Citrus Sinensis ID: 016417

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MTTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTSSFSTGLISISLKQRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
ccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccHHHHccccccccccccHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccHHHHHHHHHHHHc
ccEEEEEEEEccccccHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccEEccccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHccccccccEEEccccccccEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHccHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHcc
mttaaccfrstslpssfsIHKKLAVKRNSNAVSFMGLLsfspktssfstgLISISLKQRRSKNSFQvravaapseavsgfdemVAGTQRKYYMlggkggvgktSCAASLAVKfannghptlvvstdpahslsdsfaqdltggqlvpvegpdfplfaleinpeKAREEFRNvtqkdggtgvkdfmdgMGLGMLVEQLGelklgelldtpppgldeAIAISkghtlrllslpdfldASIGKILKLREKIASATSAIKSVFgqeqnrqgASDKLERLRERMVKVRELfrdtdsteFVIVTIPTVMavsessrlseslkkenvpvkrlivnqiippsasdckfCAMKRKDQMRALEMIKSdselsslmlieaplvdveirgvpalrfmgdiiwk
mttaaccfrstslpssfsIHKKLAVKRNSNAVSFMGLLSfspktssfSTGLISISlkqrrsknsfqvravaapseavsgfdeMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREefrnvtqkdggtgvKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAiksvfgqeqnrqgasdklerLRERMVKVrelfrdtdstefviVTIPTVmavsessrlseslkkenvpvkrlivnqiippsasdckfCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
MTTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTSSFSTGLISISLKQRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMlveqlgelklgellDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVsessrlseslkkeNVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
*****CCFR*******FSIHKKLAVKRNSNAVSFMGLLSF*********GLIS***********************VSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVST*********FAQDLTGGQLVPVEGPDFPLFALEIN*****************TGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAI***********************MVKVRELFRDTDSTEFVIVTIPTVMAV**************VPVKRLIVNQIIPPSASDCKFCAMK****************LSSLMLIEAPLVDVEIRGVPALRFMGDIIW*
*******FRSTS**********************MGLLSFSPKTSSFSTGLIS*************************GFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVT******************MLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILK************************ASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
MTTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTSSFSTGLISISLKQRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMA**********LKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
*TTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTSSFSTGLISISLKQRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTSSFSTGLISISLKQRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNxxxxxxxxxxxxxxxxxxxxxFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
O27555324 Putative arsenical pump-d yes no 0.679 0.817 0.325 1e-37
Q58542349 Putative arsenical pump-d yes no 0.723 0.808 0.326 2e-33
Q5TRE7337 ATPase ASNA1 homolog OS=A yes no 0.671 0.777 0.316 2e-30
Q16MG9341 ATPase ASNA1 homolog OS=A N/A no 0.682 0.780 0.309 2e-30
B0WEV5348 ATPase ASNA1 homolog OS=C N/A no 0.669 0.75 0.322 3e-30
P0CM24325 ATPase GET3 OS=Cryptococc yes no 0.676 0.812 0.298 5e-29
P0CM25325 ATPase GET3 OS=Cryptococc N/A no 0.676 0.812 0.298 5e-29
A7RQM5334 ATPase ASNA1 homolog OS=N N/A no 0.735 0.859 0.318 7e-29
A0E7A5325 ATPase ASNA1 homolog 2 OS N/A no 0.674 0.809 0.287 1e-28
Q8T662329 ATPase ASNA1 homolog OS=D yes no 0.671 0.796 0.307 2e-28
>sp|O27555|ARSA_METTH Putative arsenical pump-driving ATPase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1511 PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (397), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 162/307 (52%), Gaps = 42/307 (13%)

Query: 106 AASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAR 165
           +A+ A+  A +G  TLV+STDPAHSLSDS  +++        E     L+A+EI+PE A 
Sbjct: 31  SAATALWMARSGKKTLVISTDPAHSLSDSLEREIGHTPTKITEN----LYAVEIDPEVAM 86

Query: 166 EEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISK----- 220
           EE++   Q+           GMGL ML +Q+    +        PG+DEA A  +     
Sbjct: 87  EEYQAKLQEQAAMN-----PGMGLDMLQDQMDMASMS-------PGIDEAAAFDQFLRYM 134

Query: 221 ---------------GHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVF---GQEQ 262
                          GHTLRLLS P+ +D+ +GK++K+R +I S   A K++    G E+
Sbjct: 135 TTDEYDIVIFDTAPTGHTLRLLSFPEIMDSWVGKMIKIRRQIGSMAKAFKNILPFMGDEE 194

Query: 263 NRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVK 322
               A   +E  ++++   RE+  D + T F +V IP  M++ ES R  ++L+K ++   
Sbjct: 195 EEDRALQDMEATKKQINAAREVMSDPERTSFKMVVIPEEMSIYESERAMKALEKYSIHAD 254

Query: 323 RLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALR 382
            +IVNQ++ P  SDC+FC  +RK Q   L+ I+   + S  ++ E PL+  E +G+  L 
Sbjct: 255 GVIVNQVL-PEESDCEFCNARRKLQQERLKQIR--EKFSDKVVAEVPLLKKEAKGIETLE 311

Query: 383 FMGDIIW 389
            + + ++
Sbjct: 312 KIAEQLY 318
Anion-transporting ATPase. Catalyzes the extrusion of arsenite.
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (taxid: 187420)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q58542|ARSA_METJA Putative arsenical pump-driving ATPase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1142 PE=1 SV=1 Back     alignment and function description
>sp|Q5TRE7|ASNA_ANOGA ATPase ASNA1 homolog OS=Anopheles gambiae GN=AGAP005782 PE=3 SV=3 Back     alignment and function description
>sp|Q16MG9|ASNA_AEDAE ATPase ASNA1 homolog OS=Aedes aegypti GN=AAEL011136 PE=3 SV=1 Back     alignment and function description
>sp|B0WEV5|ASNA_CULQU ATPase ASNA1 homolog OS=Culex quinquefasciatus GN=CPIJ005690 PE=3 SV=1 Back     alignment and function description
>sp|P0CM24|GET3_CRYNJ ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET3 PE=3 SV=1 Back     alignment and function description
>sp|P0CM25|GET3_CRYNB ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET3 PE=3 SV=1 Back     alignment and function description
>sp|A7RQM5|ASNA_NEMVE ATPase ASNA1 homolog OS=Nematostella vectensis GN=v1g161623 PE=3 SV=1 Back     alignment and function description
>sp|A0E7A5|ASNA2_PARTE ATPase ASNA1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00023900001 PE=3 SV=1 Back     alignment and function description
>sp|Q8T662|ASNA_DICDI ATPase ASNA1 homolog OS=Dictyostelium discoideum GN=arsA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
255580205412 arsenical pump-driving atpase, putative 0.989 0.936 0.766 1e-172
297829562410 anion-transporting ATPase family protein 0.928 0.882 0.766 1e-164
225449002413 PREDICTED: putative arsenical pump-drivi 0.928 0.876 0.762 1e-163
296085994 589 unnamed protein product [Vitis vinifera] 0.928 0.614 0.756 1e-163
224109802407 predicted protein [Populus trichocarpa] 0.930 0.891 0.771 1e-163
356576235403 PREDICTED: putative arsenical pump-drivi 0.928 0.898 0.753 1e-162
30681260411 anion-transporting ATPase family protein 0.928 0.880 0.764 1e-161
357443179404 ATPase ASNA1-like protein [Medicago trun 0.933 0.900 0.753 1e-160
356535619404 PREDICTED: putative arsenical pump-drivi 0.948 0.915 0.738 1e-160
334185217433 anion-transporting ATPase family protein 0.928 0.836 0.723 1e-157
>gi|255580205|ref|XP_002530933.1| arsenical pump-driving atpase, putative [Ricinus communis] gi|223529492|gb|EEF31448.1| arsenical pump-driving atpase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 319/416 (76%), Positives = 354/416 (85%), Gaps = 30/416 (7%)

Query: 1   MTTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTS---SFSTGLISISLK 57
           M T A C  + S  SSFS+H  L   RNS  +S +GLLSF+P+T    S +T LI+ S+K
Sbjct: 1   MATIASCIVTHST-SSFSLHN-LFTPRNS--MSAVGLLSFAPRTRTSPSLATSLIAFSVK 56

Query: 58  QRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNG 117
           Q+  +NS QVR+VAAP+E V+GFDEMV+GTQRKYYMLGGKGGVGKTSCAASLAVKFANNG
Sbjct: 57  QKPGRNSLQVRSVAAPAEDVAGFDEMVSGTQRKYYMLGGKGGVGKTSCAASLAVKFANNG 116

Query: 118 HPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGG 177
           HPTLVVSTDPAHSLSDSFAQ+L GG LVPVEGPD+PL+ALEINPEKAREEFR  +QK+GG
Sbjct: 117 HPTLVVSTDPAHSLSDSFAQNLAGGTLVPVEGPDYPLYALEINPEKAREEFRGASQKNGG 176

Query: 178 TGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISK----------------- 220
           TGVKDFM+GMGLGM+VEQLGELKLGELLDTPPPGLDEAIAISK                 
Sbjct: 177 TGVKDFMEGMGLGMIVEQLGELKLGELLDTPPPGLDEAIAISKVMQFLESQEYKMFTRIV 236

Query: 221 ------GHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERL 274
                 GHTLRLLSLPDFLDASIGKILKL++KI+SATSAIKSVFGQE+ RQ A+DKLERL
Sbjct: 237 FDTAPTGHTLRLLSLPDFLDASIGKILKLKQKISSATSAIKSVFGQEETRQDAADKLERL 296

Query: 275 RERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSA 334
           RERM+KVRELFRDTDSTEFV+VTIPTVMA+SESSRL  SLKKENVPVKRLIVNQI+PPSA
Sbjct: 297 RERMIKVRELFRDTDSTEFVVVTIPTVMAISESSRLHASLKKENVPVKRLIVNQILPPSA 356

Query: 335 SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK 390
           SDCKFCAMKRKDQ RAL+MI+SD ELSSL LI APLVDVEIRGVPAL+F+GDIIWK
Sbjct: 357 SDCKFCAMKRKDQTRALDMIQSDPELSSLTLIRAPLVDVEIRGVPALQFLGDIIWK 412

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297829562|ref|XP_002882663.1| anion-transporting ATPase family protein [Arabidopsis lyrata subsp. lyrata] gi|297328503|gb|EFH58922.1| anion-transporting ATPase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225449002|ref|XP_002271753.1| PREDICTED: putative arsenical pump-driving ATPase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085994|emb|CBI31435.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224109802|ref|XP_002315316.1| predicted protein [Populus trichocarpa] gi|118487322|gb|ABK95489.1| unknown [Populus trichocarpa] gi|222864356|gb|EEF01487.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356576235|ref|XP_003556239.1| PREDICTED: putative arsenical pump-driving ATPase-like [Glycine max] Back     alignment and taxonomy information
>gi|30681260|ref|NP_187646.2| anion-transporting ATPase family protein [Arabidopsis thaliana] gi|119935933|gb|ABM06038.1| At3g10350 [Arabidopsis thaliana] gi|332641373|gb|AEE74894.1| anion-transporting ATPase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357443179|ref|XP_003591867.1| ATPase ASNA1-like protein [Medicago truncatula] gi|355480915|gb|AES62118.1| ATPase ASNA1-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356535619|ref|XP_003536342.1| PREDICTED: putative arsenical pump-driving ATPase-like [Glycine max] Back     alignment and taxonomy information
>gi|334185217|ref|NP_001189855.1| anion-transporting ATPase family protein [Arabidopsis thaliana] gi|332641374|gb|AEE74895.1| anion-transporting ATPase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
TAIR|locus:2175816391 AT5G60730 [Arabidopsis thalian 0.435 0.434 0.602 4.7e-97
DICTYBASE|DDB_G0293528329 arsA "arsenite-translocating A 0.789 0.936 0.296 3.2e-33
FB|FBgn0033191336 CG1598 [Drosophila melanogaste 0.756 0.877 0.295 3e-30
POMBASE|SPAC1142.06329 get3 "GET complex ATPase subun 0.784 0.930 0.268 9.1e-29
UNIPROTKB|A5PJI5348 ASNA1 "ATPase ASNA1" [Bos taur 0.715 0.801 0.287 1.3e-27
UNIPROTKB|O43681348 ASNA1 "ATPase ASNA1" [Homo sap 0.715 0.801 0.287 1.3e-27
UNIPROTKB|F2Z5J4348 ASNA1 "Uncharacterized protein 0.715 0.801 0.287 1.3e-27
MGI|MGI:1928379348 Asna1 "arsA arsenite transport 0.715 0.801 0.287 1.3e-27
UNIPROTKB|G3V9T7348 Asna1 "ArsA arsenite transport 0.715 0.801 0.287 1.3e-27
ZFIN|ZDB-GENE-040625-120341 asna1 "arsA arsenite transport 0.715 0.818 0.290 1.7e-27
TAIR|locus:2175816 AT5G60730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 528 (190.9 bits), Expect = 4.7e-97, Sum P(2) = 4.7e-97
 Identities = 103/171 (60%), Positives = 134/171 (78%)

Query:   221 GHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGA-SDKLERLRERMV 279
             GHTLRLLSLPDF D+SI KI KL++KI +A SA K VFG+++ +Q    ++L++L+ERM 
Sbjct:   221 GHTLRLLSLPDFYDSSISKITKLKKKITAAASAFKLVFGKKEIQQKELPNELDQLKERME 280

Query:   280 KVRELFRDTDSTEFVIVTIPTVMAVXXXXXXXXXXXXXNVPVKRLIVNQIIPPSASDCKF 339
             KVR +FRD D+TEFVIVTIPTVMA+             NVPV RLIVNQ++P S SDCKF
Sbjct:   281 KVRNVFRDVDTTEFVIVTIPTVMAINESSRLHASLRKENVPVHRLIVNQLLPQSESDCKF 340

Query:   340 CAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK 390
             C+++RK+Q R L +I++D+ELS L LI++PL+D EIRGVPAL+FMGD+IWK
Sbjct:   341 CSIRRKEQTRVLGLIQNDTELSGLKLIQSPLLDAEIRGVPALKFMGDLIWK 391
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006820 "anion transport" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016020 "membrane" evidence=ISS
GO:0016887 "ATPase activity" evidence=IEA
GO:0071722 "detoxification of arsenic-containing substance" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
DICTYBASE|DDB_G0293528 arsA "arsenite-translocating ATPase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0033191 CG1598 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPAC1142.06 get3 "GET complex ATPase subunit Get3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJI5 ASNA1 "ATPase ASNA1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O43681 ASNA1 "ATPase ASNA1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5J4 ASNA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1928379 Asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9T7 Asna1 "ArsA arsenite transporter, ATP-binding, homolog 1 (Bacterial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-120 asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
pfam02374304 pfam02374, ArsA_ATPase, Anion-transporting ATPase 5e-65
COG0003322 COG0003, ArsA, Predicted ATPase involved in chromo 4e-58
cd02035217 cd02035, ArsA, ArsA ATPase functionas as an efflux 3e-53
TIGR00345284 TIGR00345, GET3_arsA_TRC40, transport-energizing A 3e-48
TIGR04291 566 TIGR04291, arsen_driv_ArsA, arsenical pump-driving 9e-23
TIGR04291566 TIGR04291, arsen_driv_ArsA, arsenical pump-driving 2e-12
cd02042104 cd02042, ParA, ParA and ParB of Caulobacter cresce 5e-08
cd02034116 cd02034, CooC, The accessory protein CooC, which c 1e-07
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily cont 5e-06
COG1192259 COG1192, Soj, ATPases involved in chromosome parti 6e-06
TIGR03371246 TIGR03371, cellulose_yhjQ, cellulose synthase oper 7e-06
PHA02518211 PHA02518, PHA02518, ParA-like protein; Provisional 8e-06
pfam01656217 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi 2e-05
cd02038139 cd02038, FleN-like, FleN is a member of the Fer4_N 5e-05
cd02036179 cd02036, MinD, Bacterial cell division requires th 2e-04
COG1149284 COG1149, COG1149, MinD superfamily P-loop ATPase c 3e-04
COG3640255 COG3640, CooC, CO dehydrogenase maturation factor 0.001
>gnl|CDD|217004 pfam02374, ArsA_ATPase, Anion-transporting ATPase Back     alignment and domain information 
 Score =  209 bits (533), Expect = 5e-65
 Identities = 104/321 (32%), Positives = 158/321 (49%), Gaps = 38/321 (11%)

Query: 90  KYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEG 149
           ++   GGKGGVGKT+ + + AV+ +  G   L+VSTDPAHSLSDSF Q   G +   ++G
Sbjct: 2   RWIFFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTDPAHSLSDSFNQKF-GHEPTKIKG 60

Query: 150 PDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPP 209
            +  L A+EI+P+   EE+R   Q             M  G+L E+L  L          
Sbjct: 61  VE-NLSAMEIDPQMELEEYRGEVQDPIN---AVLGLDMLEGILAEELSSL---------- 106

Query: 210 PGLDEAIA---ISK-----------------GHTLRLLSLPDFLDASIGKILKLREKIAS 249
           PG+DE  +     K                 GHTLRLLSLP  L   + KI+KL+ +I  
Sbjct: 107 PGIDEIASFDEFKKYMDEGEYDVVIFDTAPTGHTLRLLSLPTVLSWYLEKIVKLKNQIGP 166

Query: 250 ATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSR 309
                K +         A + LE  +E++ K RE+  D + T F +V IP  M++ E+ R
Sbjct: 167 LAKPFKGMGMGGSCLPEALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLYETER 226

Query: 310 LSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAP 369
             + L K  + V  +IVNQ++P +   C FC  +++ Q + L+ I+     S L + + P
Sbjct: 227 AIQELAKYGIDVDAVIVNQVLPET-EQCPFCEARKEIQQKYLKEIEEL--FSDLPVAKLP 283

Query: 370 LVDVEIRGVPALRFMGDIIWK 390
           L+  E+ G+ AL      ++ 
Sbjct: 284 LLPEEVVGLEALEKFSQTLYG 304

This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304
>gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>gnl|CDD|232932 TIGR00345, GET3_arsA_TRC40, transport-energizing ATPase, TRC40/GET3/ArsA family Back     alignment and domain information
>gnl|CDD|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase Back     alignment and domain information
>gnl|CDD|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase Back     alignment and domain information
>gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234188 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ Back     alignment and domain information
>gnl|CDD|222854 PHA02518, PHA02518, ParA-like protein; Provisional Back     alignment and domain information
>gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|226166 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
KOG2825323 consensus Putative arsenite-translocating ATPase [ 100.0
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 100.0
COG0003322 ArsA Predicted ATPase involved in chromosome parti 100.0
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 100.0
TIGR00345284 arsA arsenite-activated ATPase (arsA). The N-termi 100.0
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 99.9
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 99.88
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 99.79
PRK11670369 antiporter inner membrane protein; Provisional 99.77
COG0489265 Mrp ATPases involved in chromosome partitioning [C 99.77
COG2894272 MinD Septum formation inhibitor-activating ATPase 99.72
CHL00175281 minD septum-site determining protein; Validated 99.7
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 99.66
TIGR03029274 EpsG chain length determinant protein tyrosine kin 99.66
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 99.66
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 99.65
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 99.65
PHA02518211 ParA-like protein; Provisional 99.65
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 99.61
cd02117212 NifH_like This family contains the NifH (iron prot 99.61
TIGR01968261 minD_bact septum site-determining protein MinD. Th 99.61
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 99.61
PRK13232273 nifH nitrogenase reductase; Reviewed 99.6
PRK13236296 nitrogenase reductase; Reviewed 99.6
cd03110179 Fer4_NifH_child This protein family's function is 99.59
cd02036179 MinD Bacterial cell division requires the formatio 99.59
cd02040270 NifH NifH gene encodes component II (iron protein) 99.58
CHL00072290 chlL photochlorophyllide reductase subunit L 99.58
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 99.57
PRK13233275 nifH nitrogenase reductase; Reviewed 99.57
PRK13235274 nifH nitrogenase reductase; Reviewed 99.57
PRK10818270 cell division inhibitor MinD; Provisional 99.56
TIGR01287275 nifH nitrogenase iron protein. This model describe 99.55
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 99.55
cd02032267 Bchl_like This family of proteins contains bchL an 99.52
PRK10037250 cell division protein; Provisional 99.51
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 99.5
PRK13869405 plasmid-partitioning protein RepA; Provisional 99.49
PRK13230279 nitrogenase reductase-like protein; Reviewed 99.49
PRK13231264 nitrogenase reductase-like protein; Reviewed 99.47
PRK13849231 putative crown gall tumor protein VirC1; Provision 99.47
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 99.47
PRK13234295 nifH nitrogenase reductase; Reviewed 99.47
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 99.47
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 99.47
PRK11519719 tyrosine kinase; Provisional 99.46
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 99.46
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 99.45
cd03111106 CpaE_like This protein family consists of proteins 99.45
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 99.43
COG1192259 Soj ATPases involved in chromosome partitioning [C 99.42
COG1149284 MinD superfamily P-loop ATPase containing an inser 99.38
PHA02519387 plasmid partition protein SopA; Reviewed 99.37
PRK13705388 plasmid-partitioning protein SopA; Provisional 99.37
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 99.35
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 99.32
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 99.25
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 99.22
PRK13886241 conjugal transfer protein TraL; Provisional 99.14
PF00142273 Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot 99.12
PF09140261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 99.09
PF1060981 ParA: ParA/MinD ATPase like; InterPro: IPR019591 T 98.74
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic 98.72
TIGR00064272 ftsY signal recognition particle-docking protein F 98.69
cd02034116 CooC The accessory protein CooC, which contains a 98.65
cd03114148 ArgK-like The function of this protein family is u 98.62
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 98.6
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 98.58
cd03115173 SRP The signal recognition particle (SRP) mediates 98.57
PRK10867433 signal recognition particle protein; Provisional 98.49
TIGR00347166 bioD dethiobiotin synthase. Dethiobiotin synthase 98.47
PRK10416318 signal recognition particle-docking protein FtsY; 98.44
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 98.42
TIGR00959428 ffh signal recognition particle protein. This mode 98.4
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 98.33
PRK00771437 signal recognition particle protein Srp54; Provisi 98.29
PRK13768253 GTPase; Provisional 98.24
PRK06526254 transposase; Provisional 98.18
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penulti 98.17
PRK08181269 transposase; Validated 98.15
PRK09183259 transposase/IS protein; Provisional 98.06
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.87
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.87
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 97.86
PRK00090222 bioD dithiobiotin synthetase; Reviewed 97.79
cd01394218 radB RadB. The archaeal protein radB shares simila 97.76
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.76
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.71
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.68
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.67
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.66
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.64
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.59
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.53
PRK14974336 cell division protein FtsY; Provisional 97.45
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 97.45
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 97.44
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.39
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.37
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 97.35
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.34
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.28
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.26
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.26
PRK06067234 flagellar accessory protein FlaH; Validated 97.23
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.22
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.19
PRK07667193 uridine kinase; Provisional 97.19
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.14
PHA02542473 41 41 helicase; Provisional 97.13
PRK00889175 adenylylsulfate kinase; Provisional 97.13
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 97.11
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.09
PRK05973237 replicative DNA helicase; Provisional 97.08
PRK07952244 DNA replication protein DnaC; Validated 97.05
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.02
PRK06696223 uridine kinase; Validated 97.0
PRK05632 684 phosphate acetyltransferase; Reviewed 96.99
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.98
PRK03846198 adenylylsulfate kinase; Provisional 96.97
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.95
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.93
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 96.91
PRK04328249 hypothetical protein; Provisional 96.91
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.9
PF13500199 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R 96.89
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.83
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.82
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.79
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.78
PRK13505 557 formate--tetrahydrofolate ligase; Provisional 96.78
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 96.77
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.75
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.74
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.74
PRK11823446 DNA repair protein RadA; Provisional 96.74
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.67
PRK08939306 primosomal protein DnaI; Reviewed 96.67
PRK09435332 membrane ATPase/protein kinase; Provisional 96.67
PHA00729226 NTP-binding motif containing protein 96.66
cd00477 524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca 96.65
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.65
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 96.62
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.62
PF1324576 AAA_19: Part of AAA domain 96.6
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.56
TIGR00665434 DnaB replicative DNA helicase. This model describe 96.55
PRK08506472 replicative DNA helicase; Provisional 96.54
PRK09354349 recA recombinase A; Provisional 96.53
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.52
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.52
PRK06762166 hypothetical protein; Provisional 96.51
PRK05595444 replicative DNA helicase; Provisional 96.49
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 96.49
PRK12377248 putative replication protein; Provisional 96.47
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.46
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.44
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 96.44
PRK05541176 adenylylsulfate kinase; Provisional 96.43
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.43
PRK05748448 replicative DNA helicase; Provisional 96.42
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.42
PRK06749428 replicative DNA helicase; Provisional 96.4
PRK09302 509 circadian clock protein KaiC; Reviewed 96.4
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 96.39
PRK08006471 replicative DNA helicase; Provisional 96.39
PRK08760476 replicative DNA helicase; Provisional 96.38
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.36
smart00382148 AAA ATPases associated with a variety of cellular 96.35
COG4240300 Predicted kinase [General function prediction only 96.3
PRK06321472 replicative DNA helicase; Provisional 96.29
PRK08840464 replicative DNA helicase; Provisional 96.28
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 96.28
PRK06904472 replicative DNA helicase; Validated 96.27
PRK13506 578 formate--tetrahydrofolate ligase; Provisional 96.27
PRK05480209 uridine/cytidine kinase; Provisional 96.24
PRK08084235 DNA replication initiation factor; Provisional 96.24
PRK09165497 replicative DNA helicase; Provisional 96.24
PRK08727233 hypothetical protein; Validated 96.13
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.12
PRK05642234 DNA replication initiation factor; Validated 96.12
PRK06835329 DNA replication protein DnaC; Validated 96.11
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.1
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.1
COG1341398 Predicted GTPase or GTP-binding protein [General f 96.09
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.04
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.03
PRK09302509 circadian clock protein KaiC; Reviewed 96.02
PRK07004460 replicative DNA helicase; Provisional 96.02
PRK06893229 DNA replication initiation factor; Validated 96.01
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 96.0
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 95.94
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.94
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.94
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.91
PRK15453290 phosphoribulokinase; Provisional 95.9
PRK13896 433 cobyrinic acid a,c-diamide synthase; Provisional 95.89
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.86
PRK04296190 thymidine kinase; Provisional 95.85
PRK05439311 pantothenate kinase; Provisional 95.84
PRK05636505 replicative DNA helicase; Provisional 95.84
PRK08233182 hypothetical protein; Provisional 95.84
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 95.81
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 95.78
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.77
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 95.73
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.69
PRK08116268 hypothetical protein; Validated 95.69
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.68
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.68
cd03116159 MobB Molybdenum is an essential trace element in t 95.67
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.67
PRK06921266 hypothetical protein; Provisional 95.67
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.65
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.62
PRK00131175 aroK shikimate kinase; Reviewed 95.61
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 95.6
PF12846304 AAA_10: AAA-like domain 95.56
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.54
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.52
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.52
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.46
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 95.4
PF05729166 NACHT: NACHT domain 95.38
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.33
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.3
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.29
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.25
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.17
PTZ00035337 Rad51 protein; Provisional 95.14
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.13
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.07
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.07
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.06
PRK10536262 hypothetical protein; Provisional 95.01
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.97
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 94.94
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.91
PRK07773 886 replicative DNA helicase; Validated 94.88
PRK12339197 2-phosphoglycerate kinase; Provisional 94.86
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.8
PRK06547172 hypothetical protein; Provisional 94.78
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.74
KOG1533290 consensus Predicted GTPase [General function predi 94.73
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 94.7
PLN03186342 DNA repair protein RAD51 homolog; Provisional 94.68
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 94.66
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.64
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 94.56
PF00004132 AAA: ATPase family associated with various cellula 94.55
KOG0780483 consensus Signal recognition particle, subunit Srp 94.52
PLN02796347 D-glycerate 3-kinase 94.48
PTZ00301210 uridine kinase; Provisional 94.44
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.42
PLN03046460 D-glycerate 3-kinase; Provisional 94.41
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 94.4
PF13173128 AAA_14: AAA domain 94.39
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 94.38
PRK06217183 hypothetical protein; Validated 94.35
PHA02530300 pseT polynucleotide kinase; Provisional 94.31
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.29
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 94.23
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.23
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 94.19
PRK00698205 tmk thymidylate kinase; Validated 93.99
PRK06851367 hypothetical protein; Provisional 93.96
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 93.89
PRK14495 452 putative molybdopterin-guanine dinucleotide biosyn 93.88
PRK13946184 shikimate kinase; Provisional 93.8
PF13479213 AAA_24: AAA domain 93.78
TIGR00379 449 cobB cobyrinic acid a,c-diamide synthase. This mod 93.67
PRK06761282 hypothetical protein; Provisional 93.6
PRK03839180 putative kinase; Provisional 93.6
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.59
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.57
PRK04220301 2-phosphoglycerate kinase; Provisional 93.56
PRK12422445 chromosomal replication initiation protein; Provis 93.53
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 93.49
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.45
TIGR00376 637 DNA helicase, putative. The gene product may repre 93.45
PRK07933213 thymidylate kinase; Validated 93.44
PRK12338319 hypothetical protein; Provisional 93.33
PRK00784 488 cobyric acid synthase; Provisional 93.31
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.26
PRK08118167 topology modulation protein; Reviewed 93.25
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.18
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 93.17
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.17
PRK07261171 topology modulation protein; Provisional 93.11
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 93.09
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.07
PRK13973213 thymidylate kinase; Provisional 93.05
PLN02924220 thymidylate kinase 92.98
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 92.98
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 92.98
KOG0781587 consensus Signal recognition particle receptor, al 92.83
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.82
PLN02165334 adenylate isopentenyltransferase 92.75
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 92.72
PLN02348395 phosphoribulokinase 92.65
KOG1534273 consensus Putative transcription factor FET5 [Tran 92.62
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 92.61
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 92.53
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 92.52
PRK00149450 dnaA chromosomal replication initiation protein; R 92.48
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 92.47
PRK13947171 shikimate kinase; Provisional 92.42
CHL00181287 cbbX CbbX; Provisional 92.42
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.42
PRK00652325 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 92.41
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 92.4
PRK12374231 putative dithiobiotin synthetase; Provisional 92.36
COG1855604 ATPase (PilT family) [General function prediction 92.27
PRK14088440 dnaA chromosomal replication initiation protein; P 92.2
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 92.18
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 92.15
PLN02200234 adenylate kinase family protein 92.15
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 92.14
PRK14532188 adenylate kinase; Provisional 92.09
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 92.08
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.02
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 92.01
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 92.0
PRK06851367 hypothetical protein; Provisional 91.98
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 91.97
COG2256436 MGS1 ATPase related to the helicase subunit of the 91.87
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 91.82
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 91.75
PRK14527191 adenylate kinase; Provisional 91.72
PLN03025319 replication factor C subunit; Provisional 91.71
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 91.66
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 91.65
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 91.59
PRK04040188 adenylate kinase; Provisional 91.49
PRK13948182 shikimate kinase; Provisional 91.44
PRK08356195 hypothetical protein; Provisional 91.4
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 91.4
PRK00411394 cdc6 cell division control protein 6; Reviewed 91.27
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.25
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 91.25
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 91.21
PRK01184184 hypothetical protein; Provisional 91.19
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 91.15
KOG2749415 consensus mRNA cleavage and polyadenylation factor 91.15
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 91.14
PRK13764602 ATPase; Provisional 91.05
PRK05057172 aroK shikimate kinase I; Reviewed 91.03
PRK12402337 replication factor C small subunit 2; Reviewed 90.95
COG1936180 Predicted nucleotide kinase (related to CMP and AM 90.84
PRK01906338 tetraacyldisaccharide 4'-kinase; Provisional 90.84
PRK03731171 aroL shikimate kinase II; Reviewed 90.8
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 90.79
COG2403449 Predicted GTPase [General function prediction only 90.69
PRK14491 597 putative bifunctional molybdopterin-guanine dinucl 90.69
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 90.67
TIGR00682311 lpxK tetraacyldisaccharide 4'-kinase. Also called 90.66
PRK14531183 adenylate kinase; Provisional 90.56
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 90.47
PRK14528186 adenylate kinase; Provisional 90.45
PRK14086617 dnaA chromosomal replication initiation protein; P 90.45
PRK13695174 putative NTPase; Provisional 90.44
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 90.39
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 90.31
PF1355562 AAA_29: P-loop containing region of AAA domain 90.29
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 90.29
PRK00625173 shikimate kinase; Provisional 90.25
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 90.22
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 90.2
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 90.18
PRK12337475 2-phosphoglycerate kinase; Provisional 90.18
PRK00440319 rfc replication factor C small subunit; Reviewed 90.13
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 90.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 89.93
PRK14730195 coaE dephospho-CoA kinase; Provisional 89.9
PRK02496184 adk adenylate kinase; Provisional 89.88
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 89.87
PRK14530215 adenylate kinase; Provisional 89.82
PRK13975196 thymidylate kinase; Provisional 89.81
PRK04195 482 replication factor C large subunit; Provisional 89.78
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 89.73
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 89.69
KOG2878282 consensus Predicted kinase [General function predi 89.68
PRK04182180 cytidylate kinase; Provisional 89.62
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 89.57
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 89.54
PF02606326 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr 89.53
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 89.51
COG0703172 AroK Shikimate kinase [Amino acid transport and me 89.4
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 89.4
TIGR03783829 Bac_Flav_CT_G Bacteroides conjugation system ATPas 89.4
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 89.37
PRK00279215 adk adenylate kinase; Reviewed 89.33
PF00154322 RecA: recA bacterial DNA recombination protein; In 89.14
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 89.11
PRK14731208 coaE dephospho-CoA kinase; Provisional 89.07
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 88.86
PRK14087450 dnaA chromosomal replication initiation protein; P 88.84
PRK00081194 coaE dephospho-CoA kinase; Reviewed 88.79
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 88.74
TIGR00152188 dephospho-CoA kinase. This model produces scores i 88.63
PRK10865 857 protein disaggregation chaperone; Provisional 88.58
PLN02748 468 tRNA dimethylallyltransferase 88.44
PLN02840 421 tRNA dimethylallyltransferase 88.42
cd03113255 CTGs CTP synthetase (CTPs) is a two-domain protein 88.35
PRK13342413 recombination factor protein RarA; Reviewed 88.31
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 88.27
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 88.23
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 88.23
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 88.21
PTZ00088229 adenylate kinase 1; Provisional 88.19
PF10443 431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 88.16
TIGR02928365 orc1/cdc6 family replication initiation protein. M 88.11
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 88.08
PRK13949169 shikimate kinase; Provisional 88.07
PLN02318 656 phosphoribulokinase/uridine kinase 88.05
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 88.04
TIGR00313 475 cobQ cobyric acid synthase CobQ. 87.99
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 87.97
PRK11545163 gntK gluconate kinase 1; Provisional 87.93
PRK14738206 gmk guanylate kinase; Provisional 87.75
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 87.74
PRK00300205 gmk guanylate kinase; Provisional 87.59
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 87.55
PRK14733204 coaE dephospho-CoA kinase; Provisional 87.53
PRK08154309 anaerobic benzoate catabolism transcriptional regu 87.46
PRK07429327 phosphoribulokinase; Provisional 87.44
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 87.32
COG3973 747 Superfamily I DNA and RNA helicases [General funct 87.16
KOG1969 877 consensus DNA replication checkpoint protein CHL12 87.15
PLN02459261 probable adenylate kinase 87.13
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 87.1
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 87.08
PLN03210 1153 Resistant to P. syringae 6; Provisional 87.07
PRK14737186 gmk guanylate kinase; Provisional 86.92
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 86.77
PRK13873811 conjugal transfer ATPase TrbE; Provisional 86.65
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 86.65
PRK13976209 thymidylate kinase; Provisional 86.65
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 86.64
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 86.57
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 86.5
PRK13833323 conjugal transfer protein TrbB; Provisional 86.46
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 86.46
PLN02422232 dephospho-CoA kinase 86.44
TIGR00101199 ureG urease accessory protein UreG. This model rep 86.42
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 86.37
smart00487201 DEXDc DEAD-like helicases superfamily. 86.34
TIGR02746797 TraC-F-type type-IV secretion system protein TraC. 86.28
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 86.24
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 86.23
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 86.22
PRK10490 895 sensor protein KdpD; Provisional 86.16
TIGR00929785 VirB4_CagE type IV secretion/conjugal transfer ATP 86.14
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 86.08
PRK14734200 coaE dephospho-CoA kinase; Provisional 85.95
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 85.91
PF01268 557 FTHFS: Formate--tetrahydrofolate ligase; InterPro: 85.89
PF07726131 AAA_3: ATPase family associated with various cellu 85.86
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 85.83
PRK14732196 coaE dephospho-CoA kinase; Provisional 85.8
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 85.67
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 85.65
PHA02544316 44 clamp loader, small subunit; Provisional 85.61
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 85.51
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 85.5
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 85.36
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 85.31
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 85.24
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 85.2
KOG3062281 consensus RNA polymerase II elongator associated p 85.13
PRK13894319 conjugal transfer ATPase TrbB; Provisional 85.0
PRK13721844 conjugal transfer ATP-binding protein TraC; Provis 84.93
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 84.92
COG3911183 Predicted ATPase [General function prediction only 84.87
PRK10865857 protein disaggregation chaperone; Provisional 84.63
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 84.57
PRK09825176 idnK D-gluconate kinase; Provisional 84.56
COG4185187 Uncharacterized protein conserved in bacteria [Fun 84.5
PRK13891852 conjugal transfer protein TrbE; Provisional 84.5
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 84.36
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 84.2
PRK00049 396 elongation factor Tu; Reviewed 84.02
PLN03209 576 translocon at the inner envelope of chloroplast su 84.01
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 83.98
PRK00023225 cmk cytidylate kinase; Provisional 83.95
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 83.88
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 83.79
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 83.76
PRK12740 668 elongation factor G; Reviewed 83.73
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 83.62
PRK14526211 adenylate kinase; Provisional 83.55
CHL00095 821 clpC Clp protease ATP binding subunit 83.4
PRK00741 526 prfC peptide chain release factor 3; Provisional 83.35
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 83.27
COG0645170 Predicted kinase [General function prediction only 83.23
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env 83.1
TIGR00503 527 prfC peptide chain release factor 3. This translat 83.08
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 83.05
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 83.04
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 83.04
>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-53  Score=390.67  Aligned_cols=293  Identities=40%  Similarity=0.660  Sum_probs=259.8

Q ss_pred             chhhhhhcCCcEEEEEcCCCCCcHHHHHHHHHHHHHHCCCCeEEEecCCCCCCchHhhcccCCCccccccCCCCCeeEEe
Q 016417           79 GFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALE  158 (390)
Q Consensus        79 ~~~~~~~~~~~~~~~~~gkgGvGKtt~a~~la~~~a~~g~~vll~d~D~~~~l~~~~g~~~~~~~~~~v~~~~~~L~a~e  158 (390)
                      .+++++.+...++++++|||||||||+++.||..++.-+.+||+|++||+|+++|.|+++.+ ..|+.|+|.++ |+++|
T Consensus         9 ~l~nil~q~slKwifVGGKGGVGKTTcs~sLAvqla~~r~~vLiISTDPAHNlSDAF~qkft-k~pt~V~Gf~n-LfAME   86 (323)
T KOG2825|consen    9 TLQNILEQTSLKWIFVGGKGGVGKTTCSCSLAVQLAKVRESVLIISTDPAHNLSDAFSQKFT-KTPTKVEGFEN-LFAME   86 (323)
T ss_pred             hHHHHhhcceeeEEEEcCcCCcCccchhhHHHHHHhccCCceEEeecCcccchHHHHHHHhc-CCCccccChhh-heeee
Confidence            67888999999999999999999999999999999999999999999999999999999987 57899999988 99999


Q ss_pred             cChHHHHHHHHhhhhhcCCCcchhhhcccchhhHHHHhhhhhcccccCCCCCChhHHHHhhc------------------
Q 016417          159 INPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISK------------------  220 (390)
Q Consensus       159 id~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~e~L~~~~~~~lid~~pPG~de~~~l~~------------------  220 (390)
                      |||.....+..+....   ....+...  |.+++.+...          ..||+||++++.+                  
T Consensus        87 IDp~~e~~~~~~m~~~---~~~n~~~~--g~g~l~e~~~----------~~Pgideamsfae~~klvk~~~F~~vVFDTA  151 (323)
T KOG2825|consen   87 IDPNVEMGDMPEMFGN---AANNEGSD--GKGMLQELAN----------AFPGIDEAMSFAEVMKLVKGMNFDVVVFDTA  151 (323)
T ss_pred             cCCchhhhhhHHHhhc---cccccccc--chhHHHHHHh----------cCCChhHHHhHHHHHHHhhccccceEEeccC
Confidence            9999766555443221   11222221  2222333222          3699999998754                  


Q ss_pred             --cceeccccCchHHHHHHHHHHHHHHHHHHHHHHHHHhhcccc-chhhHHHHHHHHHHHHHHHHHHhcCCCCceEEEEe
Q 016417          221 --GHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQ-NRQGASDKLERLRERMVKVRELFRDTDSTEFVIVT  297 (390)
Q Consensus       221 --g~tLrlL~lp~~l~~~l~~ll~l~~~~~~~~~~~~~~~g~~~-~~~~~~~~l~~~~~~~~~~~~~L~d~~~t~~~lVt  297 (390)
                        |||||+|.+|..+...++++++++.++....+.+.++||.+. ..+++..+++.+++.++++++.++||+.|.|++|+
T Consensus       152 PTGHTLRlL~fP~~lek~lgKl~~l~~k~~pm~sq~~sm~g~~~~~~~~l~~kle~~~~~i~~vn~qFkdpd~TtFVcVc  231 (323)
T KOG2825|consen  152 PTGHTLRLLQFPTTLEKGLGKLLSLKNKIGPMLSQMGSMFGMEDAGADDLAGKLEELLEVIEKVNEQFKDPDCTTFVCVC  231 (323)
T ss_pred             CCcceehhhccchHHHHHHHHHHHHHHHHHHHHHHHhhhhccccCCHHHHHHHHHHHHHHHHHHHHHcCCCCCceEEEEE
Confidence              999999999999999999999999999999999999999864 67799999999999999999999999999999999


Q ss_pred             CCCcchHHHHHHHHHHHHhCCCCcceEEEcCccCCCC-CchHHHHHHHHHHHHHHHhhhhcCccCCCceEEecCCCCCCC
Q 016417          298 IPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSA-SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIR  376 (390)
Q Consensus       298 ~Pe~~s~~ea~r~~~~L~~~gi~v~gvVvN~v~p~~~-~~~~~~~~~~~~q~~~l~~i~~d~~~~~l~i~~vP~~~~ev~  376 (390)
                      .||.+|+.|++|+++.|.++++++..+|||+++++.. .+|+.|+.|++.|+|||++|.++  +.+.+++++|+++.||+
T Consensus       232 I~eflslyEteRliqeL~k~~idthnIIVNQLL~~~~~~~ck~C~ar~k~Q~kyLdqi~el--yedfhv~klPl~~~Evr  309 (323)
T KOG2825|consen  232 IAEFLSLYETERLIQELAKQGIDTHNIIVNQLLFPDNEVSCKKCAARRKMQSKYLDQIEEL--YEDFHVVKLPLLPMEVR  309 (323)
T ss_pred             HHHHHhHHHHHHHHHHHHhcCCcccceeeeeccCCCCccchHHHHHHHHHHHHHhhhHHHH--Hhhcceeecccchhhhc
Confidence            9999999999999999999999999999999998776 78999999999999999999884  46799999999999999


Q ss_pred             CHHHHHHHHHHhhC
Q 016417          377 GVPALRFMGDIIWK  390 (390)
Q Consensus       377 G~~~L~~l~~~~~~  390 (390)
                      |+++|+.+++.+|+
T Consensus       310 G~~al~~fse~l~k  323 (323)
T KOG2825|consen  310 GVEALNFFSEILLK  323 (323)
T ss_pred             CHHHHHHHHHHhcC
Confidence            99999999999996

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA) Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK13506 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
3zq6_A324 Adp-Alf4 Complex Of M. Therm. Trc40 Length = 324 2e-33
3ug6_A349 Crystal Structure Of Get3 From Methanocaldococcus J 6e-30
3iqw_A334 Amppnp Complex Of C. Therm. Get3 Length = 334 7e-24
2woo_A329 Nucleotide-Free Form Of S. Pombe Get3 Length = 329 3e-22
3ibg_A348 Crystal Structure Of Aspergillus Fumigatus Get3 Wit 4e-20
3io3_A348 Get3 With Adp From D. Hansenii In Closed Form Lengt 3e-16
3idq_A369 Crystal Structure Of S. Cerevisiae Get3 At 3.7 Angs 1e-14
3sja_A362 Crystal Structure Of S. Cerevisiae Get3 In The Open 1e-14
2woj_A354 Adp-Alf4 Complex Of S. Cerevisiae Get3 Length = 354 1e-14
3a36_A362 Structural Insight Into The Membrane Insertion Of T 1e-14
3vlc_A354 Crystal Structure Of S. Cerevisiae Get3 In The Semi 1e-14
1f48_A 589 Crystal Structure Of The Escherichia Coli Arsenite- 2e-09
>pdb|3ZQ6|A Chain A, Adp-Alf4 Complex Of M. Therm. Trc40 Length = 324 Back     alignment and structure 
Iteration: 1

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 149/307 (48%), Gaps = 42/307 (13%)
Query: 106 AASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAR 165
           +A+ A+  A +G  TLV+STDPAHSLSDS  +++        E     L+A+EI+PE A 
Sbjct: 31  SAATALWMARSGKKTLVISTDPAHSLSDSLEREIGHTPTKITEN----LYAVEIDPEVAM 86
Query: 166 EEFRNVTQKDGGTGVKDFMDGMGLGMXXXXXXXXXXXXXXDTPPPGLDEAIAISK----- 220
           EE++   Q+           GMGL M                  PG+DEA A  +     
Sbjct: 87  EEYQAKLQEQAAMN-----PGMGLDMLQDQMDMASMS-------PGIDEAAAFDQFLRYM 134
Query: 221 ---------------GHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVF---GQEQ 262
                          GHTLRLLS P+ +D+ +GK++K+R +I S   A K++    G E+
Sbjct: 135 TTDEYDIVIFDTAPTGHTLRLLSFPEIMDSWVGKMIKIRRQIGSMAKAFKNILPFMGDEE 194
Query: 263 NRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVXXXXXXXXXXXXXNVPVK 322
               A   +E  ++++   RE+  D + T F +V IP  M++             ++   
Sbjct: 195 EEDRALQDMEATKKQINAAREVMSDPERTSFKMVVIPEEMSIYESERAMKALEKYSIHAD 254
Query: 323 RLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALR 382
            +IVNQ++ P  SDC+FC  +RK Q   L+ I+   + S  ++ E PL+  E +G+  L 
Sbjct: 255 GVIVNQVL-PEESDCEFCNARRKLQQERLKQIR--EKFSDKVVAEVPLLKKEAKGIETLE 311
Query: 383 FMGDIIW 389
            + + ++
Sbjct: 312 KIAEQLY 318
>pdb|3UG6|A Chain A, Crystal Structure Of Get3 From Methanocaldococcus Jannaschii Length = 349 Back     alignment and structure
>pdb|3IQW|A Chain A, Amppnp Complex Of C. Therm. Get3 Length = 334 Back     alignment and structure
>pdb|2WOO|A Chain A, Nucleotide-Free Form Of S. Pombe Get3 Length = 329 Back     alignment and structure
>pdb|3IBG|A Chain A, Crystal Structure Of Aspergillus Fumigatus Get3 With Bound Adp Length = 348 Back     alignment and structure
>pdb|3IO3|A Chain A, Get3 With Adp From D. Hansenii In Closed Form Length = 348 Back     alignment and structure
>pdb|3IDQ|A Chain A, Crystal Structure Of S. Cerevisiae Get3 At 3.7 Angstrom Resolution Length = 369 Back     alignment and structure
>pdb|3SJA|A Chain A, Crystal Structure Of S. Cerevisiae Get3 In The Open State In Complex With Get1 Cytosolic Domain Length = 362 Back     alignment and structure
>pdb|2WOJ|A Chain A, Adp-Alf4 Complex Of S. Cerevisiae Get3 Length = 354 Back     alignment and structure
>pdb|3A36|A Chain A, Structural Insight Into The Membrane Insertion Of Tail- Anchored Proteins By Get3 Length = 362 Back     alignment and structure
>pdb|3VLC|A Chain A, Crystal Structure Of S. Cerevisiae Get3 In The Semi Open Conformation In Complex With Get1 Cytosolic Domain At 4.5 Angstrom Resolution Length = 354 Back     alignment and structure
>pdb|1F48|A Chain A, Crystal Structure Of The Escherichia Coli Arsenite-Translocating Atpase Length = 589 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 5e-91
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 8e-85
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 5e-84
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 8e-84
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 1e-82
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 1e-81
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 3e-73
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 1e-61
3igf_A374 ALL4481 protein; two-domained protein consisting o 9e-52
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-15
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 7e-08
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 3e-07
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 6e-06
3cwq_A209 Para family chromosome partitioning protein; alpha 6e-05
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 9e-05
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 9e-05
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 1e-04
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 9e-04
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 Back     alignment and structure
 Score =  276 bits (707), Expect = 5e-91
 Identities = 89/332 (26%), Positives = 157/332 (47%), Gaps = 27/332 (8%)

Query: 72  APSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSL 131
           +        + ++  T  K+  +GGKGGVGKT+ + SLA++ +      L++STDPAH+L
Sbjct: 2   SFDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNL 61

Query: 132 SDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFR-NVTQKDGGTGVKDFMDGMGLG 190
           SD+F     G     V G D  L A+EI+P  + +E      Q++    +   M  +   
Sbjct: 62  SDAFGTKF-GKDARKVPGFD-NLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFT 119

Query: 191 M--LVEQLGELKLGELL----------DTPPPGLDEAIAISKGHTLRLLSLPDFLDASIG 238
           +  + E L   ++ + +          DT P           GHTLR L+ P  L+ ++G
Sbjct: 120 IPGIDEALAFAEILKQIKSMEFDCVIFDTAP----------TGHTLRFLNFPTVLEKALG 169

Query: 239 KILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTI 298
           K+  L  +     + + S+ G   N Q    K+E +R  + +V + F++ D T FV V I
Sbjct: 170 KLGGLSSRFGPMINQMGSIMGVNANEQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCI 229

Query: 299 PTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDS 358
              +++ E+ R+ + L    +    ++VNQ++    + C  C  +RK Q + L  I  + 
Sbjct: 230 SEFLSLYETERMIQELTSYEIDTHNIVVNQLLLDPNTTCPQCMARRKMQQKYLAQI--EE 287

Query: 359 ELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK 390
                 +++ P V  E+RG  AL+   +++ K
Sbjct: 288 LYEDFHVVKVPQVPAEVRGTEALKSFSEMLVK 319
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Length = 354 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Length = 348 Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 100.0
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 100.0
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 100.0
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 100.0
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 100.0
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 100.0
3igf_A374 ALL4481 protein; two-domained protein consisting o 100.0
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 99.97
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 99.96
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 99.72
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 99.7
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 99.68
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 99.68
3fwy_A314 Light-independent protochlorophyllide reductase I 99.67
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 99.67
3end_A307 Light-independent protochlorophyllide reductase ir 99.66
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 99.65
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 99.64
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 99.64
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 99.62
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 99.62
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 99.59
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 99.58
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 99.57
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 99.57
3cwq_A209 Para family chromosome partitioning protein; alpha 99.56
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 99.51
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 99.49
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 99.48
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 99.47
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 99.47
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 99.41
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 99.27
2xxa_A433 Signal recognition particle protein; protein trans 98.8
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 98.71
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.59
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.54
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.48
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 98.39
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 98.34
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 98.24
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.94
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.94
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.87
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.85
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.78
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.75
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.73
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.73
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.59
3pzx_A 557 Formate--tetrahydrofolate ligase; HET: TOE; 2.20A 97.42
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.36
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.29
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.25
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.12
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.04
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.02
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.01
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.97
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.91
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.89
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.87
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.85
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.78
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.73
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.69
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.61
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.53
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.52
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.46
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.42
2qgz_A308 Helicase loader, putative primosome component; str 96.36
3bos_A242 Putative DNA replication factor; P-loop containing 96.36
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.35
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.33
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.29
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.25
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.25
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.17
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.17
2z43_A324 DNA repair and recombination protein RADA; archaea 96.17
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.1
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.08
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.04
3io5_A333 Recombination and repair protein; storage dimer, i 96.02
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.92
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.91
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.85
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.8
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.7
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.68
2og2_A359 Putative signal recognition particle receptor; nuc 95.66
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.65
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.64
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.63
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.63
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.54
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.52
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.47
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.43
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.38
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.36
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.34
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.24
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 95.18
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.18
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.14
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.13
3bs4_A260 Uncharacterized protein PH0321; structural genomic 95.04
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.91
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.9
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.88
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.84
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.79
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.73
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.72
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.69
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.68
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.68
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.66
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.63
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.63
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.6
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.58
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.57
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.53
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.52
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.49
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.42
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.41
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 94.4
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.34
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.33
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.31
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.19
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.19
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.18
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.17
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.13
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.07
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.07
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.03
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.02
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.01
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 93.96
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.95
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.92
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.91
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.91
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.9
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.87
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.86
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.85
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.84
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.76
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.76
1via_A175 Shikimate kinase; structural genomics, transferase 93.75
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 93.61
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.61
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.59
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.55
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.55
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.53
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 93.51
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.51
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.51
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.51
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.46
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.42
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.4
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.39
2obn_A349 Hypothetical protein; structural genomics, joint c 93.35
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.33
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 93.32
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.31
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.31
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.28
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.24
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.21
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.13
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.12
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 93.06
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.04
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.01
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.0
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.99
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.99
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 92.96
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.9
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 92.87
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 92.8
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.71
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 92.68
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 92.67
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.59
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 92.51
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 92.49
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.47
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 92.46
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.45
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.32
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 92.12
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.09
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.06
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 92.02
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.92
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 91.85
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 91.83
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 91.72
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.6
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.54
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.52
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.48
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 91.42
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.35
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 91.25
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.25
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.22
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 91.17
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 91.11
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.07
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.05
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 90.99
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 90.95
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 90.86
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 90.78
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 90.66
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 90.53
1tue_A212 Replication protein E1; helicase, replication, E1E 90.5
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.45
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 90.39
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 90.24
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.22
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 90.2
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 90.2
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 90.15
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 90.05
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 90.02
2r44_A331 Uncharacterized protein; putative ATPase, structur 89.94
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 89.83
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 89.73
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 89.71
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 89.68
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 89.66
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 89.62
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 89.34
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.25
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.08
3r20_A233 Cytidylate kinase; structural genomics, seattle st 88.93
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.87
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 88.81
2eyu_A261 Twitching motility protein PILT; pilus retraction 88.79
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 88.7
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.67
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 88.67
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 88.65
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 88.54
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 88.49
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 88.42
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 88.28
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.11
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 87.89
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 87.72
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 87.71
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 87.7
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 87.63
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 87.43
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 87.39
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 87.3
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 87.28
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 87.13
2ewv_A372 Twitching motility protein PILT; pilus retraction 87.09
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 87.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 86.98
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 86.89
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 86.74
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 86.73
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 86.7
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 86.7
2chq_A319 Replication factor C small subunit; DNA-binding pr 86.56
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 86.52
2fna_A357 Conserved hypothetical protein; structural genomic 86.35
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 86.18
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 86.05
1p9r_A418 General secretion pathway protein E; bacterial typ 85.99
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 85.93
1s1m_A 545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 85.6
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 85.51
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 85.43
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 85.41
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 85.36
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 85.31
2r62_A268 Cell division protease FTSH homolog; ATPase domain 85.23
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 85.21
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 85.2
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 85.18
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 84.98
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 84.9
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 84.81
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 84.77
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 84.73
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 84.71
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 84.71
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 84.69
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 84.39
1vco_A 550 CTP synthetase; tetramer, riken structural genomic 84.39
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 84.37
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 84.34
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 84.32
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 84.26
3pvs_A447 Replication-associated recombination protein A; ma 84.24
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 83.68
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.68
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 83.1
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 83.02
3co5_A143 Putative two-component system transcriptional RES 82.96
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 82.9
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 82.67
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 82.62
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 82.51
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 82.5
3kta_A182 Chromosome segregation protein SMC; structural mai 82.36
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 82.22
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 82.13
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 81.9
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 81.8
3ice_A422 Transcription termination factor RHO; transcriptio 81.79
2vo1_A295 CTP synthase 1; pyrimidine biosynthesis, glutamine 81.64
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 81.44
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 81.4
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 81.25
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 81.22
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 80.98
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 80.98
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 80.98
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 80.85
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 80.7
3do6_A 543 Formate--tetrahydrofolate ligase; TM1766, putative 80.59
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 80.58
2c5m_A294 CTP synthase; cytidine 5-prime triphosphate synthe 80.22
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 80.18
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 80.03
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-46  Score=369.07  Aligned_cols=297  Identities=32%  Similarity=0.556  Sum_probs=205.6

Q ss_pred             chhhhhhcCCcEEEEEcCCCCCcHHHHHHHHHHHHHHCCCCeEEEecCCCCCCchHhhcccCCCccccccCCCCCeeEEe
Q 016417           79 GFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALE  158 (390)
Q Consensus        79 ~~~~~~~~~~~~~~~~~gkgGvGKtt~a~~la~~~a~~g~~vll~d~D~~~~l~~~~g~~~~~~~~~~v~~~~~~L~a~e  158 (390)
                      .++.++.+..+++++++|||||||||+|+|+|..+|+.|+||++||+||+++++++||.+.. ..+..+.+.++ |++++
T Consensus         6 ~l~~~l~~~~~~i~~~sgkGGvGKTt~a~~lA~~la~~g~~vllid~D~~~~l~~~l~~~~~-~~~~~v~~~~~-L~~~~   83 (334)
T 3iqw_A            6 TLQSILDQRSLRWIFVGGKGGVGKTTTSCSLAIQLAKVRRSVLLLSTDPAHNLSDAFSQKFG-KEARLVEGFDN-LYAME   83 (334)
T ss_dssp             SSHHHHHCTTCCEEEEECSTTSSHHHHHHHHHHHHTTSSSCEEEEECCSSCHHHHHHTSCCC-SSCEECTTCSS-EEEEE
T ss_pred             cHHHHhcCCCeEEEEEeCCCCccHHHHHHHHHHHHHhCCCcEEEEECCCCCChhHHhccccC-CCceeecCCCC-ceeee
Confidence            45567777778999999999999999999999999999999999999999999999998764 34566665555 99999


Q ss_pred             cChHHHHHHHHhhhhhcCC---Ccchhhhcc-----cc------hhhHHHHhhhhhccc-ccCCCCCChhHHHHhhccce
Q 016417          159 INPEKAREEFRNVTQKDGG---TGVKDFMDG-----MG------LGMLVEQLGELKLGE-LLDTPPPGLDEAIAISKGHT  223 (390)
Q Consensus       159 id~~~~~~~~~~~~~~~~~---~~~~~~l~~-----~~------~~~~~e~L~~~~~~~-lid~~pPG~de~~~l~~g~t  223 (390)
                      +|++...++|.........   ..+ .++..     .+      +..+.+.+....++. ++|+ ||.         |||
T Consensus        84 id~~~~~~~~~~~~~~~~~~~~~~l-~~~~~~~~~~Pg~~e~~~~~~~~~~~~~~~yD~VIiDt-pPt---------g~t  152 (334)
T 3iqw_A           84 IDPNGSMQDLLAGQTGDGDAGMGGV-GVMQDLAYAIPGIDEAMSFAEVLKQVNSLSYETIVFDT-APT---------GHT  152 (334)
T ss_dssp             CCC---------------------------------CCHHHHHHHHHHHHHHHTSSCSEEEEEC-CCH---------HHH
T ss_pred             cCHHHHHHHHHHHhhcccccccccc-hhhHHhhcCCCCHHHHHHHHHHHHHHHhCCCCEEEEeC-CCC---------HHH
Confidence            9999888777653221100   000 00000     00      011111111112222 2333 222         899


Q ss_pred             eccccCchHHHHHHHHHHHHHHHHHHHHHHHHHhhcc---ccchhhHHHHHHHHHHHHHHHHHHhcCCCCceEEEEeCCC
Q 016417          224 LRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQ---EQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPT  300 (390)
Q Consensus       224 LrlL~lp~~l~~~l~~ll~l~~~~~~~~~~~~~~~g~---~~~~~~~~~~l~~~~~~~~~~~~~L~d~~~t~~~lVt~Pe  300 (390)
                      ||+|++|+.+.+|+++++++++++..+.+.+...+|.   ....+++.+.++.+++++++++++|+||+.|++++|++|+
T Consensus       153 LrlL~lp~~l~~~l~~~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~~l~~~~~~~~~~~~~L~dp~~t~~vlVt~pe  232 (334)
T 3iqw_A          153 LRFLQFPTVLEKALAKVSQLSGQYGSLLNGILGGSGTLPNGQTLSDVMEKLDSLRVTISEVNAQFKDERLTTFVCVCIPE  232 (334)
T ss_dssp             HHHHTHHHHC-----------------------------------CCHHHHHHHHHHHHHHHHHHTCTTTEEEEEEECSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcccccHHHHHHHHHHHHHHHHHHHHHhhCCCCeeEEEEECCC
Confidence            9999999999999999999999888877777776664   2456778899999999999999999999999999999999


Q ss_pred             cchHHHHHHHHHHHHhCCCCcceEEEcCcc-CCCCCchHHHHHHHHHHHHHHHhhhhcCccCC-CceEEecCCCCCCCCH
Q 016417          301 VMAVSESSRLSESLKKENVPVKRLIVNQII-PPSASDCKFCAMKRKDQMRALEMIKSDSELSS-LMLIEAPLVDVEIRGV  378 (390)
Q Consensus       301 ~~s~~ea~r~~~~L~~~gi~v~gvVvN~v~-p~~~~~~~~~~~~~~~q~~~l~~i~~d~~~~~-l~i~~vP~~~~ev~G~  378 (390)
                      .+++.|++|+++.|+++|+++.|+|+||++ |+....|++|+.|.+.|+++|++|++  .|.+ ++++.+|+++.||+|+
T Consensus       233 ~~~~~ea~r~~~~L~~~gi~v~gvVvN~~~~p~~~~~~~~~~~r~~~q~~~l~~i~~--~~~~~~~~~~~pl~~~e~~G~  310 (334)
T 3iqw_A          233 FLSLYETERMIQELANYGIDTHCIVVNQLLFPKPGSDCEQCTARRRMQKKYLDQIEE--LYDEEFNVVKMPLLVEEVRGK  310 (334)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCEEEEEEEEECCCCTTCCCHHHHHHHHHHHHHHHHHHH--HHTTTSEEEEEECCSSCCCHH
T ss_pred             ccHHHHHHHHHHHHHHCCCCccEEEECCCcCcccCCcCHHHHHHHHHHHHHHHHHHH--hccCCCCEEEecCCCCCCCCH
Confidence            999999999999999999999999999999 55556899999999999999999998  5677 9999999999999999


Q ss_pred             HHHHHHHHHhhC
Q 016417          379 PALRFMGDIIWK  390 (390)
Q Consensus       379 ~~L~~l~~~~~~  390 (390)
                      ++|+.+++.||+
T Consensus       311 ~~L~~~~~~l~~  322 (334)
T 3iqw_A          311 ERLEKFSEMLIK  322 (334)
T ss_dssp             HHHHHHHHHHHS
T ss_pred             HHHHHHHHHHcC
Confidence            999999999985
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d1ihua1296 c.37.1.10 (A:1-296) Arsenite-translocating ATPase 1e-42
d1ihua2279 c.37.1.10 (A:308-586) Arsenite-translocating ATPas 5e-38
d1hyqa_232 c.37.1.10 (A:) Cell division regulator MinD {Archa 1e-07
d1g3qa_237 c.37.1.10 (A:) Cell division regulator MinD {Archa 4e-07
d1cp2a_269 c.37.1.10 (A:) Nitrogenase iron protein {Clostridi 5e-07
d2afhe1289 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot 2e-06
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 9e-04
d1ls1a2207 c.37.1.10 (A:89-295) GTPase domain of the signal s 0.003
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

 Score =  148 bits (374), Expect = 1e-42
 Identities = 68/296 (22%), Positives = 118/296 (39%), Gaps = 14/296 (4%)

Query: 90  KYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEG 149
            Y    GKGGVGKTS + + A++ A  G   L+VSTDPA ++   F+Q +  G  +    
Sbjct: 9   PYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSQTI--GNTIQAIA 66

Query: 150 PDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPP 209
               L ALEI+P+ A +++R          +K  +    +  +       +L     T  
Sbjct: 67  SVPGLSALEIDPQAAAQQYR----ARIVDPIKGVLPDDVVSSI-----NEQLSGACTTEI 117

Query: 210 PGLDEAIAISKGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASD 269
              DE   +    +L         D +         ++  A S+      +  +  G   
Sbjct: 118 AAFDEFTGLLTDASLLTRFDHIIFDTAPTGHTIRLLQLPGAWSSFIDSNPEGASCLGPMA 177

Query: 270 KLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQI 329
            LE+ RE+     E   D   T  V+V       + E +R    L    +  + L++N +
Sbjct: 178 GLEKQREQYAYAVEALSDPKRTRLVLVARLQKSTLQEVARTHLELAAIGLKNQYLVINGV 237

Query: 330 IPPS-ASDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFM 384
           +P + A++    A   + +  AL  +   ++L+ L      L  V + GV AL  +
Sbjct: 238 LPKTEAANDTLAAAIWEREQEALANLP--ADLAGLPTDTLFLQPVNMVGVSALSRL 291
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 100.0
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 99.97
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 99.68
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 99.67
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 99.57
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 99.55
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 99.4
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.02
d2qy9a2211 GTPase domain of the signal recognition particle r 97.67
d1vmaa2213 GTPase domain of the signal recognition particle r 97.64
d1okkd2207 GTPase domain of the signal recognition particle r 97.6
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.54
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.47
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.44
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.29
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.29
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.21
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.17
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.05
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.87
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.85
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.85
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.73
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.7
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.63
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.57
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.56
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.41
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.38
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.35
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.32
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.3
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.19
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.17
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.16
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.09
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.03
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.02
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.98
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.95
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.77
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.73
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.7
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.54
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.33
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.31
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.31
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.25
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.24
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.19
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.19
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.15
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.07
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.02
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.97
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.85
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.73
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.66
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.29
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.29
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.23
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.95
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.53
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.48
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.38
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.32
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.21
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 93.16
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.1
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.06
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.06
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.01
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.98
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.84
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.83
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.66
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 92.56
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.4
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.05
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.01
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.97
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.8
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.78
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.7
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.45
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.4
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.3
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.22
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.92
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.84
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.69
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.67
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 90.46
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.18
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.03
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 89.79
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 89.67
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.66
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 89.54
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.03
d1eg7a_ 549 Formyltetrahydrofolate synthetase {Moorella thermo 89.0
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.97
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 88.51
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.49
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.38
d1svma_362 Papillomavirus large T antigen helicase domain {Si 88.15
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.84
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 87.8
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 87.77
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 87.75
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.37
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.31
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 87.13
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.99
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.63
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.62
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 86.5
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 86.31
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.24
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 85.73
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 85.52
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 84.78
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.76
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 84.28
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 84.04
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.63
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.6
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 83.56
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 83.42
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.3
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 83.26
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 83.26
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.89
d1vcoa2272 CTP synthase PyrG, N-terminal domain {Thermus ther 82.83
d2vo1a1273 CTP synthase PyrG, N-terminal domain {Human (Homo 82.0
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.32
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 81.01
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 80.81
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 80.59
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 80.4
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.33
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 80.14
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=7.2e-39  Score=304.14  Aligned_cols=267  Identities=26%  Similarity=0.368  Sum_probs=195.7

Q ss_pred             CcEEEEEcCCCCCcHHHHHHHHHHHHHHCCCCeEEEecCCCCCCchHhhcccCCCccccccCCCCCeeEEecChHHHHHH
Q 016417           88 QRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREE  167 (390)
Q Consensus        88 ~~~~~~~~gkgGvGKtt~a~~la~~~a~~g~~vll~d~D~~~~l~~~~g~~~~~~~~~~v~~~~~~L~a~eid~~~~~~~  167 (390)
                      ..++++++|||||||||+|+|+|.+||++|+|||+||+||+++++++||.+... .+..+.+.++ +++.+++++...++
T Consensus         7 ~p~~i~~sGKGGVGKTTvaa~lA~~lA~~G~rVLlvD~Dp~~~l~~~lg~~~~~-~~~~~~~~~~-~~~~~~~~~~~~~~   84 (296)
T d1ihua1           7 IPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSQTIGN-TIQAIASVPG-LSALEIDPQAAAQQ   84 (296)
T ss_dssp             CCSEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEEECCTTCCHHHHTTSCCCS-SCEECTTSTT-EEEEECCHHHHHHH
T ss_pred             CCeEEEEECCCcChHHHHHHHHHHHHHHCCCCEEEEeCCCCCCHHHHhCCCCcc-cccccccccc-cchhccChhhHHHH
Confidence            345778899999999999999999999999999999999999999999988653 4555555555 99999999998888


Q ss_pred             HHhhhhhcCCCcc-hhhh----cc---------cchhhHHHHhh----hhhcccccCCCCCChhHHHHhhccceeccccC
Q 016417          168 FRNVTQKDGGTGV-KDFM----DG---------MGLGMLVEQLG----ELKLGELLDTPPPGLDEAIAISKGHTLRLLSL  229 (390)
Q Consensus       168 ~~~~~~~~~~~~~-~~~l----~~---------~~~~~~~e~L~----~~~~~~lid~~pPG~de~~~l~~g~tLrlL~l  229 (390)
                      |+........... ...+    ..         .++..+...+.    .-.++.++.+.||+         +|+++++.+
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yD~iviD~pp~---------~~~l~~~~l  155 (296)
T d1ihua1          85 YRARIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTAPT---------GHTIRLLQL  155 (296)
T ss_dssp             HHHHHHGGGTTTSCHHHHHHHHHHTSSHHHHHHHHHHHHHHHHHCTTHHHHCSEEEESSCCC---------HHHHHHHHC
T ss_pred             HHhhccchhhhcccccchhhhHHhhhhhhhhhHHHHHHHHHHHHHhhhcccceEEEeccCCC---------chHHHHHhH
Confidence            7654322111100 0000    00         00000111111    01233333334666         677888899


Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHHhhccccchhhHHHHHHHHHHHHHHHHHHhcCCCCceEEEEeCCCcchHHHHHH
Q 016417          230 PDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSR  309 (390)
Q Consensus       230 p~~l~~~l~~ll~l~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~~~~~~~~~~~~L~d~~~t~~~lVt~Pe~~s~~ea~r  309 (390)
                      |+.+.+|+.......           ..++       ....++.+.+.+.++.+.+.|++.|++++||+|+.+++.+++|
T Consensus       156 ~~~~~~~~~~~~~~~-----------~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~t~~~lVt~pe~~~~~~~~r  217 (296)
T d1ihua1         156 PGAWSSFIDSNPEGA-----------SCLG-------PMAGLEKQREQYAYAVEALSDPKRTRLVLVARLQKSTLQEVAR  217 (296)
T ss_dssp             GGGGTCCC------C-----------CCCG-------GGGGCCSCHHHHHHHHHHHHCTTTEEEEEEEESCHHHHHHHHH
T ss_pred             HHHHHHHHhhccchh-----------hhcc-------cccchhHHHHHHHHHHhhccCcccceeeEecCcchhHHHHHHH
Confidence            988877765332111           1111       1112234556677788889999999999999999999999999


Q ss_pred             HHHHHHhCCCCcceEEEcCccCCCC-CchHHHHHHHHHHHHHHHhhhhcCccCCCceEEecCCCCCCCCHHHHHHHH
Q 016417          310 LSESLKKENVPVKRLIVNQIIPPSA-SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMG  385 (390)
Q Consensus       310 ~~~~L~~~gi~v~gvVvN~v~p~~~-~~~~~~~~~~~~q~~~l~~i~~d~~~~~l~i~~vP~~~~ev~G~~~L~~l~  385 (390)
                      +++.++++|+++.++|+||++|... ..|++|..+.+.|++++++|++  .|.++++.++|+++.||+|+++|++|-
T Consensus       218 ~~~~l~~~gi~~~~vVvN~v~p~~~~~~~~~~~~~~~~q~~~l~~i~~--~~~~~~~~~vp~~~~e~~G~~aL~~l~  292 (296)
T d1ihua1         218 THLELAAIGLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALANLPA--DLAGLPTDTLFLQPVNMVGVSALSRLL  292 (296)
T ss_dssp             HHHHHHHHTCCCEEEEEEEECCGGGGSSCHHHHHHHHHHHHHHHTCCH--HHHTSCEEEEECCSSCCCSHHHHHHTT
T ss_pred             HHHHHHhcCCCceEEEEcCCcCccCCCCCHHHHHHHHHHHHHHHHHHH--HccCCceEEecCCCCCCcCHHHHHHHh
Confidence            9999999999999999999998754 3688999999999999999987  678999999999999999999998863
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure