Citrus Sinensis ID: 016377

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MEKDMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
cccccccccccccEEEEEcccHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccccccccccccccccccccccEEEEcccccHHHHHccccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccEEEEEEEEcccccHHHHHcccccccccccccccccccccccccccccHHHHcccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHc
cccccccccccccEEEEEEccccHHHHHHHHcccccEEEEEEEccHHHHHHHHHHccccEEEcccccccHHHccccccEEEEccccccccHHccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHcccEEEEEEEcHHHccccccccEEEEEEEccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccEEccccccccEcccccccccEccHHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHcc
mekdmckndgEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFdindkandvyelnfghrpyqgniqNLTAAELDMYGAhawllsppcqpytrqglqkqssdARAFSFLKILEliphtvkpphmLFVENVVGFETSDTHAKMIEILAnsdyltqefilsplqfgvpysrpryfclakrkplsfRCQLLNnqllrspspllgnddmtvitkhdqpddswdkllescdpverflefsnsgdqvntetgflstgtaavddfgaaeetvevdrcvsidhflvPLSLIERWGsamdivypdskrcccftksyYRYVKGTGsllatvqpknkgkasslkeqhlryftprevanlhsfpgdfqfphhlSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
mekdmckndgeaWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQllrspspllGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLatvqpknkgkasslkEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
MEKDMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
*********GEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQ********ARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRS***LL****MTVI*********WDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATV**************HLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFA***
**************VLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
MEKDMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPY**********DARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQ**********KEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
*********GEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVIT*H*QPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKDMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
O14717391 tRNA (cytosine(38)-C(5))- yes no 0.938 0.936 0.378 2e-62
Q7YS61391 tRNA (cytosine-5-)-methyl yes no 0.907 0.905 0.374 6e-62
Q4G073391 tRNA (cytosine(38)-C(5))- yes no 0.910 0.907 0.367 9e-60
O55055415 tRNA (cytosine(38)-C(5))- yes no 0.902 0.848 0.367 5e-59
Q54JH6379 DNA (cytosine-5)-methyltr yes no 0.879 0.905 0.352 1e-58
P40999330 tRNA (cytosine(38)-C(5))- yes no 0.807 0.954 0.345 5e-52
P05102327 Modification methylase Hh N/A no 0.779 0.929 0.25 9e-14
P25263420 Modification methylase Hg yes no 0.935 0.869 0.257 9e-13
P19888428 Modification methylase Ba N/A no 0.394 0.359 0.294 4e-11
Q59603317 Modification methylase Ng yes no 0.464 0.570 0.293 1e-10
>sp|O14717|TRDMT_HUMAN tRNA (cytosine(38)-C(5))-methyltransferase OS=Homo sapiens GN=TRDMT1 PE=1 SV=1 Back     alignment and function desciption
 Score =  239 bits (611), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/399 (37%), Positives = 224/399 (56%), Gaps = 33/399 (8%)

Query: 11  EAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGH-RPYQGNIQNLT 69
           E  RVLE YSG+GGM ++L ++ + AQVV A D+N  AN+VY+ NF H +     I+ +T
Sbjct: 2   EPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGIT 61

Query: 70  AAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENV 129
             E D       L+SPPCQP+TR G Q   +D+R  SFL IL+++P   K P  + +ENV
Sbjct: 62  LEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV 121

Query: 130 VGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAK--RKPLSFRCQ-- 185
            GFE S T   +I+ + N  +  QEF+LSP   G+P SR RYF +AK   +PL F+    
Sbjct: 122 KGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQ 181

Query: 186 -LLNNQLLRSPSPLLGNDDM--TVITKHDQPDDSWDKLLESC--DPVERFLEFSNSGDQV 240
            L+    + S  P     D+   +  K+ +P+ S+D  ++    D +   LE +    + 
Sbjct: 182 VLMEFPKIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRK 241

Query: 241 NTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCC 300
           N +   LS     + DF        ++    ++ +L+P   + R+   +DIV P  +R  
Sbjct: 242 NQQDSDLS--VKMLKDF--------LEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSV 291

Query: 301 CFTKSYYRYVKGTGSLLAT---VQPKNKGKA---SSLKEQ-------HLRYFTPREVANL 347
           CFTK Y  Y++GTGS+L T   VQ +N  K+    S +EQ        LRYFTP+E+ANL
Sbjct: 292 CFTKGYGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANL 351

Query: 348 HSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLF 386
             FP +F FP  ++++QRY LLGNSL++ VVA L++ L+
Sbjct: 352 LGFPPEFGFPEKITVKQRYRLLGNSLNVHVVAKLIKILY 390
Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0EC: 4
>sp|Q7YS61|TRDMT_BOVIN tRNA (cytosine-5-)-methyltransferase OS=Bos taurus GN=TRDMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q4G073|TRDMT_RAT tRNA (cytosine(38)-C(5))-methyltransferase OS=Rattus norvegicus GN=Trdmt1 PE=2 SV=1 Back     alignment and function description
>sp|O55055|TRDMT_MOUSE tRNA (cytosine(38)-C(5))-methyltransferase OS=Mus musculus GN=Trdmt1 PE=2 SV=2 Back     alignment and function description
>sp|Q54JH6|CMT1_DICDI DNA (cytosine-5)-methyltransferase OS=Dictyostelium discoideum GN=dnmA PE=1 SV=1 Back     alignment and function description
>sp|P40999|PMT1M_SCHPO tRNA (cytosine(38)-C(5))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt1 PE=1 SV=1 Back     alignment and function description
>sp|P05102|MTH1_HAEPH Modification methylase HhaI OS=Haemophilus parahaemolyticus GN=hhaIM PE=1 SV=1 Back     alignment and function description
>sp|P25263|MTC1_HERAU Modification methylase HgiCI OS=Herpetosiphon aurantiacus GN=hgiCIM PE=3 SV=2 Back     alignment and function description
>sp|P19888|MTBA_BACAR Modification methylase BanI OS=Bacillus aneurinolyticus GN=banIM PE=1 SV=1 Back     alignment and function description
>sp|Q59603|MTB1_NEIGO Modification methylase NgoBI OS=Neisseria gonorrhoeae GN=ngoBIM PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
359476106393 PREDICTED: tRNA (cytosine-5-)-methyltran 0.989 0.982 0.739 1e-164
224092438350 DNA methyltransferase [Populus trichocar 0.894 0.997 0.747 1e-160
296081999366 unnamed protein product [Vitis vinifera] 0.925 0.986 0.719 1e-158
255548992404 DNA (cytosine-5)-methyltransferase, puta 0.953 0.920 0.697 1e-155
297812763383 DNA methyltransferase-2 [Arabidopsis lyr 0.951 0.968 0.707 1e-152
18420929383 DNA methyltransferase-2 [Arabidopsis tha 0.953 0.971 0.707 1e-151
21553420383 DNA methyltransferase PMT1-like protein 0.953 0.971 0.704 1e-151
449441930385 PREDICTED: tRNA (cytosine(38)-C(5))-meth 0.979 0.992 0.683 1e-148
363814463385 uncharacterized protein LOC100792567 [Gl 0.979 0.992 0.682 1e-147
357445897378 tRNA (cytosine-5-)-methyltransferase [Me 0.961 0.992 0.675 1e-144
>gi|359476106|ref|XP_002282454.2| PREDICTED: tRNA (cytosine-5-)-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 289/391 (73%), Positives = 324/391 (82%), Gaps = 5/391 (1%)

