp. lyrata] gi|297312125|gb|EFH42549.1| damaged DNA-binding 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42568637|ref|NP_200684.2| DNA damage-binding protein 2 [Arabidopsis thaliana] gi|75324350|sp|Q6NQ88.1|DDB2_ARATH RecName: Full=Protein DAMAGED DNA-BINDING 2; AltName: Full=UV-damaged DNA-binding protein 2 gi|34365763|gb|AAQ65193.1| At5g58760 [Arabidopsis thaliana] gi|51968390|dbj|BAD42887.1| putative protein [Arabidopsis thaliana] gi|332009712|gb|AED97095.1| DNA damage-binding protein 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
TAIR|locus:2178808557 DDB2 "AT5G58760" [Arabidopsis 0.934 0.664 0.764 3.7e-158
UNIPROTKB|Q5ZJL7507 DDB2 "DNA damage-binding prote 0.795 0.621 0.349 4.5e-43
UNIPROTKB|F1NDS8509 DDB2 "DNA damage-binding prote 0.795 0.618 0.350 3.2e-42
MGI|MGI:1355314432 Ddb2 "damage specific DNA bind 0.770 0.706 0.307 2.6e-38
UNIPROTKB|Q0VBY8426 DDB2 "DNA damage-binding prote 0.772 0.718 0.302 1.5e-37
UNIPROTKB|Q92466427 DDB2 "DNA damage-binding prote 0.770 0.714 0.298 2.1e-36
UNIPROTKB|E2R0N2427 DDB2 "Uncharacterized protein" 0.770 0.714 0.298 3.1e-35
ZFIN|ZDB-GENE-050419-169496 ddb2 "damage-specific DNA bind 0.792 0.633 0.301 8.3e-35
MGI|MGI:1926186622 Wdr76 "WD repeat domain 76" [M 0.727 0.463 0.286 6.9e-22
ZFIN|ZDB-GENE-030131-4513535 wdr76 "WD repeat domain 76" [D 0.618 0.457 0.293 1.9e-18
TAIR|locus:2178808 DDB2 "AT5G58760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1541 (547.5 bits), Expect = 3.7e-158, P = 3.7e-158
 Identities = 285/373 (76%), Positives = 330/373 (88%)

Query:     1 MKPAHVIPDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYG 60
             +KP +VIPDQV+CAVIRYHSRRVTCLEFHPT N+ILLSGDKKGQ+GVWDF KV EK VYG
Sbjct:   152 IKPKYVIPDQVHCAVIRYHSRRVTCLEFHPTKNNILLSGDKKGQIGVWDFGKVYEKNVYG 211

Query:    61 NIHSCIVNNIRFNPTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLY 120
             NIHS  VNN+RF+PTND  VY+ASSDGT+  TDLETG + +L+N+NP+GW G  +W+MLY
Sbjct:   212 NIHSVQVNNMRFSPTNDDMVYSASSDGTIGYTDLETGTSSTLLNLNPDGWQGANSWKMLY 271

Query:   121 GMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSC 180
             GMDIN EKGVVL ADNFGFL+++D RTN+ +GE ILIH++GSKV GL CNP+QPELLLSC
Sbjct:   272 GMDINSEKGVVLAADNFGFLHMIDHRTNNSTGEPILIHKQGSKVCGLDCNPVQPELLLSC 331

Query:   181 GNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPS-GSKILTTSQDNRLRIWDSIFGN 239
             GNDHFARIWD+R+L+  +SL DL HKRVVNSAYFSPS G+KILTT QDNR+RIWDSIFGN
Sbjct:   332 GNDHFARIWDMRKLQPKASLHDLAHKRVVNSAYFSPSSGTKILTTCQDNRIRIWDSIFGN 391

Query:   240 LDSPSREIVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITT 299
             LD PSREIVHS+DFNRHLTPF+AEWDPKD SESL VIGRYISENYNG ALHPIDFID + 
Sbjct:   392 LDLPSREIVHSNDFNRHLTPFKAEWDPKDTSESLIVIGRYISENYNGTALHPIDFIDASN 451

Query:   300 GQLVAEVMDPNITTISPVNKLHPRDDVLASGSSRSIFIWRPKEKSELVEQKEEMKIIVC- 358
             GQLVAEVMDPNITTI+PVNKLHPRDDVLASGSSRS+FIWRP++ +E+VE+K++ KII+C 
Sbjct:   452 GQLVAEVMDPNITTITPVNKLHPRDDVLASGSSRSLFIWRPQDNTEMVEEKKDKKIIICY 511

Query:   359 GKADKK-QKHKFG 370
             G + KK +K K G
Sbjct:   512 GDSKKKGKKQKRG 524
GO:0000166 "nucleotide binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0006281 "DNA repair" evidence=IMP
GO:0010224 "response to UV-B" evidence=IEP;IMP
UNIPROTKB|Q5ZJL7 DDB2 "DNA damage-binding protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDS8 DDB2 "DNA damage-binding protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1355314 Ddb2 "damage specific DNA binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VBY8 DDB2 "DNA damage-binding protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q92466 DDB2 "DNA damage-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0N2 DDB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050419-169 ddb2 "damage-specific DNA binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1926186 Wdr76 "WD repeat domain 76" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4513 wdr76 "WD repeat domain 76" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6NQ88DDB2_ARATHNo assigned EC number0.77710.90400.6427yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-16
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-16
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-15
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-12
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
smart0032040 smart00320, WD40, WD40 repeats 2e-04
smart0032040 smart00320, WD40, WD40 repeats 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 77.4 bits (191), Expect = 5e-16
 Identities = 50/225 (22%), Positives = 88/225 (39%), Gaps = 26/225 (11%)

Query: 14  AVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFN 73
             ++ H+  VTC+ F P     L +G   G + VWD             H+  V ++  +
Sbjct: 3   RTLKGHTGGVTCVAFSPDGKL-LATGSGDGTIKVWDLETGELLRTLKG-HTGPVRDVAAS 60

Query: 74  PTNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWR----MLYGMDINPEKG 129
             +   + + SSD T+   DLETG                RT       +  +  +P+  
Sbjct: 61  A-DGTYLASGSSDKTIRLWDLETG-------------ECVRTLTGHTSYVSSVAFSPDGR 106

Query: 130 VVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIW 189
           ++  +     + + D  T       +  H      V    +      + S   D   ++W
Sbjct: 107 ILSSSSRDKTIKVWDVETGKCLT-TLRGHTDWVNSVAFSPDGT---FVASSSQDGTIKLW 162

Query: 190 DIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWD 234
           D+R  +  ++L    H   VNS  FSP G K+L++S D  +++WD
Sbjct: 163 DLRTGKCVATL--TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWD 205

Length = 289
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 396
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG4328498 consensus WD40 protein [Function unknown] 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0640430 consensus mRNA cleavage stimulating factor complex 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0643327 consensus Translation initiation factor 3, subunit 100.0
KOG1407313 consensus WD40 repeat protein [Function unknown] 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0278334 consensus Serine/threonine kinase receptor-associa 100.0
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 100.0
KOG0268433 consensus Sof1-like rRNA processing protein (conta 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0283712 consensus WD40 repeat-containing protein [Function 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0772641 consensus Uncharacterized conserved protein, conta 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG2096420 consensus WD40 repeat protein [General function pr 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0288459 consensus WD40 repeat protein TipD [General functi 100.0
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0313423 consensus Microtubule binding protein YTM1 (contai 100.0
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
PTZ00421493 coronin; Provisional 100.0
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.98
KOG4283397 consensus Transcription-coupled repair protein CSA 99.98
KOG0289506 consensus mRNA splicing factor [General function p 99.98
KOG1273405 consensus WD40 repeat protein [General function pr 99.98
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.98
PTZ00420 568 coronin; Provisional 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.97
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.97
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.97
KOG0294362 consensus WD40 repeat-containing protein [Function 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.97
KOG0289506 consensus mRNA splicing factor [General function p 99.97
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.97
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.97
KOG0283712 consensus WD40 repeat-containing protein [Function 99.97
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.97
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.96
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.96
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.96
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.96
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.96
KOG1539 910 consensus WD repeat protein [General function pred 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG1274 933 consensus WD40 repeat protein [General function pr 99.96
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0300481 consensus WD40 repeat-containing protein [Function 99.96
KOG0641350 consensus WD40 repeat protein [General function pr 99.96
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.96
KOG2055514 consensus WD40 repeat protein [General function pr 99.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.96
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.96
KOG0294362 consensus WD40 repeat-containing protein [Function 99.96
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.96
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.96
KOG1274 933 consensus WD40 repeat protein [General function pr 99.96
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.95
KOG0639705 consensus Transducin-like enhancer of split protei 99.95
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.95
KOG1539 910 consensus WD repeat protein [General function pred 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.95
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.95
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.95
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.95
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0646 476 consensus WD40 repeat protein [General function pr 99.94
KOG1188376 consensus WD40 repeat protein [General function pr 99.94
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.94
KOG0302440 consensus Ribosome Assembly protein [General funct 99.94
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.94
KOG2106626 consensus Uncharacterized conserved protein, conta 99.94
KOG2106626 consensus Uncharacterized conserved protein, conta 99.93
KOG0639705 consensus Transducin-like enhancer of split protei 99.93
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.93
KOG0270463 consensus WD40 repeat-containing protein [Function 99.93
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.93
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.93
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.93
KOG2048 691 consensus WD40 repeat protein [General function pr 99.93
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.93
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.93
KOG4227 609 consensus WD40 repeat protein [General function pr 99.93
KOG0646476 consensus WD40 repeat protein [General function pr 99.93
KOG0270463 consensus WD40 repeat-containing protein [Function 99.92
KOG0302440 consensus Ribosome Assembly protein [General funct 99.92
KOG0267 825 consensus Microtubule severing protein katanin p80 99.92
KOG0267 825 consensus Microtubule severing protein katanin p80 99.91
KOG0303472 consensus Actin-binding protein Coronin, contains 99.91
KOG4283397 consensus Transcription-coupled repair protein CSA 99.91
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.9
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.9
KOG2048 691 consensus WD40 repeat protein [General function pr 99.9
KOG1273405 consensus WD40 repeat protein [General function pr 99.9
KOG2096420 consensus WD40 repeat protein [General function pr 99.9
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.9
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.9
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.9
KOG2055514 consensus WD40 repeat protein [General function pr 99.9
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.9
KOG1334559 consensus WD40 repeat protein [General function pr 99.89
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.89
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.89
KOG4328498 consensus WD40 protein [Function unknown] 99.89
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.89
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.89
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.89
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.88
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.88
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.87
PRK11028330 6-phosphogluconolactonase; Provisional 99.87
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.87
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.87
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.87
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.87
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.87
KOG0649325 consensus WD40 repeat protein [General function pr 99.86
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.86
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.86
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.85
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.85
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.85
KOG1310 758 consensus WD40 repeat protein [General function pr 99.85
KOG1963 792 consensus WD40 repeat protein [General function pr 99.85
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
KOG1963 792 consensus WD40 repeat protein [General function pr 99.84
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.84
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.83
KOG2110391 consensus Uncharacterized conserved protein, conta 99.83
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.83
KOG0771398 consensus Prolactin regulatory element-binding pro 99.82
KOG2110391 consensus Uncharacterized conserved protein, conta 99.82
KOG1334559 consensus WD40 repeat protein [General function pr 99.81
COG2319466 FOG: WD40 repeat [General function prediction only 99.81
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.79
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.79
KOG1188376 consensus WD40 repeat protein [General function pr 99.79
KOG4227 609 consensus WD40 repeat protein [General function pr 99.78
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.78
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.78
KOG2139445 consensus WD40 repeat protein [General function pr 99.78
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.77
PRK11028330 6-phosphogluconolactonase; Provisional 99.77
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.76
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.76
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.76
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.76
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.76
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.75
KOG2321 703 consensus WD40 repeat protein [General function pr 99.75
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.75
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.74
KOG2111346 consensus Uncharacterized conserved protein, conta 99.74
KOG0649325 consensus WD40 repeat protein [General function pr 99.74
PRK01742429 tolB translocation protein TolB; Provisional 99.74
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.74
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.72
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.72
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.72
KOG1310 758 consensus WD40 repeat protein [General function pr 99.71
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.71
PRK01742429 tolB translocation protein TolB; Provisional 99.7
KOG2139445 consensus WD40 repeat protein [General function pr 99.69
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.67
KOG2111346 consensus Uncharacterized conserved protein, conta 99.67
PRK03629429 tolB translocation protein TolB; Provisional 99.67
KOG0771398 consensus Prolactin regulatory element-binding pro 99.66
KOG2315 566 consensus Predicted translation initiation factor 99.65
PRK03629429 tolB translocation protein TolB; Provisional 99.65
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.64
PRK04922433 tolB translocation protein TolB; Provisional 99.63
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.62
PRK05137435 tolB translocation protein TolB; Provisional 99.62
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.61
PRK02889427 tolB translocation protein TolB; Provisional 99.59
PRK04922433 tolB translocation protein TolB; Provisional 99.59
PRK02889427 tolB translocation protein TolB; Provisional 99.58
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.58
PRK05137435 tolB translocation protein TolB; Provisional 99.58
KOG1409404 consensus Uncharacterized conserved protein, conta 99.58
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.57
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.57
KOG2314698 consensus Translation initiation factor 3, subunit 99.55
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.55
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.54
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.51
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.5
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.5
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.5
KOG2321 703 consensus WD40 repeat protein [General function pr 99.49
PRK04792448 tolB translocation protein TolB; Provisional 99.48
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.48
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.48
PRK01029428 tolB translocation protein TolB; Provisional 99.48
PRK00178430 tolB translocation protein TolB; Provisional 99.47
PRK01029428 tolB translocation protein TolB; Provisional 99.45
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.44
PRK00178430 tolB translocation protein TolB; Provisional 99.44
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 99.43
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.42
PRK04792448 tolB translocation protein TolB; Provisional 99.42
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.4
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.4
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.4
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 99.39
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.38
KOG4714319 consensus Nucleoporin [Nuclear structure] 99.35
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.35
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.34
KOG2315566 consensus Predicted translation initiation factor 99.32
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.32
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.32
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.32
KOG4547 541 consensus WD40 repeat-containing protein [General 99.31
COG4946668 Uncharacterized protein related to the periplasmic 99.28
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.28
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.27
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.26
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.26
KOG4547 541 consensus WD40 repeat-containing protein [General 99.26
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.24
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.21
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.19
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.15
KOG1409404 consensus Uncharacterized conserved protein, conta 99.14
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.14
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.13
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.12
KOG2314698 consensus Translation initiation factor 3, subunit 99.1
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.1
PRK04043419 tolB translocation protein TolB; Provisional 99.09
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.08
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.04
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.04
KOG4714319 consensus Nucleoporin [Nuclear structure] 99.03
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.03
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.02
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 99.02
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.02
COG4946668 Uncharacterized protein related to the periplasmic 99.0
PRK04043419 tolB translocation protein TolB; Provisional 98.99
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.99
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.96
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.93
KOG2695425 consensus WD40 repeat protein [General function pr 98.93
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.91
KOG2695425 consensus WD40 repeat protein [General function pr 98.9
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.89
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.89
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.88
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.85
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.85
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.85
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.83
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.78
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.77
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.76
KOG3621 726 consensus WD40 repeat-containing protein [General 98.76
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.75
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.74
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.73
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.71
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.69
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.68
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.68
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.66
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.63
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.61
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.6
PRK02888 635 nitrous-oxide reductase; Validated 98.59
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.58
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.54
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.54
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.52
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.52
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.5
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.45
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.4
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.38
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.32
KOG3621 726 consensus WD40 repeat-containing protein [General 98.32
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.3
COG3391381 Uncharacterized conserved protein [Function unknow 98.29
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.28
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.28
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.21
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.21
PRK02888635 nitrous-oxide reductase; Validated 98.2
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.2
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.17
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.14
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.13
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.12
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.04
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.01
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.94
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.93
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.87
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.87
COG3391381 Uncharacterized conserved protein [Function unknow 97.86
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.86
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.84
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.83
KOG2444238 consensus WD40 repeat protein [General function pr 97.81
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.8
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.79
KOG2395644 consensus Protein involved in vacuole import and d 97.76
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.72
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.68
PRK13616591 lipoprotein LpqB; Provisional 97.68
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.61
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.54
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.51
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.51
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 97.39
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 97.39
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.39
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.34
KOG2444238 consensus WD40 repeat protein [General function pr 97.33
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.25
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.24
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 97.21
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.2
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.16
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.09
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.08
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 97.05
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.02
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 97.01
PHA02713557 hypothetical protein; Provisional 97.01
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.99
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.96
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.96
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.95
PHA02713557 hypothetical protein; Provisional 96.93
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.88
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 96.83
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 96.78
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.78
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.72
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.6
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.58
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.58
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.57
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.56
KOG2395644 consensus Protein involved in vacuole import and d 96.56
PRK13616591 lipoprotein LpqB; Provisional 96.55
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.43
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 96.43
COG5276370 Uncharacterized conserved protein [Function unknow 96.41
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.39
PHA03098534 kelch-like protein; Provisional 96.36
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 96.23
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.06
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.03
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.02
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.01
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.96
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.94
PHA02790480 Kelch-like protein; Provisional 95.77
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.66
PRK10115 686 protease 2; Provisional 95.61
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.46
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 95.3
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.09
COG3823262 Glutamine cyclotransferase [Posttranslational modi 95.03
COG5167776 VID27 Protein involved in vacuole import and degra 94.88
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.86
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.8
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 94.74
PF14727418 PHTB1_N: PTHB1 N-terminus 94.68
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.63
PHA03098534 kelch-like protein; Provisional 94.6
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.26
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.26
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.24
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 94.09
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.85
KOG1898 1205 consensus Splicing factor 3b, subunit 3 [RNA proce 93.48
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.45
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 93.22
PHA02790480 Kelch-like protein; Provisional 93.13
PF13449326 Phytase-like: Esterase-like activity of phytase 93.09
PF14727418 PHTB1_N: PTHB1 N-terminus 93.08
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.86
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 92.81
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 92.79
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.47
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.43
KOG2247 615 consensus WD40 repeat-containing protein [General 92.33
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.31
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.29
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.09
COG5276370 Uncharacterized conserved protein [Function unknow 92.04
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.65
COG4590 733 ABC-type uncharacterized transport system, permeas 91.55
PRK13684334 Ycf48-like protein; Provisional 91.5
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 90.9
KOG2377 657 consensus Uncharacterized conserved protein [Funct 90.66
KOG2247 615 consensus WD40 repeat-containing protein [General 90.22
KOG18961366 consensus mRNA cleavage and polyadenylation factor 90.18
PLN02193470 nitrile-specifier protein 89.91
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 89.45
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 89.12
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 89.01
COG5167776 VID27 Protein involved in vacuole import and degra 88.94
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 88.77
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 88.74
PLN02153341 epithiospecifier protein 87.63
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 87.48
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 87.21
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 86.94
KOG2377 657 consensus Uncharacterized conserved protein [Funct 86.84
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.5
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 86.45
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 86.41
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 86.39
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 85.96
COG5308 1263 NUP170 Nuclear pore complex subunit [Intracellular 85.9
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 85.81
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 85.07
PLN00033398 photosystem II stability/assembly factor; Provisio 84.92
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 84.72
PRK13684334 Ycf48-like protein; Provisional 84.31
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 82.02
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 81.84
PF13449326 Phytase-like: Esterase-like activity of phytase 80.08
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=9.5e-50  Score=314.77  Aligned_cols=309  Identities=19%  Similarity=0.314  Sum_probs=260.0

Q ss_pred             ccceeeeccccCCeEEEEecCCCCcEEEEEeCCCcEEEeecccceeeeEecCCcccceeEEEEecCCCcEEEEEeCCCeE
Q 016032           10 QVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDGTV   89 (396)
Q Consensus        10 ~~~~~~~~~h~~~v~~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~s~~~dg~v   89 (396)
                      ..+...+.||.++|.|++|+|+| ..|++|+.|.++|+||+.+..+..+. ++|...|.|++|+|+ +..|++|+.||+|
T Consensus       105 trCssS~~GH~e~Vl~~~fsp~g-~~l~tGsGD~TvR~WD~~TeTp~~t~-KgH~~WVlcvawsPD-gk~iASG~~dg~I  181 (480)
T KOG0271|consen  105 TRCSSSIAGHGEAVLSVQFSPTG-SRLVTGSGDTTVRLWDLDTETPLFTC-KGHKNWVLCVAWSPD-GKKIASGSKDGSI  181 (480)
T ss_pred             ceeccccCCCCCcEEEEEecCCC-ceEEecCCCceEEeeccCCCCcceee-cCCccEEEEEEECCC-cchhhccccCCeE
Confidence            34567899999999999999999 68999999999999999999888888 899999999999999 9999999999999


Q ss_pred             EEEECCCCcccceeecCCCCCCCCCcceeeeEEEeCC-----CCCEEEEEecCCeEEEEeCCCCCCCccceeeecCCccE
Q 016032           90 SCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINP-----EKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKV  164 (396)
Q Consensus        90 ~iwd~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~-----~~~~l~~~~~~g~i~i~d~~~~~~~~~~~~~~~~~~~i  164 (396)
                      ++||..+|+.+..-      +.+|..+  |++++|.|     ..++|++++.||.++|||+..+....   ....|..+|
T Consensus       182 ~lwdpktg~~~g~~------l~gH~K~--It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~---~lsgHT~~V  250 (480)
T KOG0271|consen  182 RLWDPKTGQQIGRA------LRGHKKW--ITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVR---TLSGHTASV  250 (480)
T ss_pred             EEecCCCCCccccc------ccCcccc--eeEEeecccccCCCccceecccCCCCEEEEEccCceEEE---EeccCccce
Confidence            99999999876432      2344433  99999966     56899999999999999998876543   456677799


Q ss_pred             EEEEeccCCCCEEEEeeCCCcEEEEecCCCCCCCccccCCCCCceeEEEEc-----------CCCC--------------
Q 016032          165 VGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFS-----------PSGS--------------  219 (396)
Q Consensus       165 ~~~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~~~~~~i~~~~~~-----------~~~~--------------  219 (396)
                      +|+.|-  ...+|++|+.|++|++|+...+.....+.  +|...|+.++.+           |.++              
T Consensus       251 TCvrwG--G~gliySgS~DrtIkvw~a~dG~~~r~lk--GHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~  326 (480)
T KOG0271|consen  251 TCVRWG--GEGLIYSGSQDRTIKVWRALDGKLCRELK--GHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALE  326 (480)
T ss_pred             EEEEEc--CCceEEecCCCceEEEEEccchhHHHhhc--ccchheeeeeccchhhhhccccccccccCCChHHHHHHHHH
Confidence            999997  46899999999999999997644433332  788899998876           3233              


Q ss_pred             -----------EEEEEeCCCcEEEEEcccccccCCCcceeecccccccCCc-eeEEeCCCCCCCceeeEeeeeeeecccc
Q 016032          220 -----------KILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHLTP-FRAEWDPKDPSESLAVIGRYISENYNGA  287 (396)
Q Consensus       220 -----------~l~~~~~d~~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~g~~~~~~~~g~  287 (396)
                                 .|++|+.|.++.+|+-...+.  |      ...+.+|... ..+.|+|+         ++|++   +++
T Consensus       327 rY~~~~~~~~erlVSgsDd~tlflW~p~~~kk--p------i~rmtgHq~lVn~V~fSPd---------~r~IA---SaS  386 (480)
T KOG0271|consen  327 RYEAVLKDSGERLVSGSDDFTLFLWNPFKSKK--P------ITRMTGHQALVNHVSFSPD---------GRYIA---SAS  386 (480)
T ss_pred             HHHHhhccCcceeEEecCCceEEEeccccccc--c------hhhhhchhhheeeEEECCC---------ccEEE---Eee
Confidence                       499999999999998764331  1      1122233222 36899999         99999   999


Q ss_pred             cccceEEEEcCccchhhhhcCCCCCCCcceeeeccCCcEEEeec-CCcEEEEcCCCcceeeeccccceEEEe
Q 016032          288 ALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDVLASGS-SRSIFIWRPKEKSELVEQKEEMKIIVC  358 (396)
Q Consensus       288 ~d~~i~vwd~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~sg~-d~~i~iw~~~~~~~~~~~~~~~~~~~~  358 (396)
                      .|..|++|+..+|+.+.+|.+|- ..++.+ +|+.|.++|++|+ |.+++||++.+.++...+.+|...+.|
T Consensus       387 FDkSVkLW~g~tGk~lasfRGHv-~~VYqv-awsaDsRLlVS~SkDsTLKvw~V~tkKl~~DLpGh~DEVf~  456 (480)
T KOG0271|consen  387 FDKSVKLWDGRTGKFLASFRGHV-AAVYQV-AWSADSRLLVSGSKDSTLKVWDVRTKKLKQDLPGHADEVFA  456 (480)
T ss_pred             cccceeeeeCCCcchhhhhhhcc-ceeEEE-EeccCccEEEEcCCCceEEEEEeeeeeecccCCCCCceEEE
Confidence            99999999999999999999987 888888 9999999999999 999999999999999999999888776

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>COG5308 NUP170 Nuclear pore complex subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 4e-37
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 6e-37
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 8e-37
3ei1_B383 Structure Of Hsddb1-Drddb2 Bound To A 14 Bp 6-4 Pho 1e-30
4a08_B382 Structure Of Hsddb1-Drddb2 Bound To A 13 Bp Cpd-Dup 1e-30
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 5e-08
2gnq_A336 Structure Of Wdr5 Length = 336 8e-08
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 8e-08
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-07
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-07
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-07
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-07
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-07
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-07
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-07
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-07
2h9l_A329 Wdr5delta23 Length = 329 2e-07
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-07
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 3e-07
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 7e-07
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 7e-07
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 7e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-06
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-06
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-06
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 4e-06
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-05
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-05
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-04
4i79_A399 Crystal Structure Of Human Nup43 Length = 399 5e-04
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure 
Iteration: 1

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 163/331 (49%), Gaps = 23/331 (6%)
Query: 21  RRVTCLEFHPTNNHILLSGDKKGQVGVWDF-YKVSEKIVYGNIHSCIVNNIRFNPTNDGT 79
           RR T L +HPT+   +  G K G + +W+F  K     + G      +  ++FNP N   
Sbjct: 120 RRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQ 179
Query: 80  VYAASSDGTVSCTDLETGLALSLMNVNP-NGWHGPRTWRMLYGMDINPEKGVVLVADNFG 138
            YA+S +GT    D +  +     + +  N W           +D++    +V+  DN G
Sbjct: 180 FYASSMEGTTRLQDFKGNILRVFASSDTINIW--------FCSLDVSASSRMVVTGDNVG 231
Query: 139 FLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRLEAGS 198
            + L++   + +    + +H+K  KV  +  NP     L +   D   +IWD+R++   +
Sbjct: 232 NVILLN--MDGKELWNLRMHKK--KVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKA 287
Query: 199 S-LCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFNRHL 257
           S L  LPH+  VN+A FSP G+++LTT Q + +R++ +     D P   I H H   +HL
Sbjct: 288 SFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSA--SQWDCPLGLIPHPHRHFQHL 345
Query: 258 TPFRAEWDPKDPSESLAVIGRYISENYNGAA---LHPIDFIDITTGQLVAEVMDPNITTI 314
           TP +A W P+    +L V+GRY   N+       L  ID  D  +G+++ ++ DP  + I
Sbjct: 346 TPIKAAWHPR---YNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGI 402
Query: 315 SPVNKLHPRDDVLASGSSRSIFIWRPKEKSE 345
           S +N+ +P  D LAS     I IW  +E++ 
Sbjct: 403 SSLNEFNPMGDTLASAMGYHILIWSEQEEAR 433
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|3EI1|B Chain B, Structure Of Hsddb1-Drddb2 Bound To A 14 Bp 6-4 Photoproduct Containing Dna-Duplex Length = 383 Back     alignment and structure
>pdb|4A08|B Chain B, Structure Of Hsddb1-Drddb2 Bound To A 13 Bp Cpd-Duplex ( Purine At D-1 Position) At 3.0 A Resolution (Cpd 1) Length = 382 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 99.98
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.95
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.94
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.94
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.94
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.93
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.93
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.93
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.92
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.92
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.92
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.92
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.91
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.9
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.89
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.89
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.87
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.87
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.87
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.86
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.84
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.84
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.84
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.83
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.83
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.82
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.82
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.82
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.79
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.78
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.77
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.76
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.76
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.76
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.76
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.75
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.74
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.73
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.72
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.72
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.69
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.69
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.69
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.68
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.68
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.68
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.67
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.67
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.67
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.65
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.65
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.64
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.63
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.6
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.6
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.59
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.57
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.56
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.55
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.55
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.55
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.54
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.53
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.48
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.48
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.45
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.44
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.44
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.44
2qe8_A343 Uncharacterized protein; structural genomics, join 99.43
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.42
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.42
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.4
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.39
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.39
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.37
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.36
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.35
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.35
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.35
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.34
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.33
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.3
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.3
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.3
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.29
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.25
2ece_A462 462AA long hypothetical selenium-binding protein; 99.23
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.18
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.17
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.15
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.15
2ece_A462 462AA long hypothetical selenium-binding protein; 99.14
2qe8_A343 Uncharacterized protein; structural genomics, join 99.14
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.12
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.1
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.08
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.07
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.07
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.04
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.04
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.02
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.01
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.98
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.97
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.96
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.95
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.93
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.93
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.93
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.9
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.87
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.85
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.84
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.8
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.79
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.79
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.77
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.76
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.75
3v65_B386 Low-density lipoprotein receptor-related protein; 98.72
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.69
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.68
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.66
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.63
3v65_B386 Low-density lipoprotein receptor-related protein; 98.63
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.62
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.61
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.6
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.59
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.57
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.55
3kya_A496 Putative phosphatase; structural genomics, joint c 98.54
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.53
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.53
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.52
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.49
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.44
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.43
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.4
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.4
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.38
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.37
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.34
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.34
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.31
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.25
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.24
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.23
3kya_A496 Putative phosphatase; structural genomics, joint c 98.21
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.17
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.14
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.07
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.05
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.02
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.98
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.95
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.91
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.79
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.69
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.53
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.45
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.42
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.3
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.29
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.27
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.26
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.2
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.13
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.06
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.04
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.99
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.86
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.84
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.82
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.81
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.8
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.79
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.73
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.64
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.62
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.61
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.51
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.46
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.26
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.23
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.21
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.13
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.99
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.97
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.94
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.91
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.62
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 95.6
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.52
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.5
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 95.42
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 94.82
3ott_A 758 Two-component system sensor histidine kinase; beta 94.45
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 93.32
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.07
3ott_A 758 Two-component system sensor histidine kinase; beta 92.54
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 92.08
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 90.88
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 90.4
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 90.27
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 88.45
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 87.84
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 86.84
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 86.34
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 83.54
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 82.64
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=4e-48  Score=341.70  Aligned_cols=292  Identities=19%  Similarity=0.299  Sum_probs=249.2

Q ss_pred             CCccceeeeccccCCeEEEEecCCCCcEEEEEeCCCcEEEeecccceeeeEecCCcccceeEEEEecCCCcEEEEEeCCC
Q 016032            8 PDQVNCAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNPTNDGTVYAASSDG   87 (396)
Q Consensus         8 ~~~~~~~~~~~h~~~v~~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~s~~~dg   87 (396)
                      +.......+.+|.++|++++|+|++ .+|++|+.||+|+|||+.++.....+ .+|...|.+++|+|+ +.+|++|+.|+
T Consensus        96 ~~~~~~~~l~gh~~~V~~~~~~p~~-~~l~s~s~Dg~i~vwd~~~~~~~~~l-~~h~~~V~~v~~~~~-~~~l~sgs~D~  172 (410)
T 1vyh_C           96 PRPPEKYALSGHRSPVTRVIFHPVF-SVMVSASEDATIKVWDYETGDFERTL-KGHTDSVQDISFDHS-GKLLASCSADM  172 (410)
T ss_dssp             CCSSCSCEEECCSSCEEEEEECSSS-SEEEEEESSSCEEEEETTTCCCCEEE-CCCSSCEEEEEECTT-SSEEEEEETTS
T ss_pred             cCCCceEeecccCCcEEEEEEcCCC-CEEEEEeCCCeEEEEECCCCcEEEEE-eccCCcEEEEEEcCC-CCEEEEEeCCC
Confidence            4445567899999999999999998 68999999999999999998877777 789999999999999 89999999999


Q ss_pred             eEEEEECCCCcccceeecCCCCCCCCCcceeeeEEEeCCCCCEEEEEecCCeEEEEeCCCCCCCccceeeecCCccEEEE
Q 016032           88 TVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVGL  167 (396)
Q Consensus        88 ~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~~g~i~i~d~~~~~~~~~~~~~~~~~~~i~~~  167 (396)
                      +|++||+.+++.+..+..+..         .|.+++|+|++.+|++|+.|+.|++||++++....   ....|...+.++
T Consensus       173 ~i~iwd~~~~~~~~~~~~h~~---------~V~~v~~~p~~~~l~s~s~D~~i~~wd~~~~~~~~---~~~~h~~~v~~~  240 (410)
T 1vyh_C          173 TIKLWDFQGFECIRTMHGHDH---------NVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVK---TFTGHREWVRMV  240 (410)
T ss_dssp             CCCEEETTSSCEEECCCCCSS---------CEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEE---EEECCSSCEEEE
T ss_pred             eEEEEeCCCCceeEEEcCCCC---------CEEEEEEeCCCCEEEEEeCCCeEEEEECCCCcEEE---EEeCCCccEEEE
Confidence            999999999888776654433         39999999999999999999999999999876543   344566689999


Q ss_pred             EeccCCCCEEEEeeCCCcEEEEecCCCCCCCccccCCCCCceeEEEEcCC--------------------CCEEEEEeCC
Q 016032          168 HCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPS--------------------GSKILTTSQD  227 (396)
Q Consensus       168 ~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~~~~~~i~~~~~~~~--------------------~~~l~~~~~d  227 (396)
                      .++| ++.+|++|+.|+.|++||+++.+....+  ..|...|.+++|+|+                    +.+|++|+.|
T Consensus       241 ~~~~-~g~~l~s~s~D~~v~vwd~~~~~~~~~~--~~h~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~sgs~D  317 (410)
T 1vyh_C          241 RPNQ-DGTLIASCSNDQTVRVWVVATKECKAEL--REHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRD  317 (410)
T ss_dssp             EECT-TSSEEEEEETTSCEEEEETTTCCEEEEE--CCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETT
T ss_pred             EECC-CCCEEEEEcCCCeEEEEECCCCceeeEe--cCCCceEEEEEEcCcccccchhhhccccccccCCCCCEEEEEeCC
Confidence            9999 9999999999999999999875543332  368899999999996                    6789999999


Q ss_pred             CcEEEEEcccccccCCCcceeecccccccCC-ceeEEeCCCCCCCceeeEeeeeeeecccccccceEEEEcCccchhhhh
Q 016032          228 NRLRIWDSIFGNLDSPSREIVHSHDFNRHLT-PFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEV  306 (396)
Q Consensus       228 ~~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~d~~i~vwd~~~~~~~~~~  306 (396)
                      +.|++||++++.....         +.++.. ...+.|+|+         |++++   +|+.|+.|++||+.+++++..+
T Consensus       318 ~~i~iwd~~~~~~~~~---------~~~h~~~v~~v~~~~~---------g~~l~---s~s~D~~i~vwd~~~~~~~~~~  376 (410)
T 1vyh_C          318 KTIKMWDVSTGMCLMT---------LVGHDNWVRGVLFHSG---------GKFIL---SCADDKTLRVWDYKNKRCMKTL  376 (410)
T ss_dssp             SEEEEEETTTTEEEEE---------EECCSSCEEEEEECSS---------SSCEE---EEETTTEEEEECCTTSCCCEEE
T ss_pred             CeEEEEECCCCceEEE---------EECCCCcEEEEEEcCC---------CCEEE---EEeCCCeEEEEECCCCceEEEE
Confidence            9999999998775321         122222 246889987         77887   8999999999999999999988


Q ss_pred             cCCCCCCCcceeeeccCCcEEEeec-CCcEEEEcC
Q 016032          307 MDPNITTISPVNKLHPRDDVLASGS-SRSIFIWRP  340 (396)
Q Consensus       307 ~~~~~~~i~~~~~~~~~~~~l~sg~-d~~i~iw~~  340 (396)
                      .+|. ..+.++ +|+|++.+|++|+ |+.|+||++
T Consensus       377 ~~h~-~~v~~l-~~~~~~~~l~sgs~D~~i~vW~~  409 (410)
T 1vyh_C          377 NAHE-HFVTSL-DFHKTAPYVVTGSVDQTVKVWEC  409 (410)
T ss_dssp             ECCS-SCEEEE-EECSSSSCEEEEETTSEEEEEC-
T ss_pred             cCCC-CcEEEE-EEcCCCCEEEEEeCCCcEEEEeC
Confidence            8776 778888 8999999999999 999999986
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-12
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-10
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.003
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.004
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.003
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.003
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 66.7 bits (161), Expect = 7e-13
 Identities = 50/327 (15%), Positives = 104/327 (31%), Gaps = 40/327 (12%)

Query: 15  VIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEKIVYGNIHSCIVNNIRFNP 74
            +R H  ++  + +   ++ +L+S  + G++ +WD Y  ++      + S  V    + P
Sbjct: 50  TLRGHLAKIYAMHWGT-DSRLLVSASQDGKLIIWDSYTTNKVHAI-PLRSSWVMTCAYAP 107

Query: 75  TNDGTVYAASSDGTVSCTDLETGLALSLMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVA 134
           + +  V     D   S  +L+T      ++    G  G  +       +           
Sbjct: 108 SGN-YVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQI--------- 157

Query: 135 DNFGFLYLVDARTNSRSGEAILIHRKGSKVVGLHCNPIQPELLLSCGNDHFARIWDIRRL 194
                     A  +  +G+        +  V          L +S   D  A++WD+R  
Sbjct: 158 -VTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREG 216

Query: 195 EAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSREIVHSHDFN 254
               +     H+  +N+  F P+G+   T S D   R++D           E++     N
Sbjct: 217 MCRQTFTG--HESDINAICFFPNGNAFATGSDDATCRLFDLRADQ------ELMTYSHDN 268

Query: 255 RHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVM--DPNIT 312
                    +            GR +     G      +  D         +   D  ++
Sbjct: 269 IICGITSVSFSKS---------GRLL---LAGYDDFNCNVWDALKADRAGVLAGHDNRVS 316

Query: 313 TISPVNKLHPRDDVLASGSS-RSIFIW 338
            +     +      +A+GS    + IW
Sbjct: 317 CLG----VTDDGMAVATGSWDSFLKIW 339
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.93
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.89
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.87
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.8
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.74
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.74
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.74
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.61
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.6
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.56
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.44
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.38
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.31
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.29
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.24
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.21
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.16
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.15
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.1
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.08
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.08
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.04
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.99
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.95
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.94
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.93
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.69
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.66
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.5
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.29
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.25
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.24
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 98.1
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 98.09
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.99
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.96
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.93
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.9
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.9
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.88
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.86
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.78
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.77
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.75
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.4
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.27
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.2
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.11
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.11
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.84
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.8
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.43
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.39
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.07
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.47
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 95.27
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 92.87
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.78
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.81
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 89.47
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 89.44
d2ebsa1427 Oligoxyloglucan reducing end-specific cellobiohydr 86.43
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 84.02
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.2e-43  Score=300.09  Aligned_cols=284  Identities=13%  Similarity=0.184  Sum_probs=229.6

Q ss_pred             eeeeccccCCeEEEEecCCCCcEEEEEeCCCcEEEeecccceee----eEecCCcccceeEEEEecCCCcEEEEEeCCCe
Q 016032           13 CAVIRYHSRRVTCLEFHPTNNHILLSGDKKGQVGVWDFYKVSEK----IVYGNIHSCIVNNIRFNPTNDGTVYAASSDGT   88 (396)
Q Consensus        13 ~~~~~~h~~~v~~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~----~~~~~~~~~~v~~~~~~~~~~~~l~s~~~dg~   88 (396)
                      ++.+ +|...|+|++|+|++ ++|++|+ ||.|+|||+.+....    .....+|...|.+++|+|+ +++|++++.||.
T Consensus        45 ~~~~-~H~~~V~~v~fs~~g-~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~d-g~~l~s~~~dg~  120 (337)
T d1gxra_          45 INTL-NHGEVVCAVTISNPT-RHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPD-GCTLIVGGEAST  120 (337)
T ss_dssp             EEEE-CCSSCCCEEEECSSS-SEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTT-SSEEEEEESSSE
T ss_pred             EEEC-CCCCcEEEEEECCCC-CEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCC-CCEEEEeecccc
Confidence            3444 799999999999999 6899987 799999999764322    2223579999999999999 899999999999


Q ss_pred             EEEEECCCCcccc--eeecCCCCCCCCCcceeeeEEEeCCCCCEEEEEecCCeEEEEeCCCCCCCccceeeecCCccEEE
Q 016032           89 VSCTDLETGLALS--LMNVNPNGWHGPRTWRMLYGMDINPEKGVVLVADNFGFLYLVDARTNSRSGEAILIHRKGSKVVG  166 (396)
Q Consensus        89 v~iwd~~~~~~~~--~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~~g~i~i~d~~~~~~~~~~~~~~~~~~~i~~  166 (396)
                      |++||+.......  .+..+.         ..+.+++|+|++.++++++.++.|++|++.+++...   ....+...+.+
T Consensus       121 i~iwd~~~~~~~~~~~~~~~~---------~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~---~~~~~~~~v~~  188 (337)
T d1gxra_         121 LSIWDLAAPTPRIKAELTSSA---------PACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVR---QFQGHTDGASC  188 (337)
T ss_dssp             EEEEECCCC--EEEEEEECSS---------SCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEE---EECCCSSCEEE
T ss_pred             ccccccccccccccccccccc---------cccccccccccccccccccccccccccccccccccc---ccccccccccc
Confidence            9999988654432  332222         238899999999999999999999999998865432   33445668999


Q ss_pred             EEeccCCCCEEEEeeCCCcEEEEecCCCCCCCccccCCCCCceeEEEEcCCCCEEEEEeCCCcEEEEEcccccccCCCcc
Q 016032          167 LHCNPIQPELLLSCGNDHFARIWDIRRLEAGSSLCDLPHKRVVNSAYFSPSGSKILTTSQDNRLRIWDSIFGNLDSPSRE  246 (396)
Q Consensus       167 ~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~d~~i~iwd~~~~~~~~~~~~  246 (396)
                      ++|++ ++..+++++.|+.|++||+++.+   .+..+.+...|.+++|+|++.+|++++.|+.+++||+++++....   
T Consensus       189 l~~s~-~~~~~~~~~~d~~v~i~d~~~~~---~~~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~---  261 (337)
T d1gxra_         189 IDISN-DGTKLWTGGLDNTVRSWDLREGR---QLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQL---  261 (337)
T ss_dssp             EEECT-TSSEEEEEETTSEEEEEETTTTE---EEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEEE---
T ss_pred             ccccc-cccccccccccccccccccccce---eecccccccceEEEEEcccccccceeccccccccccccccccccc---
Confidence            99999 99999999999999999997644   344456888999999999999999999999999999987764211   


Q ss_pred             eeecccccccCCceeEEeCCCCCCCceeeEeeeeeeecccccccceEEEEcCccchhhhhcCCCCCCCcceeeeccCCcE
Q 016032          247 IVHSHDFNRHLTPFRAEWDPKDPSESLAVIGRYISENYNGAALHPIDFIDITTGQLVAEVMDPNITTISPVNKLHPRDDV  326 (396)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~d~~i~vwd~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~  326 (396)
                            .........+.|+|+         |++++   +|+.|+.|++||+.+++.+..+. | ...+.++ +|+|++++
T Consensus       262 ------~~~~~~i~~v~~s~~---------g~~l~---s~s~Dg~i~iwd~~~~~~~~~~~-~-~~~v~~~-~~s~d~~~  320 (337)
T d1gxra_         262 ------HLHESCVLSLKFAYC---------GKWFV---STGKDNLLNAWRTPYGASIFQSK-E-SSSVLSC-DISVDDKY  320 (337)
T ss_dssp             ------CCCSSCEEEEEECTT---------SSEEE---EEETTSEEEEEETTTCCEEEEEE-C-SSCEEEE-EECTTSCE
T ss_pred             ------cccccccceEEECCC---------CCEEE---EEeCCCeEEEEECCCCCEEEEcc-C-CCCEEEE-EEeCCCCE
Confidence                  111122347889998         77777   78999999999999999887654 3 3678888 89999999


Q ss_pred             EEeec-CCcEEEEcC
Q 016032          327 LASGS-SRSIFIWRP  340 (396)
Q Consensus       327 l~sg~-d~~i~iw~~  340 (396)
                      |++|+ |+.|+|||+
T Consensus       321 l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         321 IVTGSGDKKATVYEV  335 (337)
T ss_dssp             EEEEETTSCEEEEEE
T ss_pred             EEEEeCCCeEEEEEE
Confidence            99998 999999986
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure