Citrus Sinensis ID: 016977

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKSGWTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTSANPYSRGSTSSRSDSSESEPKVKSCISSHCNFSSRLSFMSKPIYPLSFPTQTSNREAIDSASTVLSEDDTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTIDPVVGCAKTTAGPSMRR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccHHHcccccccEEEEEEccccEcHHHHHHccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccHHHHHHHHHHcccccccccccccccHcccccccccHcccccccccccccccccccccccc
mgphepywqtntsfspppsrwdfrfqseglpygsndgfhfygsstssnskesksgwtppaiqeitidgyetptrrdpvstqfsftpaiegtsanpysrgstssrsdssesepkvkscisshcnfssrlsfmskpiyplsfptqtsnreaIDSAstvlseddtstpqweahrwssasssvdfadvsepfesesfgqsyvpsdtfkcglcerflsqrspwssrrivrsgdmpvvgVLSCRHvfhaecleqttpktqksdpscpiclrlqeenspdqqVFSRLknsfprlrqscdngqsrpwgcpqaggcvegashvpprntvLLLNRNRVKKnlslkgnsskefpgklrktgacssqlfngktidpvvgcakttagpsmrr
mgphepywqtntsfspppsRWDFRFQSEGLPYGSNDGFHFYGSSTssnskesksgwtPPAIQEITIDGYETPTRRDPVSTQFSftpaiegtsanpysrgstssrsdssesepKVKSCISSHCNFSSRLSFMSKPIYPLSFPTQTSNREAIDSASTVLSEDDTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCGLCERFlsqrspwssrrivrsgdMPVVGVLSCRHVFHAEcleqttpktqksdpsCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVkknlslkgnsskefpgklrktgacssqlfngktidpvvgcakttagpsmrr
MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGsstssnskesksGWTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTSANPYsrgstssrsdssesePKVKSCISSHCNFSSRLSFMSKPIYPLSFPTQTSNREAIDSASTVLSEDDTSTPQWEAHRWssasssvdfadvsEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTvlllnrnrvkknlslkgnsskEFPGKLRKTGACSSQLFNGKTIDPVVGCAKTTAGPSMRR
**************************************************************************************************************************************I*************************************************************YVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLE***************************************************WGCPQAGGCVEGASHVPPRNTVLLLN******************************QLFNGKTIDPVVGC***********
*****PY*QTNTSFSPPPSRW*************************************************************************************************************************************************************************************FKCGLCERFLS***************MPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRL*****************************************************************************************************************
**************SPPPSRWDFRFQSEGLPYGSNDGFHFYG**************TPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTS***************************SHCNFSSRLSFMSKPIYPLSFPTQTSNREAI*******************************ADVSEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQT*********SCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTIDPVVGCAK*********
*****PYWQTNTSFSPPPSRWDFRFQSEGLP*GSNDG*********************************************************************************************************************************************************************FKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRL*****************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKSGWTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTSANPYSRGSTSSRSDSSESEPKVKSCISSHCNFSSRLSFMSKPIYPLSFPTQTSNREAIDSASTVLSEDDTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTIDPVVGCAKTTAGPSMRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
356502555 508 PREDICTED: uncharacterized protein LOC10 1.0 0.746 0.620 1e-130
449435334436 PREDICTED: uncharacterized protein LOC10 0.997 0.866 0.604 1e-124
356497916422 PREDICTED: uncharacterized protein LOC10 0.886 0.796 0.615 1e-110
357487133447 hypothetical protein MTR_5g041750 [Medic 0.923 0.782 0.503 7e-94
113205448288 Putative mandelonitrile lyase, related [ 0.757 0.996 0.609 8e-85
53749466288 Putative mandelonitrile lyase, related [ 0.757 0.996 0.606 2e-84
255562906324 conserved hypothetical protein [Ricinus 0.757 0.885 0.546 4e-74
240254076348 RING/U-box domain-containing protein [Ar 0.791 0.862 0.433 3e-67
115481938 498 Os10g0406200 [Oryza sativa Japonica Grou 0.883 0.672 0.409 5e-61
78708598433 expressed protein [Oryza sativa Japonica 0.883 0.773 0.409 7e-61
>gi|356502555|ref|XP_003520084.1| PREDICTED: uncharacterized protein LOC100789831 [Glycine max] Back     alignment and taxonomy information
 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 257/414 (62%), Positives = 300/414 (72%), Gaps = 35/414 (8%)

Query: 1   MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKS------ 54
           MGP+EPYW+TN+S+SPPP+RWDFRFQSEGLPY  NDG   YGSSTSS  KES+       
Sbjct: 95  MGPNEPYWRTNSSYSPPPTRWDFRFQSEGLPYDVNDGVQLYGSSTSSIDKESRGWVRGNH 154

Query: 55  --------------------------GWTPPAIQEITIDGYETPTRRD--PVSTQFSFTP 86
                                      WTPPAIQEI+ID YET TR+D  P   + SFTP
Sbjct: 155 LYDLHYSASDDTGIFLSSPSDLSQGPQWTPPAIQEISIDNYETSTRKDSHPSVDRVSFTP 214

Query: 87  AIEGTSANPYSRGSTSSRSDSSESEPKVKSCISSHCNFSSRLSFMSKPIYPLSFPTQTSN 146
             EGTS NP S GSTSS+S+SSESE   KS +SS  NFS+  SFMSKPI+P+SF   T+ 
Sbjct: 215 NKEGTSVNPNSGGSTSSQSESSESESTAKSRLSSQRNFSNLRSFMSKPIHPMSFNDLTTT 274

Query: 147 REAIDSASTVLSEDDTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCG 206
           R+A D A T  +E DTSTP  + HRWSSASSS +FAD++E FE E+ G+S+  SD F+CG
Sbjct: 275 RDAFDPAVTDFTEFDTSTPLRDGHRWSSASSSQEFADITESFELETPGRSHFLSDGFRCG 334

Query: 207 LCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRL 266
           LCERFL+QRSPWSSRRIVRSGDMP +GVL C H FHAECLEQTTPKTQKSDP CP+C++L
Sbjct: 335 LCERFLTQRSPWSSRRIVRSGDMPTIGVLPCCHAFHAECLEQTTPKTQKSDPPCPVCVKL 394

Query: 267 QEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRN 326
           +EENSPDQ+   RL+  FPRL+ S D+G SRPWGC Q G CVEGA H PPRNT+LLLNRN
Sbjct: 395 EEENSPDQRGHLRLRTGFPRLKSSRDDGPSRPWGCVQVGDCVEGALHAPPRNTMLLLNRN 454

Query: 327 RVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTID-PVVGCAKTTAGPSMRR 379
           R+KKNLSLKGN  KEFPGK+RK G  SS LF+G + D   VG +K TAGPS+ R
Sbjct: 455 RIKKNLSLKGNIGKEFPGKMRKNGTFSSHLFSGSSADGEAVGSSKATAGPSVWR 508

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449435334|ref|XP_004135450.1| PREDICTED: uncharacterized protein LOC101203618 [Cucumis sativus] gi|449532609|ref|XP_004173273.1| PREDICTED: uncharacterized LOC101203618 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356497916|ref|XP_003517802.1| PREDICTED: uncharacterized protein LOC100779481 [Glycine max] Back     alignment and taxonomy information
>gi|357487133|ref|XP_003613854.1| hypothetical protein MTR_5g041750 [Medicago truncatula] gi|355515189|gb|AES96812.1| hypothetical protein MTR_5g041750 [Medicago truncatula] Back     alignment and taxonomy information
>gi|113205448|gb|ABI34400.1| Putative mandelonitrile lyase, related [Solanum demissum] Back     alignment and taxonomy information
>gi|53749466|gb|AAU90320.1| Putative mandelonitrile lyase, related [Solanum demissum] Back     alignment and taxonomy information
>gi|255562906|ref|XP_002522458.1| conserved hypothetical protein [Ricinus communis] gi|223538343|gb|EEF39950.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|240254076|ref|NP_563938.5| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|26451018|dbj|BAC42615.1| putative mandelonitrile lyase [Arabidopsis thaliana] gi|332190996|gb|AEE29117.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115481938|ref|NP_001064562.1| Os10g0406200 [Oryza sativa Japonica Group] gi|15451552|gb|AAK98676.1|AC021893_10 Unknown protein [Oryza sativa Japonica Group] gi|113639171|dbj|BAF26476.1| Os10g0406200 [Oryza sativa Japonica Group] gi|125574736|gb|EAZ16020.1| hypothetical protein OsJ_31466 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|78708598|gb|ABB47573.1| expressed protein [Oryza sativa Japonica Group] gi|125531860|gb|EAY78425.1| hypothetical protein OsI_33515 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
TAIR|locus:2035819348 AT1G14180 [Arabidopsis thalian 0.575 0.626 0.386 1.6e-51
TAIR|locus:2172314320 AT5G18260 [Arabidopsis thalian 0.158 0.187 0.583 2.3e-18
TAIR|locus:2136368429 AT4G39140 [Arabidopsis thalian 0.155 0.137 0.542 7.3e-13
TAIR|locus:2050110421 AT2G21500 [Arabidopsis thalian 0.168 0.152 0.5 2.8e-12
TAIR|locus:2013114444 AT1G19680 [Arabidopsis thalian 0.166 0.141 0.471 1.9e-09
TAIR|locus:2018404455 AT1G75400 [Arabidopsis thalian 0.163 0.136 0.428 2.8e-08
TAIR|locus:2035819 AT1G14180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 420 (152.9 bits), Expect = 1.6e-51, Sum P(2) = 1.6e-51
 Identities = 90/233 (38%), Positives = 122/233 (52%)

Query:   123 NFSSRLSFMSKPIYPLSFPTQTSNREAIDSASTVLSEDDTSTPQWEAHRWXXXXXXXXXX 182
             N SSR  F+SKP++P+  P+      A DSA      D  S   W +             
Sbjct:   112 NSSSRRFFLSKPVHPILHPSDNVRDTASDSA------DACS---WSSGTPSSIDSVDVPE 162

Query:   183 XXXEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFH 242
                +   + +  Q    S TFKCGLC R+LSQ+SPW SR IVR+ DMPV GVLSC+HVFH
Sbjct:   163 PVLDWNNNSTKAQQVAASSTFKCGLCNRYLSQKSPWGSRSIVRNRDMPVTGVLSCQHVFH 222

Query:   243 AECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCP 302
              ECL+Q+TPK Q++DP CPIC + + E+     +  RLK  +       D   SRPWGC 
Sbjct:   223 VECLDQSTPKIQRNDPLCPICTKQEGEHFKSNNIVPRLKPLYE------DGPSSRPWGCA 276

Query:   303 QAGGCVEGASHVPPRNTXXXXXXXXXXXXXXXXXXXXXEFPGKLRKTGACSSQ 355
             QAG CVE A +VPP+NT                     +F  K++++ + + +
Sbjct:   277 QAGDCVESAVNVPPKNTMMMINRNRIRKSLSLRGNSSKDFSRKMKRSNSVAME 329
GO:0005576 "extracellular region" evidence=ISM
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0042127 "regulation of cell proliferation" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
TAIR|locus:2172314 AT5G18260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136368 AT4G39140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050110 AT2G21500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013114 AT1G19680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018404 AT1G75400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT1G14180
protein binding / zinc ion binding; protein binding / zinc ion binding; FUNCTIONS IN- protein binding, zinc ion binding; INVOLVED IN- biological_process unknown; EXPRESSED IN- 10 plant structures; EXPRESSED DURING- 6 growth stages; CONTAINS InterPro DOMAIN/s- Zinc finger, RING-type (InterPro-IPR001841); BEST Arabidopsis thaliana protein match is- protein binding / zinc ion binding (TAIR-AT5G18260.1); Has 25 Blast hits to 25 proteins in 6 species- Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 25; Viruses - 0; Other Eukaryotes - 0 (source- NCBI BLink). (348 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G61040
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (590 aa)
   •    0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-04
cd0016245 cd00162, RING, RING-finger (Really Interesting New 0.004
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 38.1 bits (89), Expect = 2e-04
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 4/32 (12%)

Query: 232 VGVLSCRHVFHAECLEQTTPKTQKSDPSCPIC 263
           V VL C HVFH ECL++      +S  +CP+C
Sbjct: 16  VVVLPCGHVFHKECLDKWL----RSSNTCPLC 43

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.36
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.32
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.22
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.16
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.05
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.92
PHA02929238 N1R/p28-like protein; Provisional 98.92
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.86
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.84
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.74
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.72
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.66
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.65
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.62
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.6
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.47
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.46
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.46
PF1463444 zf-RING_5: zinc-RING finger domain 98.45
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.4
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.36
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.3
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.24
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.24
PHA02926242 zinc finger-like protein; Provisional 98.24
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.17
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.15
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.98
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.96
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.76
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.74
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.67
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.63
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.59
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.5
COG52191525 Uncharacterized conserved protein, contains RING Z 97.48
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.47
KOG1941518 consensus Acetylcholine receptor-associated protei 97.44
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.38
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.21
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.1
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.9
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.83
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.82
KOG1940276 consensus Zn-finger protein [General function pred 96.51
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.49
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.19
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.16
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.95
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.8
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.73
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.6
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.48
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.41
KOG4445368 consensus Uncharacterized conserved protein, conta 95.14
PF04641260 Rtf2: Rtf2 RING-finger 95.12
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 95.08
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.08
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 95.01
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.0
PHA02862156 5L protein; Provisional 94.98
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 94.51
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 94.2
COG5152259 Uncharacterized conserved protein, contains RING a 94.14
PHA02825162 LAP/PHD finger-like protein; Provisional 93.92
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 93.85
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 93.76
KOG4739233 consensus Uncharacterized protein involved in syna 93.06
KOG0297 391 consensus TNF receptor-associated factor [Signal t 92.91
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 92.36
PHA03096284 p28-like protein; Provisional 92.3
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 91.23
KOG2660 331 consensus Locus-specific chromosome binding protei 91.19
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.99
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 90.89
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 90.79
COG5222427 Uncharacterized conserved protein, contains RING Z 90.62
KOG1002791 consensus Nucleotide excision repair protein RAD16 89.43
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 88.95
KOG03091081 consensus Conserved WD40 repeat-containing protein 88.78
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 87.42
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 85.07
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 84.88
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 84.73
KOG3053293 consensus Uncharacterized conserved protein [Funct 84.22
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 84.13
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 83.85
KOG1001674 consensus Helicase-like transcription factor HLTF/ 83.81
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 83.75
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 82.51
KOG1609323 consensus Protein involved in mRNA turnover and st 81.94
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 81.5
KOG1829580 consensus Uncharacterized conserved protein, conta 80.06
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=99.36  E-value=1.7e-13  Score=97.19  Aligned_cols=44  Identities=34%  Similarity=0.749  Sum_probs=36.3

Q ss_pred             ccccccccchhccCCCcccccccCCCCCCceeecCCCHhhHHHHHhhccCCCCCCCCCcccc
Q 016977          203 FKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICL  264 (379)
Q Consensus       203 ~~CaICle~LsqrsP~ss~~iv~~gD~~vVaVLPCGHVFHaeCLeqWL~k~~~~d~tCPLCR  264 (379)
                      ..|+||++.|.              +...+.+|+|||+||.+||.+|+..+    .+||+||
T Consensus         1 d~C~IC~~~~~--------------~~~~~~~l~C~H~fh~~Ci~~~~~~~----~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFE--------------DGEKVVKLPCGHVFHRSCIKEWLKRN----NSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHH--------------TTSCEEEETTSEEEEHHHHHHHHHHS----SB-TTTH
T ss_pred             CCCcCCChhhc--------------CCCeEEEccCCCeeCHHHHHHHHHhC----CcCCccC
Confidence            36999999998              23446789999999999999999875    4999997

...
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 4e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-04
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
 Score = 39.1 bits (90), Expect = 3e-04
 Identities = 17/72 (23%), Positives = 23/72 (31%), Gaps = 2/72 (2%)

Query: 205 CGLC-ERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQ-TTPKTQKSDPSCPI 262
           C +C E+                G M V  +  C H FH  CL        +     CP 
Sbjct: 28  CIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPS 87

Query: 263 CLRLQEENSPDQ 274
           C  +  E +  Q
Sbjct: 88  CKTIYGEKTGTQ 99
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.49
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.4
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.39
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.36
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.36
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.35
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.33
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.32
2ect_A78 Ring finger protein 126; metal binding protein, st 99.32
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.31
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.26
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.25
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.22
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.21
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.16
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.14
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.12
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.1
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.1
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.09
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.01
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.0
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.0
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.0
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.98
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.98
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.97
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.95
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.94
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.93
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.92
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.92
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.92
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.92
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.9
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.89
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.88
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.83
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.75
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.75
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.74
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.58
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.56
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.54
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.54
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.49
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.46
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.45
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.43
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.41
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.35
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.34
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.32
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.24
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.23
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.23
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.18
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.06
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.98
2ea5_A68 Cell growth regulator with ring finger domain prot 97.97
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.97
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.86
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.82
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.67
3nw0_A238 Non-structural maintenance of chromosomes element 97.55
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.15
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.39
2k16_A75 Transcription initiation factor TFIID subunit 3; p 90.81
1wil_A89 KIAA1045 protein; ring finger domain, structural g 89.54
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 88.13
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 85.87
1weu_A91 Inhibitor of growth family, member 4; structural g 85.66
1we9_A64 PHD finger family protein; structural genomics, PH 83.97
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 80.4
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.49  E-value=8.9e-15  Score=118.41  Aligned_cols=76  Identities=25%  Similarity=0.390  Sum_probs=50.3

Q ss_pred             CCccccccccchhccCCCccccccc-CCCCCCceeecCCCHhhHHHHHhhccCCC-CCCCCCcccccccccCCCCchh
Q 016977          201 DTFKCGLCERFLSQRSPWSSRRIVR-SGDMPVVGVLSCRHVFHAECLEQTTPKTQ-KSDPSCPICLRLQEENSPDQQV  276 (379)
Q Consensus       201 ~~~~CaICle~LsqrsP~ss~~iv~-~gD~~vVaVLPCGHVFHaeCLeqWL~k~~-~~d~tCPLCRs~~~~~~~~q~~  276 (379)
                      ....|+||++.|.....+....... .....++.+++|||+||.+||++|+...+ ....+||+||..+..+.++||-
T Consensus        24 ~~~~C~ICl~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~Fh~~Ci~~wl~~~~~~~~~~CP~CR~~~~~~~g~qp~  101 (114)
T 1v87_A           24 PEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPW  101 (114)
T ss_dssp             CSCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSCSSSCTT
T ss_pred             CCCcCccCChhhcCcccccccccccccCcccceecCCCCCcccHHHHHHHHHcccCCCCCcCCCCCCccCCCCCCCCC
Confidence            3468999999997432211110000 00122455789999999999999995321 1236999999999987777764
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.002
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.003
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.0 bits (85), Expect = 3e-04
 Identities = 11/61 (18%), Positives = 21/61 (34%), Gaps = 5/61 (8%)

Query: 204 KCGLC-ERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPI 262
            C +C    +       + +   + +   V    C H FH  C+     +  K+   CP+
Sbjct: 23  NCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCIS----RWLKTRQVCPL 78

Query: 263 C 263
            
Sbjct: 79  D 79
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.54
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.41
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.4
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.36
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.35
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.26
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.96
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.89
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.86
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.85
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.84
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.74
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.61
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.6
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.2
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.2
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.83
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 86.16
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 84.25
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 83.82
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 80.77
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Deltex protein 2 RING-H2 domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.54  E-value=1.8e-15  Score=122.13  Aligned_cols=76  Identities=26%  Similarity=0.387  Sum_probs=53.5

Q ss_pred             CCccccccccchhccCCCcccccc-cCCCCCCceeecCCCHhhHHHHHhhccCCCC-CCCCCcccccccccCCCCchh
Q 016977          201 DTFKCGLCERFLSQRSPWSSRRIV-RSGDMPVVGVLSCRHVFHAECLEQTTPKTQK-SDPSCPICLRLQEENSPDQQV  276 (379)
Q Consensus       201 ~~~~CaICle~LsqrsP~ss~~iv-~~gD~~vVaVLPCGHVFHaeCLeqWL~k~~~-~d~tCPLCRs~~~~~~~~q~~  276 (379)
                      ....|+||++.|.....+...... ...+...+.+++|||+||.+||++||...+. .+.+||+||+.++.+.++||-
T Consensus        24 ~~~~C~IC~e~l~~~~~~~~~~~~~~~~~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~~~~~~~~~qP~  101 (114)
T d1v87a_          24 PEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPW  101 (114)
T ss_dssp             CSCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSCSSSCTT
T ss_pred             ccccccchhheecccccccccccccccccccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccchhccCcCCCCC
Confidence            345799999999754333222111 1123445677899999999999999975431 235899999999988777774
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure