Citrus Sinensis ID: 016527
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 388 | ||||||
| 255548265 | 390 | Calcium-activated outward-rectifying pot | 0.987 | 0.982 | 0.762 | 1e-165 | |
| 224068707 | 379 | outward rectifying potassium channel [Po | 0.969 | 0.992 | 0.734 | 1e-158 | |
| 147818960 | 390 | hypothetical protein VITISV_040173 [Viti | 0.989 | 0.984 | 0.728 | 1e-154 | |
| 225437793 | 390 | PREDICTED: probable calcium-activated ou | 0.989 | 0.984 | 0.725 | 1e-154 | |
| 224128167 | 318 | outward rectifying potassium channel [Po | 0.814 | 0.993 | 0.820 | 1e-152 | |
| 356503966 | 376 | PREDICTED: probable calcium-activated ou | 0.963 | 0.994 | 0.694 | 1e-151 | |
| 356572840 | 385 | PREDICTED: probable calcium-activated ou | 0.963 | 0.971 | 0.688 | 1e-149 | |
| 357511543 | 382 | Outward rectifying potassium channel [Me | 0.873 | 0.887 | 0.736 | 1e-142 | |
| 297814143 | 406 | hypothetical protein ARALYDRAFT_490395 [ | 0.976 | 0.933 | 0.606 | 1e-131 | |
| 15234351 | 408 | putative calcium-activated outward-recti | 0.987 | 0.938 | 0.594 | 1e-128 |
| >gi|255548265|ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 588 bits (1517), Expect = e-165, Method: Compositional matrix adjust.
Identities = 301/395 (76%), Positives = 337/395 (85%), Gaps = 12/395 (3%)
Query: 1 MEQEPFLGSQTRPQHQ--LEAILEEEHDHDTLHTVPQSLSSPHIFNEIENLDQPQSQA-- 56
ME EPFL SQTRPQ Q L++ILE HD T+ SLSSP +F+EI+ +QP S A
Sbjct: 1 MENEPFLASQTRPQSQPQLQSILER---HDLSFTLSPSLSSPILFSEIQ--EQPVSTAIL 55
Query: 57 PPESSTTWKPGSLHRSKTAPALVVLRDVQQQTSQVPKPKSESSFIIRQAFVLLSIYLFVG 116
S+ KPGSLHRSKTAPA+VV+RD++ Q PKP+SESS IIRQA LL +YL +G
Sbjct: 56 GAPSTQRKKPGSLHRSKTAPAMVVMRDLKPLPPQDPKPQSESSSIIRQAIFLLFLYLLLG 115
Query: 117 VVIYSFNTDHFSGVETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFACLFVLVGFGFI 176
VVIYSFN D+FSG+ETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFAC+FVLVGFGFI
Sbjct: 116 VVIYSFNRDNFSGIETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFACVFVLVGFGFI 175
Query: 177 DILLSGVVNYVLDLQENMILTGIQMGKVK---EGFSARDYIVDVAKGRMRIRLKVGLALG 233
DILLSGVVNYVLDLQE+MIL GIQMG + EGFSAR+YIVDV KGRMRIRLKVGLALG
Sbjct: 176 DILLSGVVNYVLDLQESMILAGIQMGNNRTAHEGFSARNYIVDVEKGRMRIRLKVGLALG 235
Query: 234 VVVLCIAIGALILFFLEDLDWLDSFYLSVMSVTTVGYGDRAFKTLPGRFFAAIWLLFSTL 293
VVVLCI IG L+L++LEDLD +DS YL+VMSVTTVGYGDR FKTLPGR FAAIWLL S+L
Sbjct: 236 VVVLCIGIGTLVLYYLEDLDCIDSIYLAVMSVTTVGYGDRVFKTLPGRLFAAIWLLVSSL 295
Query: 294 MVARAFLYLAEARIDKRHRRIAKWVLQREITIDDLLAADMNHNGFISKSEYVIFKLKEMG 353
VARAFLYLAEARIDKRHRRI KWVL R+IT++DL+AAD+N+NGFISKSEYVI+KLKEMG
Sbjct: 296 AVARAFLYLAEARIDKRHRRITKWVLHRDITVEDLIAADINNNGFISKSEYVIYKLKEMG 355
Query: 354 KIGEKDISQICNQFNRLDPNNCGKITLPDLLENHL 388
KIGEKDI QICNQF++LDPNN GKITLPDLLEN L
Sbjct: 356 KIGEKDILQICNQFSKLDPNNLGKITLPDLLENRL 390
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224068707|ref|XP_002302805.1| outward rectifying potassium channel [Populus trichocarpa] gi|222844531|gb|EEE82078.1| outward rectifying potassium channel [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147818960|emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225437793|ref|XP_002274039.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224128167|ref|XP_002320260.1| outward rectifying potassium channel [Populus trichocarpa] gi|222861033|gb|EEE98575.1| outward rectifying potassium channel [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356503966|ref|XP_003520770.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356572840|ref|XP_003554573.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357511543|ref|XP_003626060.1| Outward rectifying potassium channel [Medicago truncatula] gi|355501075|gb|AES82278.1| Outward rectifying potassium channel [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297814143|ref|XP_002874955.1| hypothetical protein ARALYDRAFT_490395 [Arabidopsis lyrata subsp. lyrata] gi|297320792|gb|EFH51214.1| hypothetical protein ARALYDRAFT_490395 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15234351|ref|NP_192093.1| putative calcium-activated outward-rectifying potassium channel 5 [Arabidopsis thaliana] gi|38605077|sp|Q9S6Z8.1|TPK5_ARATH RecName: Full=Two-pore potassium channel 5; Short=AtTPK5; AltName: Full=Calcium-activated outward-rectifying potassium channel 5, chloroplastic; Short=AtKCO5 gi|4558553|gb|AAD22646.1|AC007138_10 putative potassium channel [Arabidopsis thaliana] gi|6522947|emb|CAB62162.1| KCO5 protein [Arabidopsis thaliana] gi|7268568|emb|CAB80677.1| putative potassium channel [Arabidopsis thaliana] gi|21537080|gb|AAM61421.1| putative potassium channel [Arabidopsis thaliana] gi|332656683|gb|AEE82083.1| putative calcium-activated outward-rectifying potassium channel 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 388 | ||||||
| TAIR|locus:2141375 | 408 | KCO5 "Ca2+ activated outward r | 0.824 | 0.784 | 0.667 | 2.3e-114 | |
| TAIR|locus:2117681 | 436 | KCO6 "Ca2+ activated outward r | 0.855 | 0.761 | 0.582 | 9.7e-96 | |
| TAIR|locus:2170423 | 443 | KCO2 "Ca2+ activated outward r | 0.922 | 0.808 | 0.517 | 3.2e-88 | |
| TAIR|locus:2196155 | 284 | TPK4 [Arabidopsis thaliana (ta | 0.561 | 0.767 | 0.473 | 1.8e-54 | |
| TAIR|locus:2162162 | 363 | KCO1 "CA2+ ACTIVATED OUTWARD R | 0.801 | 0.856 | 0.347 | 3.5e-52 | |
| TAIR|locus:2170413 | 260 | KCO3 "AT5G46360" [Arabidopsis | 0.365 | 0.546 | 0.570 | 6.8e-49 | |
| UNIPROTKB|Q850M0 | 347 | TPKA "Two pore potassium chann | 0.793 | 0.887 | 0.346 | 1.8e-48 | |
| UNIPROTKB|Q8LIN5 | 349 | TPKB "Two pore potassium chann | 0.822 | 0.914 | 0.327 | 2.6e-47 | |
| UNIPROTKB|Q8E842 | 131 | Q8E842 "Potassium/ion transpor | 0.219 | 0.648 | 0.376 | 4.7e-09 | |
| TIGR_CMR|SO_A0098 | 131 | SO_A0098 "potassium/ion transp | 0.219 | 0.648 | 0.376 | 4.7e-09 |
| TAIR|locus:2141375 KCO5 "Ca2+ activated outward rectifying K+ channel 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1098 (391.6 bits), Expect = 2.3e-114, Sum P(2) = 2.3e-114
Identities = 217/325 (66%), Positives = 255/325 (78%)
Query: 69 LHRSKTAPALVVLRDVQQQTSQVPKPKSESSFIIRQAFVLLSIYLFVGVVIYSFNTDHFS 128
LHRS+TAPA+V+++D++ + + KP S IIRQA LL +YL +GV IYSFN DH+S
Sbjct: 84 LHRSRTAPAMVIIKDLRTKPPETKKPSPVSKSIIRQAIFLLIVYLTLGVSIYSFNRDHYS 143
Query: 129 GVETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFACLFVLVGFGFIDILLSGVVNYVL 188
G+ETHPVVDALYFCIVTMCTIGYGDIAPLTP TK+FA +FVL GFGF+DILLSGVVNYVL
Sbjct: 144 GIETHPVVDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNYVL 203
Query: 189 DLQENMILTGIQMGKVKEG-----FSARDYIVDVAKGRMRIRXXXXXXXXXXXXCIAIGA 243
DLQE+MILTGIQ + + FSA+DYI+D KGRMRIR CI +GA
Sbjct: 204 DLQESMILTGIQTRQHHQHHHHHRFSAKDYIIDFEKGRMRIRMKVCLALCVVVLCIGVGA 263
Query: 244 LILFFLEDLDWLDSFYLSVMSVTTVGYGDRAFKTLPGRFFAAIWLLFSTLMVARAFLYLA 303
L+L F+E+L ++DS YLSVMSVTTVGYGDRAFKTL GR FAA+WLL STL VARAFLYLA
Sbjct: 264 LVLHFVEELGFVDSVYLSVMSVTTVGYGDRAFKTLQGRLFAAVWLLVSTLAVARAFLYLA 323
Query: 304 EARIDKRHRRIAKWVLQREITIDDLLAADMNHNGFISKSEYVIFKLKEMGKIGEKDISQI 363
EARID+RHR+ K L REIT+DDLL AD +GFISKSEY++ KLKEMGKI +KDI Q+
Sbjct: 324 EARIDRRHRKAVKLALNREITVDDLLKADTYQHGFISKSEYIVLKLKEMGKITQKDIDQV 383
Query: 364 CNQFNRLDPNNCGKITLPDLLENHL 388
QF +LDPN GKITLPDLL + L
Sbjct: 384 VIQFEKLDPNQIGKITLPDLLGDPL 408
|
|
| TAIR|locus:2117681 KCO6 "Ca2+ activated outward rectifying K+ channel 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170423 KCO2 "Ca2+ activated outward rectifying K+ channel 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196155 TPK4 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162162 KCO1 "CA2+ ACTIVATED OUTWARD RECTIFYING K+ CHANNEL 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170413 KCO3 "AT5G46360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q850M0 TPKA "Two pore potassium channel a" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8LIN5 TPKB "Two pore potassium channel b" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E842 Q8E842 "Potassium/ion transporter, voltage-gated ion channel (VIC) superfamily" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_A0098 SO_A0098 "potassium/ion transporter, voltage-gated ion channel (VIC) superfamily" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_II001901 | outward rectifying potassium channel (379 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 388 | |||
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 2e-13 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 1e-10 | |
| PRK10537 | 393 | PRK10537, PRK10537, voltage-gated potassium channe | 6e-06 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 0.002 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
Score = 64.5 bits (158), Expect = 2e-13
Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
Query: 107 VLLSIYLFVGVVIYSFNTDHFSGVETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFAC 166
+LL + L G V YS +DALYF VT+ TIGYGDI PLT A ++F
Sbjct: 1 ILLLLVLIFGTVYYSLE----EEGWGWDFLDALYFSFVTLTTIGYGDIVPLTDAGRLFTI 56
Query: 167 LFVLVGFGFIDILLS 181
+++L+G + L+
Sbjct: 57 IYILIGIPLFLLFLA 71
|
This family includes the two membrane helix type ion channels found in bacteria. Length = 74 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 388 | |||
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 99.96 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 99.91 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.69 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.54 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 99.53 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.51 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.49 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.34 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.33 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 99.29 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 99.29 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 99.24 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.16 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.13 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.08 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 99.03 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.02 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 98.99 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 98.79 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 98.78 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 98.66 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 98.55 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 98.35 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 98.23 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 98.21 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.99 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 97.87 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 97.81 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.79 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 97.55 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 96.58 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 96.58 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 96.51 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 96.08 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 95.79 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 95.78 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 95.62 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 95.44 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 95.08 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 94.8 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 94.8 | |
| PRK10750 | 483 | potassium transporter; Provisional | 94.78 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 94.64 | |
| PRK10750 | 483 | potassium transporter; Provisional | 94.02 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 93.93 | |
| PRK05482 | 559 | potassium-transporting ATPase subunit A; Provision | 93.75 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 93.64 | |
| PF00060 | 148 | Lig_chan: Ligand-gated ion channel; InterPro: IPR0 | 93.08 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 92.11 | |
| PF00060 | 148 | Lig_chan: Ligand-gated ion channel; InterPro: IPR0 | 92.05 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 91.57 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 91.31 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 90.44 | |
| COG0168 | 499 | TrkG Trk-type K+ transport systems, membrane compo | 90.28 | |
| PF02386 | 354 | TrkH: Cation transport protein; InterPro: IPR00344 | 90.26 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 89.05 | |
| PTZ00183 | 158 | centrin; Provisional | 87.98 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 87.75 | |
| TIGR00934 | 800 | 2a38euk potassium uptake protein, Trk family. The | 86.01 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 85.71 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 85.48 | |
| KOG4440 | 993 | consensus NMDA selective glutamate-gated ion chann | 85.19 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 84.95 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 84.88 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 84.84 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 84.8 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 83.92 | |
| PTZ00183 | 158 | centrin; Provisional | 83.83 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 83.73 | |
| TIGR00934 | 800 | 2a38euk potassium uptake protein, Trk family. The | 83.25 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 83.07 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 82.83 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 82.69 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 82.68 | |
| PTZ00184 | 149 | calmodulin; Provisional | 82.25 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 82.25 | |
| KOG1054 | 897 | consensus Glutamate-gated AMPA-type ion channel re | 81.96 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 81.87 | |
| PTZ00184 | 149 | calmodulin; Provisional | 81.7 | |
| KOG4440 | 993 | consensus NMDA selective glutamate-gated ion chann | 81.15 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 80.01 |
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.96 E-value=4.9e-28 Score=226.35 Aligned_cols=191 Identities=21% Similarity=0.350 Sum_probs=149.0
Q ss_pred HHHHHHHHHHHHHHHhhhhhhccc---------------------------------------ccCCCCCCCcchhhhhe
Q 016527 102 IRQAFVLLSIYLFVGVVIYSFNTD---------------------------------------HFSGVETHPVVDALYFC 142 (388)
Q Consensus 102 ~~~~~i~~~~~i~~g~~i~~~~~~---------------------------------------~~~~~~~~s~~~a~yf~ 142 (388)
...+++..+.|+++|+++|-..+. .......|.|..|+||+
T Consensus 9 ~l~Livct~tYLLvGAaVFdaLEse~E~~~r~~l~~~~~~~~~kyn~s~~d~r~~er~i~~s~ph~ag~qWkF~GaFYFa 88 (350)
T KOG4404|consen 9 TLLLIVCTFTYLLVGAAVFDALESENEARERERLERRLANLKRKYNLSEEDYRELERVILKSEPHKAGPQWKFAGAFYFA 88 (350)
T ss_pred HHHHHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHhcCccccccccccCcceEEE
Confidence 344666778899999999976430 11113459999999999
Q ss_pred eeeeecccccccccCCcccchhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccCcccccceeeecccch
Q 016527 143 IVTMCTIGYGDIAPLTPATKVFACLFVLVGFGFIDILLSGVVNYVLDLQENMILTGIQMGKVKEGFSARDYIVDVAKGRM 222 (388)
Q Consensus 143 ~vtltTVGYGdi~p~t~~gr~~~~~~~l~Gi~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~ 222 (388)
.+.+||||||.-.|.|..||+||++|.++|+++..+.+..++..+.... ..+++..|.+...+.++..
T Consensus 89 ~TVItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lvmFqs~gERlnt~~-ayil~~~r~~~~~r~~~~S----------- 156 (350)
T KOG4404|consen 89 TTVITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLVMFQSIGERLNTFV-AYILRRCRRRLGRRRWDVS----------- 156 (350)
T ss_pred EEEEeeeccCCCCCCCcCceehhhhHHHhcCchHHHHHHHHHHHHHHHH-HHHHHHHHHHhccccCCCc-----------
Confidence 9999999999999999999999999999999999999999988776543 4455555554443322111
Q ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHhhcCCcccceeeeEeeeeccccCCCccCC--------cCcchhhHHHHHHHHHH
Q 016527 223 RIRLKVGLALGVVVLCIAIGALILFFLEDLDWLDSFYLSVMSVTTVGYGDRAFKT--------LPGRFFAAIWLLFSTLM 294 (388)
Q Consensus 223 ~~~~~~~~~~~~~~~~i~~g~~~~~~~e~~s~~da~y~~~iT~tTVGyGDi~p~t--------~~gr~~~~~~~l~G~~~ 294 (388)
.-.-+.......++.++.|+.+|...|+|+|+||+||++||+|||||||+++.. +..+.+..++|++|+.+
T Consensus 157 -~~~l~~i~~~~~~~~i~~gaa~fs~~E~Wsyfds~YyCFITltTIGFGDyValQ~~~alq~qplYv~~sf~fIL~Gl~v 235 (350)
T KOG4404|consen 157 -VYNLVLILFTACILLICCGAAMFSSVEGWSYFDSYYYCFITLTTIGFGDYVALQQDAALQSQPLYVFFSFVFILLGLCV 235 (350)
T ss_pred -HHHHHHHHHHHHHHHHHhhHHHhhcccCcchhhhhheeeeeeeeccccchhhhcchhhhhCCCceehHhHHHHHHHHHH
Confidence 111233444566677889999999999999999999999999999999999853 35678999999999999
Q ss_pred HHHHHHHHHHH
Q 016527 295 VARAFLYLAEA 305 (388)
Q Consensus 295 ~~~~~~~l~~~ 305 (388)
++.+++.+.=.
T Consensus 236 i~a~~NllvLr 246 (350)
T KOG4404|consen 236 IYALLNLLVLR 246 (350)
T ss_pred HHHHHHHHHHH
Confidence 99888877633
|
|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10750 potassium transporter; Provisional | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PRK10750 potassium transporter; Provisional | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PRK05482 potassium-transporting ATPase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >COG0168 TrkG Trk-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02386 TrkH: Cation transport protein; InterPro: IPR003445 This family consists of various potassium transport proteins (Trk) and V-type sodium ATP synthase subunit J or translocating ATPase J (3 | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00934 2a38euk potassium uptake protein, Trk family | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >TIGR00934 2a38euk potassium uptake protein, Trk family | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 388 | ||||
| 4h33_A | 137 | Crystal Structure Of A Voltage-gated K+ Channel Por | 1e-07 | ||
| 3ouf_A | 97 | Structure Of A K+ Selective Nak Mutant Length = 97 | 5e-07 | ||
| 3tcu_A | 97 | Crystal Structure Of Nak2k Channel D68e Mutant Leng | 2e-06 | ||
| 3tet_A | 97 | Crystal Structure Of Nak2k Channel Y66f Mutant Leng | 2e-06 | ||
| 3t4d_A | 97 | Crystal Structure Of Nak2k Channel Y55f Mutant Leng | 2e-06 | ||
| 3t4z_A | 97 | Crystal Structure Of Nak2k Channel Y55w Mutant Leng | 2e-06 | ||
| 3t1c_A | 97 | Crystal Structure Of Nak Channel D66y Mutant Length | 2e-06 | ||
| 3vou_A | 148 | The Crystal Structure Of Nak-Navsulp Chimera Channe | 7e-06 | ||
| 4hyo_A | 91 | Crystal Structure Of Mthk Pore Length = 91 | 7e-06 | ||
| 3ldd_A | 82 | High Resolution Open Mthk Pore Structure Crystalliz | 9e-06 | ||
| 1lnq_A | 336 | Crystal Structure Of Mthk At 3.3 A Length = 336 | 9e-06 | ||
| 3t2m_A | 97 | Crystal Structure Of Nak Channel N68d Mutant Length | 9e-06 | ||
| 3r65_A | 82 | Mthk Channel Pore E92q Mutant Length = 82 | 1e-05 | ||
| 3ldc_A | 82 | High Resolution Open Mthk Pore Structure Crystalliz | 1e-05 | ||
| 2q67_A | 114 | Crystal Structure Of Nak Channel D66a Mutant Length | 2e-05 | ||
| 2q69_A | 114 | Crystal Structure Of Nak Channel D66n Mutant Length | 2e-05 | ||
| 2q6a_A | 114 | Crystal Structure Of Nak Channel D66e Mutant Length | 2e-05 | ||
| 2ahy_A | 110 | Na+ Complex Of The Nak Channel Length = 110 | 3e-05 | ||
| 3e83_A | 96 | Crystal Structure Of The The Open Nak Channel Pore | 3e-05 | ||
| 2q68_A | 114 | Crystal Structure Of Nak Channel D66a, S70e Double | 3e-05 | ||
| 3rbz_A | 340 | Mthk Channel, Ca2+-Bound Length = 340 | 3e-05 | ||
| 3ous_A | 82 | Mthk Channel Pore T59a Mutant Length = 82 | 4e-05 | ||
| 2a0l_A | 241 | Crystal Structure Of Kvap-33h1 Fv Complex Length = | 4e-05 | ||
| 3um7_A | 309 | Crystal Structure Of The Human Two Pore Domain K+ I | 6e-05 | ||
| 3lnm_B | 514 | F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Chan | 8e-05 | ||
| 1orq_C | 223 | X-Ray Structure Of A Voltage-Dependent Potassium Ch | 8e-05 | ||
| 2r9r_B | 514 | Shaker Family Voltage Dependent Potassium Channel ( | 9e-05 | ||
| 3lut_B | 499 | A Structural Model For The Full-Length Shaker Potas | 1e-04 | ||
| 2a79_B | 499 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 1e-04 | ||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 1e-04 |
| >pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 | Back alignment and structure |
|
| >pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 | Back alignment and structure |
| >pdb|3TCU|A Chain A, Crystal Structure Of Nak2k Channel D68e Mutant Length = 97 | Back alignment and structure |
| >pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 | Back alignment and structure |
| >pdb|3T4D|A Chain A, Crystal Structure Of Nak2k Channel Y55f Mutant Length = 97 | Back alignment and structure |
| >pdb|3T4Z|A Chain A, Crystal Structure Of Nak2k Channel Y55w Mutant Length = 97 | Back alignment and structure |
| >pdb|3T1C|A Chain A, Crystal Structure Of Nak Channel D66y Mutant Length = 97 | Back alignment and structure |
| >pdb|3VOU|A Chain A, The Crystal Structure Of Nak-Navsulp Chimera Channel Length = 148 | Back alignment and structure |
| >pdb|4HYO|A Chain A, Crystal Structure Of Mthk Pore Length = 91 | Back alignment and structure |
| >pdb|3LDD|A Chain A, High Resolution Open Mthk Pore Structure Crystallized In 100 Mm K+ And Further Soaked In 99 Mm Na+1 MM K+ Length = 82 | Back alignment and structure |
| >pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 | Back alignment and structure |
| >pdb|3T2M|A Chain A, Crystal Structure Of Nak Channel N68d Mutant Length = 97 | Back alignment and structure |
| >pdb|3R65|A Chain A, Mthk Channel Pore E92q Mutant Length = 82 | Back alignment and structure |
| >pdb|3LDC|A Chain A, High Resolution Open Mthk Pore Structure Crystallized In 100 Mm K+ Length = 82 | Back alignment and structure |
| >pdb|2Q67|A Chain A, Crystal Structure Of Nak Channel D66a Mutant Length = 114 | Back alignment and structure |
| >pdb|2Q69|A Chain A, Crystal Structure Of Nak Channel D66n Mutant Length = 114 | Back alignment and structure |
| >pdb|2Q6A|A Chain A, Crystal Structure Of Nak Channel D66e Mutant Length = 114 | Back alignment and structure |
| >pdb|2AHY|A Chain A, Na+ Complex Of The Nak Channel Length = 110 | Back alignment and structure |
| >pdb|3E83|A Chain A, Crystal Structure Of The The Open Nak Channel Pore Length = 96 | Back alignment and structure |
| >pdb|2Q68|A Chain A, Crystal Structure Of Nak Channel D66a, S70e Double Mutants Length = 114 | Back alignment and structure |
| >pdb|3RBZ|A Chain A, Mthk Channel, Ca2+-Bound Length = 340 | Back alignment and structure |
| >pdb|3OUS|A Chain A, Mthk Channel Pore T59a Mutant Length = 82 | Back alignment and structure |
| >pdb|2A0L|A Chain A, Crystal Structure Of Kvap-33h1 Fv Complex Length = 241 | Back alignment and structure |
| >pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 | Back alignment and structure |
| >pdb|3LNM|B Chain B, F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Channel Length = 514 | Back alignment and structure |
| >pdb|1ORQ|C Chain C, X-Ray Structure Of A Voltage-Dependent Potassium Channel In Complex With An Fab Length = 223 | Back alignment and structure |
| >pdb|2R9R|B Chain B, Shaker Family Voltage Dependent Potassium Channel (Kv1.2-Kv2.1 Paddle Chimera Channel) In Association With Beta Subunit Length = 514 | Back alignment and structure |
| >pdb|3LUT|B Chain B, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 499 | Back alignment and structure |
| >pdb|2A79|B Chain B, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 499 | Back alignment and structure |
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 388 | |||
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 1e-22 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 5e-22 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 7e-21 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 5e-16 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 2e-20 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 4e-16 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 4e-20 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 4e-17 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 7e-20 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 5e-15 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 8e-15 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 6e-14 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 1e-12 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 5e-08 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 4e-12 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 8e-08 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 5e-12 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 2e-07 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 8e-12 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 4e-07 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 4e-11 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 4e-06 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 7e-11 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 3e-08 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 1e-10 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 4e-07 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 4e-10 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 1e-08 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 5e-10 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 9e-10 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 4e-08 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 3e-06 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 4e-08 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 4e-07 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 4e-05 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 5e-04 |
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 | Back alignment and structure |
|---|
Score = 96.4 bits (239), Expect = 1e-22
Identities = 42/211 (19%), Positives = 74/211 (35%), Gaps = 16/211 (7%)
Query: 118 VIYSFNTDHFSGVETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFACLFVLVGFGFID 177
+ S + A +F + TIGYG++A T A ++F + LVG
Sbjct: 99 ADPETQSTSQSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFG 158
Query: 178 ILLSGVVNYVLDLQENMILTGIQMGKVKEGFSARDYIVDVAKGRMRIRLKVGLALGVVVL 237
ILL+GV + + + I A V +R+ + L +L
Sbjct: 159 ILLAGVGDRLGSSLRHGIGH----------IEAIFLKWHVPPELVRVLSAMLFLLIGCLL 208
Query: 238 CIAIGALILFFLEDLDWLDSFYLSVMSVTTVGYGDRAFKTLP------GRFFAAIWLLFS 291
+ + ++ED L++ Y ++++TTVG+GD P + W+L
Sbjct: 209 FVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLG 268
Query: 292 TLMVARAFLYLAEARIDKRHRRIAKWVLQRE 322
A + R A+
Sbjct: 269 LAYFASVLTTIGNWLRVVSRRTRAEMGGLTA 299
|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Length = 340 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 388 | |||
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 100.0 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.98 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.72 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.72 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.7 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.7 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.68 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.67 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.65 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.65 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.64 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.63 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.6 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.58 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.58 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.57 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.56 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.56 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.53 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.53 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.53 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.51 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.45 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.45 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.42 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.42 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.35 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.32 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.32 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.31 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.29 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.27 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.24 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.24 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.23 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.18 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.12 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.12 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.08 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 98.97 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.97 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 98.93 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.87 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.73 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.62 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.99 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 96.5 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 95.11 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 95.05 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 94.76 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 94.63 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 94.45 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 94.38 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 94.29 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 94.13 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 94.12 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 94.03 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 93.96 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 93.91 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 93.8 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 93.77 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 93.62 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 93.55 | |
| 3pjz_A | 494 | Potassium uptake protein TRKH; structural genomics | 93.55 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 93.35 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 93.35 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 93.3 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 93.28 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 93.25 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 93.21 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 93.18 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 93.13 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 93.04 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 93.02 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 93.01 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 92.98 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 92.97 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 92.92 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 92.89 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 92.88 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 92.88 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 92.8 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 92.68 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 92.62 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 92.51 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 92.5 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 92.5 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 92.47 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 92.45 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 92.42 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 92.38 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 92.33 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 92.2 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 92.17 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 92.14 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 92.02 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 91.99 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 91.99 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 91.96 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 91.88 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 91.86 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 91.85 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 91.84 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 91.83 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 91.81 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 91.77 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 91.76 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 91.72 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 91.62 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 91.62 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 91.61 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 91.59 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 91.55 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 91.49 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 91.47 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 91.47 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 91.39 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 91.35 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 91.35 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 91.22 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 91.2 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 91.18 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 91.15 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 91.11 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 91.1 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 91.03 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 91.03 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 91.01 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 90.99 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 90.96 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 90.95 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 90.95 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 90.93 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 90.93 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 90.9 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 90.85 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 90.76 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 90.76 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 90.75 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 90.73 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 90.72 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 90.71 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 90.67 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 90.65 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 90.61 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 90.58 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 90.56 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 90.53 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 90.53 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 90.5 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 90.49 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 90.48 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 90.47 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 90.47 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 90.46 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 90.43 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 90.43 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 90.35 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 90.35 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 90.33 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 90.25 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 90.24 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 90.22 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 90.21 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 90.18 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 90.07 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 90.02 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 90.0 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 89.93 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 89.9 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 89.9 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 89.88 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 89.86 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 89.85 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 89.85 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 89.84 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 89.78 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 89.7 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 89.68 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 89.62 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 89.6 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 89.47 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 89.47 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 89.37 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 89.34 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 89.23 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 89.21 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 89.18 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 89.15 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 89.15 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 89.11 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 89.05 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 89.05 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 89.02 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 89.01 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 88.97 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 88.9 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 88.77 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 88.76 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 88.63 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 88.54 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 88.48 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 88.37 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 88.36 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 88.35 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 88.33 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 88.32 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 88.3 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 88.29 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 88.19 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 88.07 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 88.05 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 87.88 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 87.86 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 87.76 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 87.72 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 87.7 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 87.68 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 87.59 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 87.58 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 87.42 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 87.31 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 87.26 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 87.24 | |
| 3pjz_A | 494 | Potassium uptake protein TRKH; structural genomics | 87.01 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 86.79 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 86.74 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 86.7 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 86.68 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 86.67 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 86.48 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 86.41 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 86.38 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 86.25 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 86.06 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 86.0 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 85.94 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 85.81 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 85.71 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 85.7 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 85.65 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 85.63 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 85.39 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 85.31 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 85.2 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 85.12 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 85.1 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 85.1 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 85.04 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 85.03 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 84.92 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 84.75 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 84.64 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 84.52 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 84.47 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 84.46 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 84.14 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 84.12 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 83.9 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 83.7 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 83.62 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 83.57 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 83.47 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 83.43 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 83.07 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 83.06 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 82.89 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 82.87 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 82.82 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 82.8 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 82.72 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 82.64 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 82.56 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 82.54 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 82.49 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 82.43 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 82.03 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 81.79 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 81.56 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 81.56 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 81.37 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 81.35 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 81.35 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 80.71 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 80.69 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 80.39 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 80.32 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 80.2 |
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=9.4e-34 Score=267.47 Aligned_cols=202 Identities=24% Similarity=0.356 Sum_probs=155.3
Q ss_pred HHHHHHHHHHHHHHHHHhhhhhhccc------------------------------------------------ccCCCC
Q 016527 100 FIIRQAFVLLSIYLFVGVVIYSFNTD------------------------------------------------HFSGVE 131 (388)
Q Consensus 100 ~~~~~~~i~~~~~i~~g~~i~~~~~~------------------------------------------------~~~~~~ 131 (388)
.....+++..++|+++|+++|...+. +..+.+
T Consensus 11 ~~l~lLil~~~~Yl~~GA~vF~~LE~p~E~~~r~~~~~~~~~fl~~~~~~s~~~l~~~~~~~~~a~~~g~~~~~~~~~~~ 90 (280)
T 3ukm_A 11 TMFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSQASGNW 90 (280)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHTTTCCCC------C
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhCccHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHhcCCccccCCCCCC
Confidence 44445556678899999999986430 112356
Q ss_pred CCCcchhhhheeeeeecccccccccCCcccchhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccCcccc
Q 016527 132 THPVVDALYFCIVTMCTIGYGDIAPLTPATKVFACLFVLVGFGFIDILLSGVVNYVLDLQENMILTGIQMGKVKEGFSAR 211 (388)
Q Consensus 132 ~~s~~~a~yf~~vtltTVGYGdi~p~t~~gr~~~~~~~l~Gi~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~ 211 (388)
.|+|.+|+||+++|+|||||||++|.|+.||+|+++|+++|++++.+.++.+++.+.....++..+.+ ++++..
T Consensus 91 ~w~~~~a~yf~~~t~tTvGyGd~~P~T~~Gk~f~~~~~l~Gi~~~~~~~~~~~~~l~~~~~~~~~~~~---~~~~~~--- 164 (280)
T 3ukm_A 91 NWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYF---HIRWGF--- 164 (280)
T ss_dssp CSSHHHHHHHHHHHHTTCCCCSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSTTTTTC------------
T ss_pred CCChhcchhheeeeeeccccCCcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHhcC---
Confidence 79999999999999999999999999999999999999999999999999998877664322211111 111100
Q ss_pred cceeeecccchhhhHHHHHHHHHHHHHHHHHHHHHHHhh-cCCcccceeeeEeeeeccccCCCccCCcCc-------chh
Q 016527 212 DYIVDVAKGRMRIRLKVGLALGVVVLCIAIGALILFFLE-DLDWLDSFYLSVMSVTTVGYGDRAFKTLPG-------RFF 283 (388)
Q Consensus 212 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~~~~~~~e-~~s~~da~y~~~iT~tTVGyGDi~p~t~~g-------r~~ 283 (388)
.+.+......+.+.+.++++++++|+++++..| +|+|+||+||+++|+|||||||++|.+..| |++
T Consensus 165 ------~~~~~~~~~~~~l~~~~~~~~~~~ga~~~~~~E~~~s~~da~y~~~iTltTvGyGD~~p~t~~~~~~~~l~r~~ 238 (280)
T 3ukm_A 165 ------SKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIG 238 (280)
T ss_dssp ------CCHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSCCHHHHHHHHHHHHTTCCCCSCCSSCSSSCTTHHHHHHH
T ss_pred ------ChhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhcCCchhhhhhheeeeeecccCCCCCCCCCcccccchhHHHH
Confidence 111222233344455666778889999999998 899999999999999999999999999874 999
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 016527 284 AAIWLLFSTLMVARAFLYLAEARIDKRHRR 313 (388)
Q Consensus 284 ~~~~~l~G~~~~~~~~~~l~~~~~~~~~~~ 313 (388)
+++|+++|++++++.++.+++....++.++
T Consensus 239 ~~~~il~Gl~~~~~~~~~i~~~~~~~~l~~ 268 (280)
T 3ukm_A 239 ITCYLLLGLIAMLVVLETFCELHELKKFRK 268 (280)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTSHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999877766554
|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3pjz_A Potassium uptake protein TRKH; structural genomics, PSI-2, protein structure initiative, NE consortium on membrane protein structure; 3.51A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3pjz_A Potassium uptake protein TRKH; structural genomics, PSI-2, protein structure initiative, NE consortium on membrane protein structure; 3.51A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 388 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 3e-15 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 1e-13 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 3e-12 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 2e-09 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 2e-09 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 1e-05 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 3e-09 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 3e-07 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 0.002 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 67.8 bits (166), Expect = 3e-15
Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 7/82 (8%)
Query: 106 FVLLSIYLFVGVVIYSFNTDHFSGVETHPVVDALYFCIVTMCTIGYGDIAPLTPATKVFA 165
+L+ + G + F +E +LY+ VT+ T+GYGD +P TP F
Sbjct: 6 LLLVLAVIIYGTAGFHF-------IEGESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFT 58
Query: 166 CLFVLVGFGFIDILLSGVVNYV 187
+++G G + + ++ ++
Sbjct: 59 VTLIVLGIGTFAVAVERLLEFL 80
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 388 | |||
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.73 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.67 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.58 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.46 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.44 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.44 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.42 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.42 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.61 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.37 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 95.96 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 95.78 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 95.44 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 95.33 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 95.01 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 94.94 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 94.86 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 94.6 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 94.38 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 94.3 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 94.02 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 93.93 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 93.89 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 93.85 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 93.69 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 93.4 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 93.34 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 93.29 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 93.02 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 92.84 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 92.81 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 92.13 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 91.89 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 91.73 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 91.7 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 91.69 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 91.62 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 91.59 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 91.53 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 91.52 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 91.4 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 91.25 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 91.18 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 91.16 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 91.14 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 90.89 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 90.35 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 90.32 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 90.31 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 90.28 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 90.26 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 90.17 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 90.02 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 90.01 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 89.98 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 89.52 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 89.5 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 89.35 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 89.08 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 88.9 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 88.77 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 88.75 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 88.51 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 88.48 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 88.3 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 88.16 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 87.89 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 87.89 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 87.68 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 87.58 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 87.56 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 87.33 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 87.06 | |
| d2b59b1 | 60 | Cellulosomal scaffolding protein A {Clostridium th | 86.61 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 86.4 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 86.33 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 86.21 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 86.08 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 86.03 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 85.83 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 85.49 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 85.43 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 85.37 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 85.3 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 85.05 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 84.64 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 84.6 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 84.38 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 84.11 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 83.96 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 83.89 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 83.87 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 83.7 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 83.3 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 83.0 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 82.81 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 82.76 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 82.69 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 82.67 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 82.66 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 82.23 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 82.17 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 82.13 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 81.91 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 81.86 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 81.82 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 81.76 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 81.42 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 81.22 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 80.82 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 80.72 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 80.71 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 80.6 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 80.23 |
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel protein species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.73 E-value=1.6e-18 Score=138.59 Aligned_cols=89 Identities=25% Similarity=0.312 Sum_probs=77.1
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHhhc-------CCcccceeeeEeeeeccccCCCccCCcCcchhhHHHHHHHHHHHHH
Q 016527 225 RLKVGLALGVVVLCIAIGALILFFLED-------LDWLDSFYLSVMSVTTVGYGDRAFKTLPGRFFAAIWLLFSTLMVAR 297 (388)
Q Consensus 225 ~~~~~~~~~~~~~~i~~g~~~~~~~e~-------~s~~da~y~~~iT~tTVGyGDi~p~t~~gr~~~~~~~l~G~~~~~~ 297 (388)
++.+..++.++++++++++.+++..|+ .++.||+||+++|+|||||||++|.|..||+++++++++|+++++.
T Consensus 5 ~r~~~~~~~~~~~~~~~~s~~~~~~e~~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~ 84 (103)
T d1r3jc_ 5 WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGL 84 (103)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhccCCCcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHH
Confidence 445556666667777888888888886 3789999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHH
Q 016527 298 AFLYLAEARIDKRHRR 313 (388)
Q Consensus 298 ~~~~l~~~~~~~~~~~ 313 (388)
.++.+++.+.++++++
T Consensus 85 ~~~~i~~~~~~~~~~r 100 (103)
T d1r3jc_ 85 VTAALATWFVGREQER 100 (103)
T ss_dssp HHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHh
Confidence 9999999888766543
|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|