Query: 1   MEKDMCKNDGE-AWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHR 59
           MEK +C   GE  WRVLEFYSGIGGMRYSL +  V+A++VEAFDIN+ ANDVY+ NFGHR
Sbjct: 1   MEKGLCNPQGEDPWRVLEFYSGIGGMRYSLKRGGVNAKIVEAFDINNIANDVYQHNFGHR 60

Query: 60  PYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVK 119
           P QGNIQ+LTAA+LD Y AHAWLLSPPCQPYTRQGLQK S DARAFSFLKILELI HT+ 
Sbjct: 61  PCQGNIQSLTAADLDRYRAHAWLLSPPCQPYTRQGLQKHSGDARAFSFLKILELIQHTLH 120

Query: 120 PPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKP 179
           PP MLFVENVVGFETSDTH KMIEIL+ + ++TQEFILSP+QFGVPYSRPRYFCLAKRKP
Sbjct: 121 PPLMLFVENVVGFETSDTHEKMIEILSKTGFVTQEFILSPIQFGVPYSRPRYFCLAKRKP 180

Query: 180 LSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQ 239
           LSF  QL NNQLL +PSPL G++D ++I +HDQ +  WDKLL+SC+PVERFLEF N+ + 
Sbjct: 181 LSFENQLFNNQLLSTPSPLFGHEDDSLIDEHDQSEKIWDKLLQSCEPVERFLEFKNTINP 240

Query: 240 VNTETGFLSTGTAAVDDFGAAEETVEVDR--CVSIDHFLVPLSLIERWGSAMDIVYPDSK 297
           + TE+ +L T + + D  G  E   E DR    S D F VPLSLIERWGSAMDIVYPDSK
Sbjct: 241 LETESSYLDTLSVSTDASGELENN-ERDRSDSNSWDQFSVPLSLIERWGSAMDIVYPDSK 299

Query: 298 RCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFP 357
           RCCCFTKSYYRYVKGTGSLLAT Q K K KAS L+EQ LRYFTPREVANLHSFP DF FP
Sbjct: 300 RCCCFTKSYYRYVKGTGSLLATGQSK-KDKASLLEEQCLRYFTPREVANLHSFPEDFHFP 358

Query: 358 HHLSLRQRYALLGNSLSIAVVAPLLQYLFAQ 388
            H++LRQRYALLGNSLS+AVVAPLL YLF Q
Sbjct: 359 QHVNLRQRYALLGNSLSVAVVAPLLTYLFTQ 389

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224092438|ref|XP_002309610.1| DNA methyltransferase [Populus trichocarpa] gi|222855586|gb|EEE93133.1| DNA methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296081999|emb|CBI21004.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548992|ref|XP_002515552.1| DNA (cytosine-5)-methyltransferase, putative [Ricinus communis] gi|223545496|gb|EEF47001.1| DNA (cytosine-5)-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297812763|ref|XP_002874265.1| DNA methyltransferase-2 [Arabidopsis lyrata subsp. lyrata] gi|297320102|gb|EFH50524.1| DNA methyltransferase-2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18420929|ref|NP_568474.1| DNA methyltransferase-2 [Arabidopsis thaliana] gi|332006070|gb|AED93453.1| DNA methyltransferase-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21553420|gb|AAM62513.1| DNA methyltransferase PMT1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449441930|ref|XP_004138735.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase-like [Cucumis sativus] gi|449514978|ref|XP_004164528.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363814463|ref|NP_001242866.1| uncharacterized protein LOC100792567 [Glycine max] gi|255640237|gb|ACU20409.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357445897|ref|XP_003593226.1| tRNA (cytosine-5-)-methyltransferase [Medicago truncatula] gi|355482274|gb|AES63477.1| tRNA (cytosine-5-)-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
TAIR|locus:2179469383 DNMT2 "DNA methyltransferase-2 0.953 0.971 0.709 3.9e-140
UNIPROTKB|O14717391 TRDMT1 "tRNA (cytosine(38)-C(5 0.938 0.936 0.388 3.5e-59
UNIPROTKB|E2RM86391 TRDMT1 "Uncharacterized protei 0.935 0.933 0.395 4.5e-59
UNIPROTKB|Q7YS61391 TRDMT1 "tRNA (cytosine-5-)-met 0.933 0.930 0.393 1.2e-58
DICTYBASE|DDB_G0288047379 dnmA "DNA (cytosine-5-)-methyl 0.589 0.606 0.376 2e-57
FB|FBgn0028707345 Mt2 "Methyltransferase 2" [Dro 0.420 0.475 0.439 2.7e-56
MGI|MGI:1274787415 Trdmt1 "tRNA aspartic acid met 0.933 0.877 0.365 1.1e-55
ZFIN|ZDB-GENE-041008-138381 trdmt1 "tRNA aspartic acid met 0.912 0.934 0.373 2.3e-55
RGD|1306292391 Trdmt1 "tRNA aspartic acid met 0.933 0.930 0.373 7.8e-55
POMBASE|SPBC19C2.02330 pmt1 "tRNA methyltransferase" 0.417 0.493 0.447 6.9e-53
TAIR|locus:2179469 DNMT2 "DNA methyltransferase-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1371 (487.7 bits), Expect = 3.9e-140, P = 3.9e-140
 Identities = 269/379 (70%), Positives = 302/379 (79%)

Query:     8 NDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQN 67
             N+ + W+VLEFYSGIGGMRYSLM + + ++VVEAF+IND ANDVY+ NF HRPYQGNIQ+
Sbjct:    10 NEKKPWQVLEFYSGIGGMRYSLMASGIVSEVVEAFEINDSANDVYQHNFKHRPYQGNIQS 69

Query:    68 LTAAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVE 127
             LTAA+LD Y A AWLLSPPCQPYTRQGLQK S DARAFSFL+ILELIPHT KPP MLFVE
Sbjct:    70 LTAADLDKYNADAWLLSPPCQPYTRQGLQKHSGDARAFSFLRILELIPHTTKPPQMLFVE 129

Query:   128 NVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLL 187
             NVVGFETSDTH +MI  L   DY+TQEFILSPLQFGVPYSRPRYFCLAKRKPL F+ Q  
Sbjct:   130 NVVGFETSDTHMEMIGTLTKLDYVTQEFILSPLQFGVPYSRPRYFCLAKRKPLPFKSQHS 189

Query:   188 NNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFL 247
             NN+LL SP PL G DD     K  Q ++  DKLLE C PVE+FLE +   D   +     
Sbjct:   190 NNKLLWSPDPLYGRDDQVEFGKC-QAEEGLDKLLEFCKPVEKFLELAAHVDGEPSSVDDS 248

Query:   248 STGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYY 307
               G+   D  G   ++V  D   S+  +LVP+SLIERWG+AMDIVYPDSKRCCCFTKSYY
Sbjct:   249 ENGSK--DCCGQEGDSVP-D---SVHQYLVPVSLIERWGNAMDIVYPDSKRCCCFTKSYY 302

Query:   308 RYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYA 367
             RYVKGTGSLLATVQPK KGK S LKEQ LRYFTPREVAN HSFP DF+FP H+SLRQRYA
Sbjct:   303 RYVKGTGSLLATVQPKIKGKESCLKEQRLRYFTPREVANFHSFPEDFEFPKHISLRQRYA 362

Query:   368 LLGNSLSIAVVAPLLQYLF 386
             +LGNSLS+AVVAPLL+YLF
Sbjct:   363 MLGNSLSVAVVAPLLRYLF 381
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006306 "DNA methylation" evidence=IEA;ISS
UNIPROTKB|O14717 TRDMT1 "tRNA (cytosine(38)-C(5))-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM86 TRDMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YS61 TRDMT1 "tRNA (cytosine-5-)-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288047 dnmA "DNA (cytosine-5-)-methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0028707 Mt2 "Methyltransferase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1274787 Trdmt1 "tRNA aspartic acid methyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-138 trdmt1 "tRNA aspartic acid methyltransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306292 Trdmt1 "tRNA aspartic acid methyltransferase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
POMBASE|SPBC19C2.02 pmt1 "tRNA methyltransferase" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O55055TRDMT_MOUSE2, ., 1, ., 1, ., 2, 0, 40.36730.90250.8481yesno
Q4G073TRDMT_RAT2, ., 1, ., 1, ., 2, 0, 40.36760.91020.9079yesno
O14717TRDMT_HUMAN2, ., 1, ., 1, ., 2, 0, 40.37840.93840.9360yesno
Q54JH6CMT1_DICDI2, ., 1, ., 1, ., 3, 70.35270.87940.9050yesno
Q7YS61TRDMT_BOVIN2, ., 1, ., 1, ., 2, 0, 40.37400.90760.9053yesno
P40999PMT1M_SCHPONo assigned EC number0.34570.80760.9545yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1.370.824
3rd Layer2.1.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
DMT906
DNA methyltransferase (350 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XVIII.3078.1
S-adenosylmethionine decarboxylase (EC-4.1.1.50) (348 aa)
     •  0.899
gw1.VIII.2435.1
S-adenosylmethionine decarboxylase (EC-4.1.1.50) (303 aa)
     •  0.899
gw1.IV.4194.1
SubName- Full=Putative uncharacterized protein; (357 aa)
     •  0.899
gw1.123.86.1
SubName- Full=Putative uncharacterized protein; (357 aa)
     •  0.899
AdoMet5
s-adenosylmethionine synthetase 5 (EC-2.5.1.6); Catalyzes the formation of S-adenosylmethionine [...] (392 aa)
     •  0.899
ACS3
1-aminocyclopropane-1-carboxylate (EC-4.4.1.14) (467 aa)
     •  0.899
ACS6
1-aminocyclopropane-1-carboxylate (EC-4.4.1.14) (440 aa)
     •  0.899
ACS7
1-aminocyclopropane-1-carboxylate (480 aa)
     •  0.899
ACS8
1-aminocyclopropane-1-carboxylate (EC-4.4.1.14) (449 aa)
     •  0.899
ACS5
1-aminocyclopropane-1-carboxylate (EC-4.4.1.14) (446 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
cd00315275 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi 5e-52
COG0270328 COG0270, Dcm, Site-specific DNA methylase [DNA rep 1e-27
pfam00145320 pfam00145, DNA_methylase, C-5 cytosine-specific DN 2e-25
TIGR00675315 TIGR00675, dcm, DNA-methyltransferase (dcm) 4e-24
cd00315275 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi 1e-17
>gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information 
 Score =  174 bits (443), Expect = 5e-52
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 8/171 (4%)

Query: 13  WRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAE 72
            RV++ ++GIGG R  L KA    ++V A +I+  A + YE NF ++  +G+I  +   +
Sbjct: 1   LRVIDLFAGIGGFRLGLEKA--GFEIVAANEIDKSAAETYEANFPNKLIEGDITKIDEKD 58

Query: 73  LDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGF 132
                        PCQP++  G +K   D R   F +I+ ++    K P    +ENV G 
Sbjct: 59  FI-PDIDLLTGGFPCQPFSIAGKRKGFEDTRGTLFFEIIRILKE--KKPKYFLLENVKGL 115

Query: 133 ETSD---THAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPL 180
            T D   T   ++  L    Y     +L+   +GVP +R R F +  RK L
Sbjct: 116 LTHDNGNTLKVILNTLEELGYNVYWKLLNASDYGVPQNRERVFIIGIRKDL 166

Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the mammalian genome. These effects include transcriptional repression via inhibition of transcription factor binding or the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. Length = 275
>gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase Back     alignment and domain information
>gnl|CDD|233085 TIGR00675, dcm, DNA-methyltransferase (dcm) Back     alignment and domain information
>gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
PF00145335 DNA_methylase: C-5 cytosine-specific DNA methylase 100.0
TIGR00675315 dcm DNA-methyltransferase (dcm). All proteins in t 100.0
COG0270328 Dcm Site-specific DNA methylase [DNA replication, 100.0
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 100.0
PRK10458467 DNA cytosine methylase; Provisional 100.0
KOG0919338 consensus C-5 cytosine-specific DNA methylase [Tra 100.0
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.29
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.13
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.12
COG2520341 Predicted methyltransferase [General function pred 98.05
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.02
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.01
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.0
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.93
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.92
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.84
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.81
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.76
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.75
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 97.73
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.69
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.55
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 97.52
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.52
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.51
PHA03412241 putative methyltransferase; Provisional 97.51
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 97.5
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.47
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 97.46
PRK14967223 putative methyltransferase; Provisional 97.45
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.31
PHA03411279 putative methyltransferase; Provisional 97.27
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.22
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 97.15
PRK10901427 16S rRNA methyltransferase B; Provisional 97.14
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.14
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.08
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.07
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.07
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.98
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.94
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.94
COG4123248 Predicted O-methyltransferase [General function pr 96.94
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 96.93
PRK14904445 16S rRNA methyltransferase B; Provisional 96.91
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.89
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 96.86
PRK14901434 16S rRNA methyltransferase B; Provisional 96.84
PRK14902444 16S rRNA methyltransferase B; Provisional 96.82
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.8
PRK14968188 putative methyltransferase; Provisional 96.76
COG2890280 HemK Methylase of polypeptide chain release factor 96.72
KOG1227351 consensus Putative methyltransferase [General func 96.64
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 96.64
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.62
KOG2730263 consensus Methylase [General function prediction o 96.6
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.6
PTZ00146293 fibrillarin; Provisional 96.58
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.57
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 96.57
PRK14903431 16S rRNA methyltransferase B; Provisional 96.57
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.57
PRK04266226 fibrillarin; Provisional 96.46
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.45
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 96.43
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.4
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 96.25
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.24
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.2
PLN02336475 phosphoethanolamine N-methyltransferase 96.12
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.11
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 96.09
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 96.08
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.07
PRK03612521 spermidine synthase; Provisional 96.02
PRK01581374 speE spermidine synthase; Validated 96.02
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 95.95
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 95.88
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 95.86
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 95.86
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 95.81
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 95.81
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 95.77
PLN02490340 MPBQ/MSBQ methyltransferase 95.74
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 95.71
PTZ00338294 dimethyladenosine transferase-like protein; Provis 95.62
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.59
COG1041347 Predicted DNA modification methylase [DNA replicat 95.58
COG2521287 Predicted archaeal methyltransferase [General func 95.56
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 95.44
PRK10258251 biotin biosynthesis protein BioC; Provisional 95.43
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 95.41
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 95.38
PRK04148134 hypothetical protein; Provisional 95.35
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 95.33
KOG2904328 consensus Predicted methyltransferase [General fun 95.28
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.25
PRK11207197 tellurite resistance protein TehB; Provisional 95.19
PLN02244340 tocopherol O-methyltransferase 95.13
PRK05785226 hypothetical protein; Provisional 95.11
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 95.03
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 94.95
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 94.93
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 94.92
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 94.9
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 94.89
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 94.88
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 94.85
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 94.77
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 94.76
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 94.74
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 94.68
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 94.67
PRK06202232 hypothetical protein; Provisional 94.6
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 94.53
COG3897218 Predicted methyltransferase [General function pred 94.5
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 94.48
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 94.45
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 94.43
PRK13255218 thiopurine S-methyltransferase; Reviewed 94.42
PRK00811283 spermidine synthase; Provisional 94.42
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 94.41
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 94.37
PRK10742250 putative methyltransferase; Provisional 94.35
PLN02672 1082 methionine S-methyltransferase 94.32
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 94.3
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 94.24
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 94.24
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 94.04
PRK12335287 tellurite resistance protein TehB; Provisional 94.01
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 93.93
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 93.9
PLN02233261 ubiquinone biosynthesis methyltransferase 93.86
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 93.67
PRK06922677 hypothetical protein; Provisional 93.39
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 93.31
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 93.27
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 93.24
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 93.15
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 93.14
TIGR00740239 methyltransferase, putative. A simple BLAST search 93.1
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 93.08
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 92.91
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 92.78
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 92.68
PRK07402196 precorrin-6B methylase; Provisional 92.66
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 92.36
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 92.27
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 91.89
PLN02366308 spermidine synthase 91.84
TIGR00438188 rrmJ cell division protein FtsJ. 91.34
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 91.02
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 90.89
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 90.86
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 90.85
KOG1271227 consensus Methyltransferases [General function pre 90.66
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 90.57
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 90.47
COG4076252 Predicted RNA methylase [General function predicti 90.14
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 90.08
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 89.91
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 89.67
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 89.36
PLN02823336 spermine synthase 89.18
KOG1500517 consensus Protein arginine N-methyltransferase CAR 88.99
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 88.82
PLN02476278 O-methyltransferase 88.63
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 88.03
PF02086260 MethyltransfD12: D12 class N6 adenine-specific DNA 87.95
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 87.84
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 87.81
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 87.7
KOG2078495 consensus tRNA modification enzyme [RNA processing 87.64
PRK11524284 putative methyltransferase; Provisional 87.61
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 87.49
PLN02336475 phosphoethanolamine N-methyltransferase 87.29
PRK08317241 hypothetical protein; Provisional 86.93
PRK13699227 putative methylase; Provisional 86.71
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 86.7
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 86.34
TIGR00452314 methyltransferase, putative. Known examples to dat 86.29
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 86.07
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 85.41
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 84.61
KOG1499346 consensus Protein arginine N-methyltransferase PRM 84.26
KOG1270282 consensus Methyltransferases [Coenzyme transport a 84.04
COG4106257 Tam Trans-aconitate methyltransferase [General fun 83.63
PRK13256226 thiopurine S-methyltransferase; Reviewed 83.4
TIGR03438301 probable methyltransferase. This model represents 82.88
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 82.31
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 81.84
PRK04457262 spermidine synthase; Provisional 81.3
KOG2361264 consensus Predicted methyltransferase [General fun 80.38
COG4262508 Predicted spermidine synthase with an N-terminal m 80.16
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information 
Probab=100.00  E-value=3.1e-67  Score=508.56  Aligned_cols=164  Identities=30%  Similarity=0.540  Sum_probs=149.0

Q ss_pred             ceEEeeecCchhHHHHHHhcCCCccEEEEEcccHHHHHHHHHhcCCCCeecCccccchhhhcccCccEEEeCCCCchhhh
Q 016377           13 WRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSPPCQPYTR   92 (390)
Q Consensus        13 ~~~~dlF~G~Gg~~~g~~~aG~~~~~v~a~e~~~~a~~~~~~n~~~~~~~~di~~~~~~~~~~~~~D~l~~g~PCq~fS~   92 (390)
                      ++++|||||+||+++||++|||+  +++|+|+|+.|++||++||| .++.+||++++...+++ ++|+|+||||||+||.
T Consensus         1 ~~~~dlFsG~Gg~~~g~~~ag~~--~~~a~e~~~~a~~~y~~N~~-~~~~~Di~~~~~~~l~~-~~D~l~ggpPCQ~fS~   76 (335)
T PF00145_consen    1 MKVIDLFSGIGGFSLGLEQAGFE--VVWAVEIDPDACETYKANFP-EVICGDITEIDPSDLPK-DVDLLIGGPPCQGFSI   76 (335)
T ss_dssp             EEEEEET-TTTHHHHHHHHTTEE--EEEEEESSHHHHHHHHHHHT-EEEESHGGGCHHHHHHH-T-SEEEEE---TTTST
T ss_pred             CcEEEEccCccHHHHHHHhcCcE--EEEEeecCHHHHHhhhhccc-ccccccccccccccccc-cceEEEeccCCceEec
Confidence            58999999999999999999966  99999999999999999999 88899999999999996 6999999999999999


Q ss_pred             ccCCCCCCChhhhhHHHHHHhcccccCCCcEEEEeccccccCh---HHHHHHHHHHHhCCceeEEEEeCCCCcCCCccCc
Q 016377           93 QGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETS---DTHAKMIEILANSDYLTQEFILSPLQFGVPYSRP  169 (390)
Q Consensus        93 ~g~~~~~~d~r~~l~~~~~~~i~~~~~~P~~~~~ENV~~~~~~---~~~~~~~~~l~~~GY~~~~~~l~a~~~G~pq~R~  169 (390)
                      +|++++.+|+|+.||++++++++++  +|++|+||||+|+++.   ..++.+++.|+++||++.+.+|||++||+||+|+
T Consensus        77 ag~~~~~~d~r~~L~~~~~~~v~~~--~Pk~~~~ENV~~l~~~~~~~~~~~i~~~l~~lGY~v~~~vlna~~yGvPQ~R~  154 (335)
T PF00145_consen   77 AGKRKGFDDPRNSLFFEFLRIVKEL--KPKYFLLENVPGLLSSKNGEVFKEILEELEELGYNVQWRVLNAADYGVPQNRE  154 (335)
T ss_dssp             TSTHHCCCCHTTSHHHHHHHHHHHH--S-SEEEEEEEGGGGTGGGHHHHHHHHHHHHHTTEEEEEEEEEGGGGTSSBE-E
T ss_pred             cccccccccccchhhHHHHHHHhhc--cceEEEecccceeeccccccccccccccccccceeehhccccHhhCCCCCcee
Confidence            9998899999999999999999999  8999999999999997   4799999999999999999999999999999999


Q ss_pred             EEEEEEEeCCCcc
Q 016377          170 RYFCLAKRKPLSF  182 (390)
Q Consensus       170 R~~~i~~~~~~~~  182 (390)
                      |+|+||++++...
T Consensus       155 R~fivg~r~~~~~  167 (335)
T PF00145_consen  155 RVFIVGIRKDLPL  167 (335)
T ss_dssp             EEEEEEEEGGG--
T ss_pred             eEEEEEECCCCCc
Confidence            9999999998643

1.1.37 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [, , ]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [, ]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A []: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 1DCT_A 3LX6_A 3ME5_A 2QRV_A ....
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
1g55_A343 Structure Of Human Dnmt2, An Enigmatic Dna Methyltr 1e-61
4h0n_A333 Crystal Structure Of Spodoptera Frugiperda Dnmt2 E2 6e-44
3qv2_A327 Structure Analysis Of Entamoeba Histolytica Methylt 2e-26
3qv2_A327 Structure Analysis Of Entamoeba Histolytica Methylt 6e-20
2uyh_A327 Hhai Dna Methyltransferase S87q-Q237s Mutant Comple 5e-16
1mht_A327 Covalent Ternary Structure Of Hhai Methyltransferas 6e-15
1svu_A327 Structure Of The Q237w Mutant Of Hhai Dna Methyltra 1e-14
1fjx_A327 Structure Of Ternary Complex Of Hhai Methyltransfer 2e-14
2zcj_A327 Ternary Structure Of The Glu119gln M.Hhai, C5-Cytos 2e-14
2uz4_A327 Hhai Dna Methyltransferase R165n Mutant Complex Wit 4e-14
2uyc_A327 Hhai Dna Methyltransferase R163n Mutant Complex Wit 4e-14
2z6u_A327 Ternary Structure Of The Glu119ala M.Hhai, C5-Cytos 4e-14
2z6q_A327 Ternary Structure Of Arg165ala M.Hhai C5-Cytosine D 5e-14
2i9k_A327 Engineered Extrahelical Base Destabilization Enhanc 8e-14
2z6a_A327 S-Adenosyl-L-Methionine-Dependent Methyl Transfer: 1e-13
1dct_A324 Dna (Cytosine-5) Methylase From Haeiii Covalently B 3e-08
3ubt_Y331 Crystal Structure Of C71s Mutant Of Dna Cytosine-5 6e-07
3g7u_A376 Crystal Structure Of Putative Dna Modification Meth 1e-06
>pdb|1G55|A Chain A, Structure Of Human Dnmt2, An Enigmatic Dna Methyltransferase Homologue Length = 343 Back     alignment and structure 
Iteration: 1

 Score =  233 bits (594), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 208/392 (53%), Gaps = 66/392 (16%)
Query: 11  EAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGH-RPYQGNIQNLT 69
           E  RVLE YSG+GGM ++L ++ + AQVV A D+N  AN+VY+ NF H +     I+ +T
Sbjct: 1   EPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGIT 60
Query: 70  AAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENV 129
             E D       L+SPPCQP+TR G Q   +D+R  SFL IL+++P   K P  + +ENV
Sbjct: 61  LEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV 120
Query: 130 VGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAK--RKPLSFRCQLL 187
            GFE S T   +I+ + N  +  QEF+LSP   G+P SR RYF +AK   +PL F     
Sbjct: 121 KGFEVSSTRDLLIQTIENXGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPF----- 175
Query: 188 NNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFL 247
                ++P  +L       I + +Q D        S   ++ FLE               
Sbjct: 176 -----QAPGQVLMEFPKIEIHRKNQQDSDL-----SVKMLKDFLE--------------- 210
Query: 248 STGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYY 307
                  DD               ++ +L+P   + R+   +DIV P  +R  CFTK Y 
Sbjct: 211 -------DD-------------TDVNQYLLPPKSLLRYALLLDIVQPTXRRSVCFTKGYG 250
Query: 308 RYVKGTGSLLAT---VQPKNKGKA---SSLKEQ-------HLRYFTPREVANLHSFPGDF 354
            Y++GTGS+L T   VQ +N  K+    S +EQ        LRYFTP+E+ANL  FP +F
Sbjct: 251 SYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEF 310
Query: 355 QFPHHLSLRQRYALLGNSLSIAVVAPLLQYLF 386
            FP  ++++QRY LLGNSL++ VVA L++ L+
Sbjct: 311 GFPEKITVKQRYRLLGNSLNVHVVAKLIKILY 342
>pdb|4H0N|A Chain A, Crystal Structure Of Spodoptera Frugiperda Dnmt2 E260a/e261a/k263a Mutant Length = 333 Back     alignment and structure
>pdb|3QV2|A Chain A, Structure Analysis Of Entamoeba Histolytica Methyltransferase Ehmeth Length = 327 Back     alignment and structure
>pdb|3QV2|A Chain A, Structure Analysis Of Entamoeba Histolytica Methyltransferase Ehmeth Length = 327 Back     alignment and structure
>pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327 Back     alignment and structure
>pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 Back     alignment and structure
>pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327 Back     alignment and structure
>pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 Back     alignment and structure
>pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 Back     alignment and structure
>pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 Back     alignment and structure
>pdb|3UBT|Y Chain Y, Crystal Structure Of C71s Mutant Of Dna Cytosine-5 Methyltransferase M.Haeiii Bound To Dna Length = 331 Back     alignment and structure
>pdb|3G7U|A Chain A, Crystal Structure Of Putative Dna Modification Methyltransferase Encoded Within Prophage Cp-933r (E.Coli) Length = 376 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA me 1e-89
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 4e-60
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 7e-21
1dct_A324 Protein (modification methylase HAEIII); enzyme, c 1e-33
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 6e-26
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 3e-04
3me5_A482 Cytosine-specific methyltransferase; structural ge 1e-25
3g7u_A376 Cytosine-specific methyltransferase; DNA-binding, 6e-20
3g7u_A376 Cytosine-specific methyltransferase; DNA-binding, 1e-05
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 7e-16
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 3e-04
3swr_A1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 2e-14
3av4_A1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 Back     alignment and structure
 Score =  273 bits (699), Expect = 1e-89
 Identities = 134/390 (34%), Positives = 194/390 (49%), Gaps = 62/390 (15%)

Query: 11  EAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRP-YQGNIQNLT 69
           E  RVLE YSG+GGM ++L ++ + AQVV A D+N  AN+VY+ NF H       I+ +T
Sbjct: 1   EPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGIT 60

Query: 70  AAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENV 129
             E D       L+SPPCQP+TR G Q   +D+R  SFL IL+++P   K P  + +ENV
Sbjct: 61  LEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV 120

Query: 130 VGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNN 189
            GFE S T   +I+ + N  +  QEF+LSP   G+P SR RYF +AK +      Q    
Sbjct: 121 KGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQ 180

Query: 190 QLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLST 249
            L+  P             K +    +      S   ++ FLE                 
Sbjct: 181 VLMEFP-------------KIEIHRKNQQDSDLSVKMLKDFLEDD--------------- 212

Query: 250 GTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRY 309
                                 ++ +L+P   + R+   +DIV P  +R  CFTK Y  Y
Sbjct: 213 --------------------TDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSY 252

Query: 310 VKGTGSLLATVQ----------PKNKGKASSLKEQH---LRYFTPREVANLHSFPGDFQF 356
           ++GTGS+L T +            N  +   + +     LRYFTP+E+ANL  FP +F F
Sbjct: 253 IEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGF 312

Query: 357 PHHLSLRQRYALLGNSLSIAVVAPLLQYLF 386
           P  ++++QRY LLGNSL++ VVA L++ L+
Sbjct: 313 PEKITVKQRYRLLGNSLNVHVVAKLIKILY 342
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 Back     alignment and structure
>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 100.0
4h0n_A333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 100.0
3ubt_Y331 Modification methylase HAEIII; protein-DNA complex 100.0
3g7u_A376 Cytosine-specific methyltransferase; DNA-binding, 100.0
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA me 100.0
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 100.0
4ft4_B784 DNA (cytosine-5)-methyltransferase 1; chromodomain 100.0
3swr_A1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 100.0
4dkj_A403 Cytosine-specific methyltransferase; CG-specificit 100.0
3av4_A1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 100.0
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 100.0
3me5_A482 Cytosine-specific methyltransferase; structural ge 100.0
2qrv_B230 DNA (cytosine-5)-methyltransferase 3-like; DNA met 99.97
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 99.97
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.02
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.51
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.47
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.24
3k6r_A278 Putative transferase PH0793; structural genomics, 98.22
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.19
3lpm_A259 Putative methyltransferase; structural genomics, p 98.06
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.04
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 97.96
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.92
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.85
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 97.82
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.78
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 97.75
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 97.74
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.7
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 97.69
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.67
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 97.67
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 97.66
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.66
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.65
3lcc_A235 Putative methyl chloride transferase; halide methy 97.64
1ne2_A200 Hypothetical protein TA1320; structural genomics, 97.61
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.6
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.57
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.57
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 97.56
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.54
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 97.53
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 97.52
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.45
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 97.44
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.38
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.37
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.37
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.36
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.35
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.33
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 97.33
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.32
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.31
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.3
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.29
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.28
3fut_A271 Dimethyladenosine transferase; methyltransferase, 97.28
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 97.25
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 97.24
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.21
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.21
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.21
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 97.21
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.2
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 97.15
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 97.14
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 97.14
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 97.13
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.11
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 97.1
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.09
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.08
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.08
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.06
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 97.06
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.05
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.05
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.04
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 97.04
2pt6_A321 Spermidine synthase; transferase, structural genom 97.03
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.01
3ll7_A410 Putative methyltransferase; methytransferase, stru 96.99
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.98
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.98
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.98
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 96.97
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 96.97
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 96.94
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 96.93
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.92
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.91
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 96.91
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 96.9
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 96.9
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 96.88
3dh0_A219 SAM dependent methyltransferase; cystal structure, 96.87
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.85
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.84
2h00_A254 Methyltransferase 10 domain containing protein; st 96.84
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.83
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 96.83
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 96.83
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.82
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.8
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.79
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 96.79
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.79
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 96.77
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.76
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 96.75
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 96.75
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 96.74
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 96.73
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.73
2b3t_A276 Protein methyltransferase HEMK; translation termin 96.72
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.71
3m33_A226 Uncharacterized protein; structural genomics, PSI- 96.69
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.67
2i62_A265 Nicotinamide N-methyltransferase; structural genom 96.66
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 96.66
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.65
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 96.65
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 96.64
2i7c_A283 Spermidine synthase; transferase, structural genom 96.58
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.54
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 96.52
3f4k_A257 Putative methyltransferase; structural genomics, P 96.52
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.51
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 96.51
1xxl_A239 YCGJ protein; structural genomics, protein structu 96.5
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.47
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.46
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.45
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 96.44
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 96.43
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 96.43
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 96.42
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 96.39
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 96.39
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 96.32
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.29
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.27
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 96.21
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 96.21
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 96.18
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.15
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 96.12
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 96.09
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.08
1vl5_A260 Unknown conserved protein BH2331; putative methylt 96.07
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.06
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.05
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.04
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 96.03
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.98
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 95.95
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 95.94
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 95.93
3lkd_A542 Type I restriction-modification system methyltrans 95.92
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 95.91
2o07_A304 Spermidine synthase; structural genomics, structur 95.91
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 95.91
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 95.9
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 95.9
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 95.89
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 95.89
3ocj_A305 Putative exported protein; structural genomics, PS 95.85
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 95.85
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 95.83
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 95.76
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 95.75
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 95.69
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 95.69
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 95.63
2oo3_A283 Protein involved in catabolism of external DNA; st 95.62
2kw5_A202 SLR1183 protein; structural genomics, northeast st 95.62
3gjy_A317 Spermidine synthase; APC62791, structural genomics 95.6
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 95.58
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 95.57
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 95.54
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 95.54
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 95.53
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 95.51
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 95.49
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 95.44
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 95.43
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 95.42
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 95.42
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 95.41
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 95.3
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.28
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 95.26
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 95.25
2fyt_A340 Protein arginine N-methyltransferase 3; structural 95.24
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 95.21
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 95.17
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 95.17
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 95.16
2p7i_A250 Hypothetical protein; putative methyltransferase, 95.13
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 95.13
1wzn_A252 SAM-dependent methyltransferase; structural genomi 95.1
3ege_A261 Putative methyltransferase from antibiotic biosyn 95.1
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 95.09
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 95.04
2b25_A336 Hypothetical protein; structural genomics, methyl 95.04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 95.04
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 95.01
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 95.0
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 94.97
2zig_A297 TTHA0409, putative modification methylase; methylt 94.95
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 94.95
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 94.9
3gu3_A284 Methyltransferase; alpha-beta protein, structural 94.88
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 94.82
1vlm_A219 SAM-dependent methyltransferase; possible histamin 94.81
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 94.8
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 94.79
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 94.77
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 94.73
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 94.66
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 94.43
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 94.42
3cc8_A230 Putative methyltransferase; structural genomics, j 94.35
4hg2_A257 Methyltransferase type 11; structural genomics, PS 94.34
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 94.33
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 94.3
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 94.23
2r3s_A335 Uncharacterized protein; methyltransferase domain, 94.23
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 94.12
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 94.0
1jsx_A207 Glucose-inhibited division protein B; methyltransf 94.0
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 93.9
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 93.81
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 93.77
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 93.69
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 93.61
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 93.59
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 93.54
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 93.53
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 93.51
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 93.32
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 93.32
3khk_A544 Type I restriction-modification system methylation 93.31
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 93.25
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 93.18
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 93.17
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 93.0
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 92.72
1xj5_A334 Spermidine synthase 1; structural genomics, protei 92.64
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 92.47
2cmg_A262 Spermidine synthase; transferase, putrescine amino 92.43
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 91.92
3dp7_A363 SAM-dependent methyltransferase; structural genomi 91.55
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 91.51
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 91.5
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 91.49
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 91.44
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 91.13
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 90.77
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 90.6
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 90.55
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 90.43
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 90.0
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 89.78
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 89.58
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 89.28
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 89.11
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 89.1
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 88.79
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 88.25
3ufb_A530 Type I restriction-modification system methyltran 87.84
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 87.73
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 87.51
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 87.42
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 87.39
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 87.31
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 87.23
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 86.31
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 86.23
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 85.62
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 84.03
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 83.65
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 81.3
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 80.95
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 80.33
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=5.6e-73  Score=544.04  Aligned_cols=314  Identities=34%  Similarity=0.661  Sum_probs=272.2

Q ss_pred             cCCCCCceEEeeecCchhHHHHHHhcCCCccEE-EEEcccHHHHHHHHHhcCCCCeecCccccchhhhcccCccEEEeCC
Q 016377            7 KNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVV-EAFDINDKANDVYELNFGHRPYQGNIQNLTAAELDMYGAHAWLLSP   85 (390)
Q Consensus         7 ~~~~~~~~~~dlF~G~Gg~~~g~~~aG~~~~~v-~a~e~~~~a~~~~~~n~~~~~~~~di~~~~~~~~~~~~~D~l~~g~   85 (390)
                      .-...+++++|||||+||+++||++||++++++ +|+|+|+.|++||++|||+.++++||++++.++++..++|+|+|||
T Consensus         5 ~m~~~~~~vidLFaG~GG~~~G~~~aG~~~~~v~~a~e~d~~a~~ty~~N~~~~~~~~DI~~~~~~~i~~~~~Dil~ggp   84 (327)
T 3qv2_A            5 SMQQKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWFMSP   84 (327)
T ss_dssp             ---CCCEEEEEETCTTTHHHHHHHHSSCCCCEEEEEECCCHHHHHHHHHHHCCCCBCCCTTTCCHHHHHHTCCCEEEECC
T ss_pred             cccCCCCEEEEECCChhHHHHHHHHcCCCceEEEEEEECCHHHHHHHHHHCCCCcccCChhhcCHHHhccCCCCEEEecC
Confidence            335568999999999999999999999866699 9999999999999999999989999999999888855699999999


Q ss_pred             CCchh--hhccCCCCCCChhhhhHHHHHH-hcccccCCCcEEEEeccccccChHHHHHHHHHHHhCCceeEEEEeCCCCc
Q 016377           86 PCQPY--TRQGLQKQSSDARAFSFLKILE-LIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQF  162 (390)
Q Consensus        86 PCq~f--S~~g~~~~~~d~r~~l~~~~~~-~i~~~~~~P~~~~~ENV~~~~~~~~~~~~~~~l~~~GY~~~~~~l~a~~~  162 (390)
                      |||+|  |.+|++++.+|+|+.||+++++ ++++++.+|++|+||||+|++++.+++.+++.|+++||.+.+.+|||++|
T Consensus        85 PCQ~fs~S~ag~~~~~~d~r~~L~~~~~r~~i~~~~~~P~~~~lENV~gl~~~~~~~~i~~~l~~~GY~v~~~vl~a~~y  164 (327)
T 3qv2_A           85 PCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSPIDI  164 (327)
T ss_dssp             CCTTCSHHHHTTTCTTTCGGGHHHHHHHHTTGGGCSSCCSEEEEEECGGGGGSHHHHHHHHHHHHTTCEEEEEEECGGGG
T ss_pred             CccCcccccCCCCCCCccccchhHHHHHHHHHHHhccCCCEEEEEchhhhcChHHHHHHHHHHHhCCCEEEEEEEeHHHc
Confidence            99999  9999999999999999999999 99985226999999999999999999999999999999999999999999


Q ss_pred             CCCccCcEEEEEEEeCCCcccccccccccccCCCCCCCCCCccccccCCCCCCccccccccCCchhhhhhccCCCCcccc
Q 016377          163 GVPYSRPRYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNT  242 (390)
Q Consensus       163 G~pq~R~R~~~i~~~~~~~~~~~~~~~~~~~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~~~~~~~~~~  242 (390)
                      |+||+|+|+|+||++++            |.+|.|++..                     ...+++|+|+....      
T Consensus       165 GvPQ~R~R~fivg~r~~------------f~fP~~~~~~---------------------~~~~l~d~Le~~~~------  205 (327)
T 3qv2_A          165 GIPNSRTRYYVMARLTP------------FKNEIQLHQE---------------------KESMISNYLDNNVN------  205 (327)
T ss_dssp             TCSBCCCEEEEEEESSC------------CCSCCCCCCC---------------------SCCCGGGGCCSSCC------
T ss_pred             CCCccceEEEEEEEeCC------------CCCCCccccc---------------------ccccHHHHhccccc------
Confidence            99999999999999987            3457666531                     12357788873211      


Q ss_pred             cccccccCcccccccCCCcccchhcccccccccccchhHHhhhcccccccCCCCcccccccCCcEEeecCCccceeecCC
Q 016377          243 ETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQP  322 (390)
Q Consensus       243 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~d~~~p~~~~~~~~~~~y~r~~~~~~~~t~~~~~  322 (390)
                                                    .+|.++.+.+.+++...|++.|++.++.|++++|+++..+.++.++....
T Consensus       206 ------------------------------~~y~l~~~~~~~~~~~~di~~~~~~~~~~~t~~y~~y~~~~gs~l~~~~~  255 (327)
T 3qv2_A          206 ------------------------------ESYSIPSDLILKKGMLFDIVGKDDKRTCCFTKSYTKIVEGTGSIYCPIEP  255 (327)
T ss_dssp             ------------------------------GGGBCCHHHHHHHGGGSCEEETTSSCBCCCCTTTTTSSTTSCCEEESSCS
T ss_pred             ------------------------------ccccCCHHHHHhhhcccccccccccccccccccceEEecCCCceeecccc
Confidence                                          33666777788888999999999999999999999999998887744321


Q ss_pred             C--CCCCccccccCccccccHHHHHHhCCCCCCeecC-CCCCHHHHHHHhCCccchHHHHHHHHHHHhcc
Q 016377          323 K--NKGKASSLKEQHLRYFTPREVANLHSFPGDFQFP-HHLSLRQRYALLGNSLSIAVVAPLLQYLFAQA  389 (390)
Q Consensus       323 ~--~~~~~~~ihp~~~R~LT~rE~aRLQgFPd~y~f~-g~~s~~~~y~qiGNAVp~~v~~~I~~~l~~~~  389 (390)
                      .  ...+...+|+.+.|+|||||+||||||||+|.|+ +++|.+++|+|+||||||+|+++|++.|+++.
T Consensus       256 ~~~~~~~~~~~~~~~~R~lt~~E~~rlqgfP~~~~~~~~~~s~~~~y~~~GNsv~v~v~~~i~~~l~~~l  325 (327)
T 3qv2_A          256 HFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQLMEYLFDDL  325 (327)
T ss_dssp             SCCCCSSGGGGTTSCCBCCCHHHHHHHTTCCTTCCSCCTTCCHHHHHHHHHTSCCHHHHHHHHHHHTTTS
T ss_pred             cccccCCceeecCCccccCcHHHHHHhCcCCHHHcCCcCCCCHHHHHHHccCccCHHHHHHHHHHHHHHh
Confidence            1  1224556799999999999999999999999999 67899999999999999999999999998764
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d1g55a_343 c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 1e-44
d1dcta_324 c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a 4e-26
d2c7pa1327 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu 2e-25
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNMT2
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  155 bits (392), Expect = 1e-44
 Identities = 134/390 (34%), Positives = 194/390 (49%), Gaps = 62/390 (15%)

Query: 11  EAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRP-YQGNIQNLT 69
           E  RVLE YSG+GGM ++L ++ + AQVV A D+N  AN+VY+ NF H       I+ +T
Sbjct: 1   EPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGIT 60

Query: 70  AAELDMYGAHAWLLSPPCQPYTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENV 129
             E D       L+SPPCQP+TR G Q   +D+R  SFL IL+++P   K P  + +ENV
Sbjct: 61  LEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV 120

Query: 130 VGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFRCQLLNN 189
            GFE S T   +I+ + N  +  QEF+LSP   G+P SR RYF +AK +      Q    
Sbjct: 121 KGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQ 180

Query: 190 QLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLST 249
            L+  P             K +    +      S   ++ FLE                 
Sbjct: 181 VLMEFP-------------KIEIHRKNQQDSDLSVKMLKDFLE----------------- 210

Query: 250 GTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRY 309
                                 ++ +L+P   + R+   +DIV P  +R  CFTK Y  Y
Sbjct: 211 ------------------DDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSY 252

Query: 310 VKGTGSLLATVQPKN-------------KGKASSLKEQHLRYFTPREVANLHSFPGDFQF 356
           ++GTGS+L T +                + + + L    LRYFTP+E+ANL  FP +F F
Sbjct: 253 IEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGF 312

Query: 357 PHHLSLRQRYALLGNSLSIAVVAPLLQYLF 386
           P  ++++QRY LLGNSL++ VVA L++ L+
Sbjct: 313 PEKITVKQRYRLLGNSLNVHVVAKLIKILY 342
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 100.0
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 100.0
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.52
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.49
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.48
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.43
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.29
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.28
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.26
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.24
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.23
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.09
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.08
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 97.94
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.76
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.74
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.45
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 97.32
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.27
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.22
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.16
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.09
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.03
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.79
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.75
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.63
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.44
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 96.26
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.22
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.17
d2h00a1250 Methyltransferase 10 domain containing protein MET 96.15
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.12
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 96.09
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 96.0
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 95.99
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.96
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.96
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 95.86
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 95.85
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 95.83
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 95.83
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 95.81
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 95.65
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 95.6
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.56
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.4
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 95.07
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 94.79
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 94.74
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 94.67
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 94.52
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 94.35
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 94.03
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 93.94
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 93.74
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 93.73
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 93.72
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 93.5
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 92.92
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 92.7
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 92.67
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 92.56
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 91.99
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 91.96
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 91.73
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 91.69
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 91.54
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 90.99
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 90.7
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 90.59
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 90.51
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 89.85
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 89.4
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 89.32
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 89.16
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 89.09
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 88.45
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 87.72
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 86.75
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 86.62
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 86.38
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 85.2
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 84.95
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 84.23
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 83.72
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 81.71
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNMT2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.6e-72  Score=539.27  Aligned_cols=328  Identities=39%  Similarity=0.637  Sum_probs=218.8

Q ss_pred             CCceEEeeecCchhHHHHHHhcCCCccEEEEEcccHHHHHHHHHhcCC-CCeecCccccchhhhcccCccEEEeCCCCch
Q 016377           11 EAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGH-RPYQGNIQNLTAAELDMYGAHAWLLSPPCQP   89 (390)
Q Consensus        11 ~~~~~~dlF~G~Gg~~~g~~~aG~~~~~v~a~e~~~~a~~~~~~n~~~-~~~~~di~~~~~~~~~~~~~D~l~~g~PCq~   89 (390)
                      ++|+|+|||||+||+++||++||+++++++|+|+|++|++||++|||+ .++++||++++..+++..++|+|+||||||+
T Consensus         1 ~p~kv~~lF~G~Gg~~~gl~~aG~~~~~~~a~E~~~~a~~~~~~n~~~~~~~~~di~~~~~~~~~~~~~Dll~ggpPCq~   80 (343)
T d1g55a_           1 EPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQP   80 (343)
T ss_dssp             CCEEEEEETCTTCHHHHHHHHHTCSEEEEEEECCCHHHHHHHHHHCTTSCEECSCGGGCCHHHHHHHCCSEEEECCC---
T ss_pred             CCCEEEEcCcCccHHHHHHHHcCCCCeEEEEEECCHHHHHHHHHHCCCCCcccCchhhCCHhHcCCCCccEEEeeccccc
Confidence            478999999999999999999999878999999999999999999998 4577999999998887657999999999999


Q ss_pred             hhhccCCCCCCChhhhhHHHHHHhcccccCCCcEEEEeccccccChHHHHHHHHHHHhCCceeEEEEeCCCCcCCCccCc
Q 016377           90 YTRQGLQKQSSDARAFSFLKILELIPHTVKPPHMLFVENVVGFETSDTHAKMIEILANSDYLTQEFILSPLQFGVPYSRP  169 (390)
Q Consensus        90 fS~~g~~~~~~d~r~~l~~~~~~~i~~~~~~P~~~~~ENV~~~~~~~~~~~~~~~l~~~GY~~~~~~l~a~~~G~pq~R~  169 (390)
                      ||.+|++++.+|+|+.|+++++++++++..+|++|+||||+++++.+.++.+++.|+++||.+.+.+|||++||+||+|+
T Consensus        81 fS~ag~~~~~~d~r~~l~~~~~~~i~~~~~kPk~~i~ENV~~l~~~~~~~~i~~~l~~~GY~v~~~vlna~dyGvPQ~R~  160 (343)
T d1g55a_          81 FTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRL  160 (343)
T ss_dssp             ---------------CHHHHHHHHGGGCSSCCSEEEEEEETTGGGSHHHHHHHHHHHHTTEEEEEEEECGGGGTCSCCCC
T ss_pred             ccccccccccccccccccchhhhhHhhhcCCCceeeeeccCCcccchhhHHHHhhhhccccccceeeeeccccCCcccce
Confidence            99999999999999999999999999863369999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEEEeCCCcccccccccccccCCCCCCCCCCccccccCCCCCCccccccccCCchhhhhhccCCCCccccccccccc
Q 016377          170 RYFCLAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLST  249 (390)
Q Consensus       170 R~~~i~~~~~~~~~~~~~~~~~~~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~~~~~~~~~~~~~~~~~  249 (390)
                      |+|+||++++...+++.+....+.+|......             ............+.++++.....            
T Consensus       161 Rvfivg~r~~~~~~~~~p~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~~~l~~~~~~------------  215 (343)
T d1g55a_         161 RYFLIAKLQSEPLPFQAPGQVLMEFPKIEIHR-------------KNQQDSDLSVKMLKDFLEDDTDV------------  215 (343)
T ss_dssp             EEEEEEEESSSCCTTCCTTCEESSCCC-------------------------CCCCCGGGGCCTTCCH------------
T ss_pred             eEEEEEEeCCccccCCCcccccccCCcccccc-------------cccccccccccchhhhcccccch------------
Confidence            99999999987654432222222222111000             00000011112344444321110            


Q ss_pred             CcccccccCCCcccchhcccccccccccchhHHhhhcccccccCCCCcccccccCCcE----------EeecC----Ccc
Q 016377          250 GTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYY----------RYVKG----TGS  315 (390)
Q Consensus       250 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~d~~~p~~~~~~~~~~~y~----------r~~~~----~~~  315 (390)
                                             ..+..+.....++........+...+..+++..++          +..+.    ...
T Consensus       216 -----------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  272 (343)
T d1g55a_         216 -----------------------NQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIY  272 (343)
T ss_dssp             -----------------------HHHBCCHHHHHHHGGGCCEECTTCSCCCCCCTTTTTCCTTSCCEEECCSSCCHHHHH
T ss_pred             -----------------------hhcccChHhhhhhhhhcccccccccccchhcccccccccCCCcccccccccccCCcc
Confidence                                   01111111111121111111222222111221111          11111    111


Q ss_pred             ceeecCCCCCCCccccccCccccccHHHHHHhCCCCCCeecCCCCCHHHHHHHhCCccchHHHHHHHHHHHh
Q 016377          316 LLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFA  387 (390)
Q Consensus       316 ~t~~~~~~~~~~~~~ihp~~~R~LT~rE~aRLQgFPd~y~f~g~~s~~~~y~qiGNAVp~~v~~~I~~~l~~  387 (390)
                      .+++.. ........+||.+.|.||||||||||||||+|+|++.+|.+++|+||||||||+|+++|++.|+|
T Consensus       273 ~~~~~~-~~~~~~~~~~~~~~R~LT~rE~arLQgFPd~f~~~~~~s~~~~ykqiGNaVp~~v~~~i~k~l~e  343 (343)
T d1g55a_         273 KSLTNL-SQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGNSLNVHVVAKLIKILYE  343 (343)
T ss_dssp             HTTTTC-CHHHHHHHHHTTCEECCCHHHHHHHTTCCTTCCCCTTSCHHHHHHHHHHSCCHHHHHHHHHHHHC
T ss_pred             cccccC-CCCCCcccCCCCCCcCCCHHHHHHhCCCCCCCEECCCCCHHHHhhhEeCCccHHHHHHHHHHhcC
Confidence            111111 11122345799999999999999999999999999999999999999999999999999999975
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure