Citrus Sinensis ID: 017241

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MGSGETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEcccccc
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccEEcHHHHHHHHHccccccccccccccccEEEEEcccc
mgsgetrrfppaaqpEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTgsgqqtlgeeycditqvvgpqrlpptparRALFIVYQTAVPYIAERISSRVASRGIalaesqsdefdrynaagssrdqsletiespsssaprVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVfigkptnqrpryqILGVFLLIQLCIIAAEGLRRSNLSSIASsvhhtslgfqqastgrglpvlneegslipsesdkggwvldststsesqaapgvskctlclsnrqdptatpcghvfcWNCIMewcnekpecplcrapithsslvclyhsdf
mgsgetrrfppaaqpEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAesqsdefdrynaagssrdqsletiespsssaprvYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTstsesqaapgVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF
MGSGETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF
*************************QYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVA*******************************************AVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNL***********************************************************KCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYH***
**********PAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVG******T**RRALFIVYQTAVPYIAERISSRVASRGI**************************************SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLS******************************************************PGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHS**
**********PAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYN*************************AVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLD*************SKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF
********FPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDE*************************PRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIAS***************************************************GVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSGETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query375 2.2.26 [Sep-21-2011]
Q9SYU4381 Peroxisome biogenesis fac yes no 0.96 0.944 0.713 1e-151
Q8HXW8326 Peroxisome biogenesis fac N/A no 0.84 0.966 0.309 4e-37
O60683326 Peroxisome biogenesis fac yes no 0.834 0.960 0.307 3e-36
B1AUE5324 Peroxisome biogenesis fac yes no 0.834 0.966 0.302 2e-35
Q54S31374 Peroxisome biogenesis fac yes no 0.762 0.764 0.293 5e-34
Q05568337 Peroxisome biogenesis fac yes no 0.746 0.830 0.291 3e-32
Q00940295 Peroxisome biogenesis fac N/A no 0.746 0.949 0.279 1e-30
Q92265419 Peroxisome biogenesis fac yes no 0.797 0.713 0.263 2e-20
Q9UUF0306 Peroxisome biogenesis fac yes no 0.144 0.176 0.5 6e-10
Q91YT2192 E3 ubiquitin-protein liga no no 0.202 0.395 0.341 8e-09
>sp|Q9SYU4|PEX10_ARATH Peroxisome biogenesis factor 10 OS=Arabidopsis thaliana GN=PEX10 PE=1 SV=1 Back     alignment and function desciption
 Score =  533 bits (1374), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 266/373 (71%), Positives = 294/373 (78%), Gaps = 13/373 (3%)

Query: 4   GETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLY 63
           G  RRFP AAQPEIMRAAEKD+QYASFI++ACRDAFR LFGTR+A+AYQ E KL+GQMLY
Sbjct: 21  GGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIALAYQKEMKLLGQMLY 80

Query: 64  YVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRG 123
           YVLTTGSGQQTLGEEYCDI QV GP  L PTPARRALFI+YQTAVPYIAERIS+R A++ 
Sbjct: 81  YVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFILYQTAVPYIAERISTRAATQA 140

Query: 124 IALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRV-YSAVSRLKEKLNGLRLYVIRR 182
           +   ES  DEF      G S   S   I+ PSSS      S VSRL ++L       I+R
Sbjct: 141 VTFDES--DEF-----FGDSHIHSPRMIDLPSSSQVETSTSVVSRLNDRLMRSWHRAIQR 193

Query: 183 WPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVF 242
           WP+VLP+ RE LQLVLRANLM FYFEG YYHISKR +G+RYVFIGK  NQRPRYQILGVF
Sbjct: 194 WPVVLPVAREVLQLVLRANLMLFYFEGFYYHISKRASGVRYVFIGKQLNQRPRYQILGVF 253

Query: 243 LLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGW 302
           LLIQLCI+AAEGLRRSNLSSI SS+   S+G  Q S GRGLPVLNEEG+LI SE++KG W
Sbjct: 254 LLIQLCILAAEGLRRSNLSSITSSIQQASIGSYQTSGGRGLPVLNEEGNLITSEAEKGNW 313

Query: 303 VLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPI 362
                STS+S +   V KCTLCLS RQ PTATPCGHVFCW+CIMEWCNEK ECPLCR P 
Sbjct: 314 -----STSDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCNEKQECPLCRTPN 368

Query: 363 THSSLVCLYHSDF 375
           THSSLVCLYHSDF
Sbjct: 369 THSSLVCLYHSDF 381
Involved in the formation of peroxisomes, lipid bodies and protein bodies. Required for normal-shaped peroxisomes that can physically associate with the outer membrane of the chloroplast envelope. Not involved in beta-oxidation and glyoxylate cycle.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8HXW8|PEX10_MACFA Peroxisome biogenesis factor 10 OS=Macaca fascicularis GN=PEX10 PE=2 SV=1 Back     alignment and function description
>sp|O60683|PEX10_HUMAN Peroxisome biogenesis factor 10 OS=Homo sapiens GN=PEX10 PE=1 SV=1 Back     alignment and function description
>sp|B1AUE5|PEX10_MOUSE Peroxisome biogenesis factor 10 OS=Mus musculus GN=Pex10 PE=2 SV=1 Back     alignment and function description
>sp|Q54S31|PEX10_DICDI Peroxisome biogenesis factor 10 OS=Dictyostelium discoideum GN=pex10 PE=3 SV=2 Back     alignment and function description
>sp|Q05568|PEX10_YEAST Peroxisome biogenesis factor 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX10 PE=1 SV=1 Back     alignment and function description
>sp|Q00940|PEX10_PICAN Peroxisome biogenesis factor 10 OS=Pichia angusta GN=PEX10 PE=3 SV=1 Back     alignment and function description
>sp|Q92265|PEX10_PICPA Peroxisome biogenesis factor 10 OS=Komagataella pastoris GN=PEX10 PE=1 SV=1 Back     alignment and function description
>sp|Q9UUF0|PEX10_SCHPO Peroxisome biogenesis factor 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pas4 PE=3 SV=1 Back     alignment and function description
>sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query375
359476271400 PREDICTED: peroxisome biogenesis factor 0.981 0.92 0.789 1e-166
224088762357 predicted protein [Populus trichocarpa] 0.949 0.997 0.796 1e-159
449447165397 PREDICTED: peroxisome biogenesis factor 0.981 0.926 0.764 1e-155
356552390394 PREDICTED: peroxisome biogenesis factor 0.981 0.934 0.735 1e-152
356564027394 PREDICTED: peroxisome biogenesis factor 0.986 0.939 0.729 1e-151
297825791388 hypothetical protein ARALYDRAFT_481492 [ 0.973 0.940 0.72 1e-150
18401101381 peroxin 10 [Arabidopsis thaliana] gi|340 0.96 0.944 0.713 1e-149
7576235381 Pex10p [Arabidopsis thaliana] 0.96 0.944 0.710 1e-148
21592718381 putative peroxisome assembly protein PER 0.96 0.944 0.705 1e-147
171988284397 peroxisome biogenesis factor 10 [Nicotia 0.992 0.937 0.735 1e-146
>gi|359476271|ref|XP_002279784.2| PREDICTED: peroxisome biogenesis factor 10-like [Vitis vinifera] gi|296081704|emb|CBI20709.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 293/371 (78%), Positives = 321/371 (86%), Gaps = 3/371 (0%)

Query: 6   TRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYV 65
           +RRFP AAQPEIMRAAEKD+QYAS +Y+ACRDAFR LFGTRVAVAYQSETKL+GQMLYY+
Sbjct: 32  SRRFPLAAQPEIMRAAEKDDQYASHVYEACRDAFRHLFGTRVAVAYQSETKLLGQMLYYI 91

Query: 66  LTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIA 125
           LTTGSGQQTLGEEYCDITQV GP  L PTPARRALFI+YQTAVPYIAER+SSRVA+RGIA
Sbjct: 92  LTTGSGQQTLGEEYCDITQVAGPYGLSPTPARRALFILYQTAVPYIAERVSSRVAARGIA 151

Query: 126 LAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVYSAV-SRLKEKLNGLRLYVIRRWP 184
           +A++Q+DE    N  GSS+ QS    E PSSSA     +V SRLKEK N   LY ++RWP
Sbjct: 152 IADAQADELYGNNVPGSSQVQSSAITEIPSSSASGASLSVLSRLKEKFNQSWLYAVQRWP 211

Query: 185 MVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLL 244
           +VLP+ REFLQLVLR NLMFFYFEGLYYHISKR AGIRYVFIGK  NQRPRYQILGVFLL
Sbjct: 212 VVLPLAREFLQLVLRTNLMFFYFEGLYYHISKRAAGIRYVFIGKSLNQRPRYQILGVFLL 271

Query: 245 IQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVL 304
           IQLCIIAAEGLRR NLSSIASSVH T LG  Q +TG+GLPVLNEEG+LI +++DKG WV 
Sbjct: 272 IQLCIIAAEGLRRRNLSSIASSVHRTPLGAHQTATGQGLPVLNEEGNLIAADADKGSWVS 331

Query: 305 DSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITH 364
           DST   ESQA+ GVSKCTLCLSNRQ PTATPCGHVFCW+CIMEWCNEKPECPLCR P+TH
Sbjct: 332 DSTYV-ESQAS-GVSKCTLCLSNRQHPTATPCGHVFCWSCIMEWCNEKPECPLCRTPLTH 389

Query: 365 SSLVCLYHSDF 375
           SSLVCLYHSDF
Sbjct: 390 SSLVCLYHSDF 400

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224088762|ref|XP_002308529.1| predicted protein [Populus trichocarpa] gi|222854505|gb|EEE92052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449447165|ref|XP_004141339.1| PREDICTED: peroxisome biogenesis factor 10-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356552390|ref|XP_003544551.1| PREDICTED: peroxisome biogenesis factor 10-like [Glycine max] Back     alignment and taxonomy information
>gi|356564027|ref|XP_003550258.1| PREDICTED: peroxisome biogenesis factor 10-like [Glycine max] Back     alignment and taxonomy information
>gi|297825791|ref|XP_002880778.1| hypothetical protein ARALYDRAFT_481492 [Arabidopsis lyrata subsp. lyrata] gi|297326617|gb|EFH57037.1| hypothetical protein ARALYDRAFT_481492 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18401101|ref|NP_565621.1| peroxin 10 [Arabidopsis thaliana] gi|34098752|sp|Q9SYU4.1|PEX10_ARATH RecName: Full=Peroxisome biogenesis factor 10; AltName: Full=PER10; AltName: Full=Peroxin-10; AltName: Full=Peroxisomal biogenesis factor 10; Short=AtPEX10; Short=AthPEX10; AltName: Full=Peroxisome assembly protein 10; AltName: Full=Pex10p gi|4337011|gb|AAD18035.1| zinc-binding peroxisomal integral membrane protein [Arabidopsis thaliana] gi|20196940|gb|AAC14514.2| putative peroxisome assembly protein PER8 [Arabidopsis thaliana] gi|26450822|dbj|BAC42519.1| putative zinc-binding peroxisomal integral membrane protein PEX10 [Arabidopsis thaliana] gi|28950961|gb|AAO63404.1| At2g26350 [Arabidopsis thaliana] gi|330252734|gb|AEC07828.1| peroxin 10 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7576235|emb|CAB87983.1| Pex10p [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592718|gb|AAM64667.1| putative peroxisome assembly protein PER8 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|171988284|gb|ACB59354.1| peroxisome biogenesis factor 10 [Nicotiana tabacum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query375
TAIR|locus:2057780381 PEX10 "peroxin 10" [Arabidopsi 0.96 0.944 0.713 2.8e-137
DICTYBASE|DDB_G0282693374 pex10 "peroxisome biogenesis f 0.496 0.497 0.345 2.3e-44
ZFIN|ZDB-GENE-041010-71318 pex10 "peroxisome biogenesis f 0.28 0.330 0.380 1.1e-41
ASPGD|ASPL0000031841373 AN5681 [Emericella nidulans (t 0.92 0.924 0.302 1.8e-39
UNIPROTKB|E1BST1327 PEX10 "Uncharacterized protein 0.144 0.165 0.592 2.8e-38
MGI|MGI:2684988324 Pex10 "peroxisomal biogenesis 0.173 0.200 0.553 7.8e-38
UNIPROTKB|O60683326 PEX10 "Peroxisome biogenesis f 0.165 0.190 0.532 2.5e-37
UNIPROTKB|Q8HXW8326 PEX10 "Peroxisome biogenesis f 0.165 0.190 0.532 5.2e-37
UNIPROTKB|I3LSN3326 LOC100736805 "Uncharacterized 0.274 0.315 0.368 5.9e-37
UNIPROTKB|I3L768326 LOC100624129 "Uncharacterized 0.274 0.315 0.368 9.6e-37
TAIR|locus:2057780 PEX10 "peroxin 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1344 (478.2 bits), Expect = 2.8e-137, P = 2.8e-137
 Identities = 266/373 (71%), Positives = 294/373 (78%)

Query:     4 GETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLY 63
             G  RRFP AAQPEIMRAAEKD+QYASFI++ACRDAFR LFGTR+A+AYQ E KL+GQMLY
Sbjct:    21 GGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIALAYQKEMKLLGQMLY 80

Query:    64 YVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRG 123
             YVLTTGSGQQTLGEEYCDI QV GP  L PTPARRALFI+YQTAVPYIAERIS+R A++ 
Sbjct:    81 YVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFILYQTAVPYIAERISTRAATQA 140

Query:   124 IALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVY-SAVSRLKEKLNGLRLYVIRR 182
             +   ES  DEF      G S   S   I+ PSSS      S VSRL ++L       I+R
Sbjct:   141 VTFDES--DEF-----FGDSHIHSPRMIDLPSSSQVETSTSVVSRLNDRLMRSWHRAIQR 193

Query:   183 WPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVF 242
             WP+VLP+ RE LQLVLRANLM FYFEG YYHISKR +G+RYVFIGK  NQRPRYQILGVF
Sbjct:   194 WPVVLPVAREVLQLVLRANLMLFYFEGFYYHISKRASGVRYVFIGKQLNQRPRYQILGVF 253

Query:   243 LLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGW 302
             LLIQLCI+AAEGLRRSNLSSI SS+   S+G  Q S GRGLPVLNEEG+LI SE++KG W
Sbjct:   254 LLIQLCILAAEGLRRSNLSSITSSIQQASIGSYQTSGGRGLPVLNEEGNLITSEAEKGNW 313

Query:   303 VLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPI 362
                  STS+S +   V KCTLCLS RQ PTATPCGHVFCW+CIMEWCNEK ECPLCR P 
Sbjct:   314 -----STSDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCNEKQECPLCRTPN 368

Query:   363 THSSLVCLYHSDF 375
             THSSLVCLYHSDF
Sbjct:   369 THSSLVCLYHSDF 381
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0007031 "peroxisome organization" evidence=IMP
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
GO:0005777 "peroxisome" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009853 "photorespiration" evidence=IMP
GO:0010381 "attachment of peroxisome to chloroplast" evidence=IMP
GO:0006635 "fatty acid beta-oxidation" evidence=RCA;IMP
GO:0016558 "protein import into peroxisome matrix" evidence=RCA;IMP
DICTYBASE|DDB_G0282693 pex10 "peroxisome biogenesis factor 10" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-71 pex10 "peroxisome biogenesis factor 10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000031841 AN5681 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E1BST1 PEX10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2684988 Pex10 "peroxisomal biogenesis factor 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O60683 PEX10 "Peroxisome biogenesis factor 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXW8 PEX10 "Peroxisome biogenesis factor 10" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSN3 LOC100736805 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3L768 LOC100624129 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O60683PEX10_HUMANNo assigned EC number0.30790.83460.9601yesno
B1AUE5PEX10_MOUSENo assigned EC number0.30240.83460.9660yesno
Q9SYU4PEX10_ARATHNo assigned EC number0.71310.960.9448yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032261001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (400 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00032871001
SubName- Full=Chromosome undetermined scaffold_62, whole genome shotgun sequence; (393 aa)
    • • 0.554
GSVIVG00034358001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (346 aa)
    • • 0.463
GSVIVG00009597001
SubName- Full=Chromosome chr2 scaffold_241, whole genome shotgun sequence; (243 aa)
    • • 0.435
GSVIVG00026327001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (278 aa)
   •  • 0.413

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
pfam04757215 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal 6e-40
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-13
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 7e-13
cd0016245 cd00162, RING, RING-finger (Really Interesting New 9e-13
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 2e-12
PLN03208 193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 5e-10
smart0018440 smart00184, RING, Ring finger 8e-10
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 7e-09
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 4e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-07
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 5e-07
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 2e-06
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 7e-06
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 4e-05
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 8e-05
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 2e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 7e-04
>gnl|CDD|218247 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal region Back     alignment and domain information 
 Score =  140 bits (355), Expect = 6e-40
 Identities = 62/228 (27%), Positives = 95/228 (41%), Gaps = 41/228 (17%)

Query: 24  DEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDIT 83
           DE+  S +    R   R L G R  + Y  E KL+ ++LY  LT   G  TLGEE+  + 
Sbjct: 1   DEELESLLRPQLRYILRYLAGARFLLNYFDELKLLLKLLYERLTLLRGNATLGEEFYGLK 60

Query: 84  QV-VGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGS 142
           +V    +    +  +R L ++     PY+  ++ S +        E+      R      
Sbjct: 61  RVNEDDEGRLLSRKQRLLSLLLLVLGPYLLRKLDSLLERLLEEDLENSLLRQSR------ 114

Query: 143 SRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANL 202
                                 +SRLK +L  L+LY         P +   L+L+   + 
Sbjct: 115 ----------------------LSRLKRRL--LKLY---------PALNALLELLNLLHF 141

Query: 203 MFFYFEGLYYHISKRTAGIRYVFIGKPTNQR-PRYQILGVFLLIQLCI 249
           + F F G YY +SKR  GIRYV + +   +R   Y+ LG  LL QL +
Sbjct: 142 LLFLFGGTYYSLSKRLLGIRYVRLNQSDLERNVSYEFLGRLLLWQLFV 189

This region is found at the N terminal of a number of known and predicted peroxins including Pex2, Pex10 and Pex12. This conserved region is usually associated with a C terminal ring finger (pfam00097) domain. Length = 215
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 375
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 100.0
PF04757229 Pex2_Pex12: Pex2 / Pex12 amino terminal region; In 99.97
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 99.93
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 99.59
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 99.56
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.39
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.35
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.21
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.1
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.93
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.92
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.9
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.88
PHA02929238 N1R/p28-like protein; Provisional 98.86
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.85
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.82
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.8
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.69
PHA02926242 zinc finger-like protein; Provisional 98.66
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.65
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.65
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.63
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.51
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.51
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.46
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.44
PF1463444 zf-RING_5: zinc-RING finger domain 98.42
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.41
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.25
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.2
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.17
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.12
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.08
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.06
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
COG5222427 Uncharacterized conserved protein, contains RING Z 97.96
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.95
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
COG5152259 Uncharacterized conserved protein, contains RING a 97.8
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.8
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.69
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.64
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.56
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.52
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.45
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.33
PF04641260 Rtf2: Rtf2 RING-finger 97.26
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.26
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.19
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 97.15
KOG2660 331 consensus Locus-specific chromosome binding protei 97.1
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.03
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.92
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.78
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.78
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.65
COG52191525 Uncharacterized conserved protein, contains RING Z 96.53
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.44
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.38
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.25
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.11
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.07
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.97
KOG149384 consensus Anaphase-promoting complex (APC), subuni 95.7
KOG4739 233 consensus Uncharacterized protein involved in syna 95.54
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 95.24
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.21
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.21
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.59
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.55
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.38
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 93.67
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.32
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.82
KOG4367 699 consensus Predicted Zn-finger protein [Function un 92.63
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.41
KOG1941518 consensus Acetylcholine receptor-associated protei 92.26
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 91.72
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 91.18
PHA03096284 p28-like protein; Provisional 91.06
KOG3039 303 consensus Uncharacterized conserved protein [Funct 90.29
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 90.09
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.0
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 89.6
PHA02825162 LAP/PHD finger-like protein; Provisional 89.15
KOG3113 293 consensus Uncharacterized conserved protein [Funct 88.94
KOG4445 368 consensus Uncharacterized conserved protein, conta 88.93
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 88.43
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 87.62
COG5109396 Uncharacterized conserved protein, contains RING Z 87.36
PF10272358 Tmpp129: Putative transmembrane protein precursor; 86.72
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 86.65
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 86.26
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 85.37
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 85.32
KOG3002 299 consensus Zn finger protein [General function pred 85.14
KOG03091081 consensus Conserved WD40 repeat-containing protein 84.65
KOG1940276 consensus Zn-finger protein [General function pred 84.2
KOG0298 1394 consensus DEAD box-containing helicase-like transc 83.98
PHA02862156 5L protein; Provisional 82.79
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 82.72
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 82.7
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 81.86
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 81.44
KOG3899381 consensus Uncharacterized conserved protein [Funct 80.87
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-56  Score=405.10  Aligned_cols=285  Identities=36%  Similarity=0.682  Sum_probs=222.5

Q ss_pred             CCCCCchhhhhhhhhHHHHHHHHHHHHHHHHHhcchhHHHhcHHHHHHHHHHHHHHHhhcCCCCCccccccceEEecCCC
Q 017241           10 PPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQ   89 (375)
Q Consensus        10 p~A~~p~IvRa~QkD~~~~~~L~~~l~~~~~~l~g~r~~~~~~~Ei~~~~~llY~~lTt~~g~qTlGEEy~~l~~v~~~~   89 (375)
                      ++|++|+|||+.||||+|.+.+.++++++.+.+.|+|.|++|++|+..+++++||.+||..+.||+||||++|+++|+.+
T Consensus         5 ~~a~~p~ivr~tq~de~~~~~l~~~~s~~~~~lag~r~~i~~~~~l~~~a~~ly~~~at~~~~~tlgEEy~~i~~~~~~~   84 (293)
T KOG0317|consen    5 AHADPPEIVRSTQKDEYYIGYLISSLSGLSRTLAGPRAWIRYRKELVLIAEVLYFGFATDARYQTLGEEYVSIIESNPLR   84 (293)
T ss_pred             cccCchHHHHHhhhHHHhhhhhhhhhHhHhhhhcchHHHHhhccchhhhhchhhheeehhccccccchhhhhhheecCCc
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHHhhHHHHHHHHHHHHHhhhhhhhcccchhhhhhhccCCCCcccccccCCCCCCCcchhhHHHHHH
Q 017241           90 RLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLK  169 (375)
Q Consensus        90 ~~~ps~~rR~l~vll~~~~pyl~~rl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  169 (375)
                      .++|+..+|+.+++++.+.||+.+++.+++....        +              ..     +  +.          .
T Consensus        85 ~~~pssl~~~~~v~~~~v~~~~~~~l~~~l~q~l--------~--------------~~-----~--~i----------~  125 (293)
T KOG0317|consen   85 LRLPSSLRRIVFVASHLVLPLLLDKLTKKLMQAL--------Q--------------SS-----S--EI----------L  125 (293)
T ss_pred             cccCchhhhHHHHHHHHHHHHHhHHHHHHHHHhh--------c--------------cC-----c--cc----------c
Confidence            9999999999999999999999999998874311        0              00     0  00          0


Q ss_pred             HHhhhHHHHHHhhcCcchhhHHHHHHHHHHHHHHHHhhccccchhhhhhcCceEEeecCC----CCCChhHHHHHHHHHH
Q 017241          170 EKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKP----TNQRPRYQILGVFLLI  245 (375)
Q Consensus       170 ~r~~~~~~~~~~~l~~~~~~~~~~~~~~~~lhl~lFy~~G~Yy~l~kRi~giryv~~~~~----~~~~~sy~~Lg~lll~  245 (375)
                      ...+             .+++++.. .+.++|.++||++|.||+|+||++||||++.+..    .+.+..|++||+++++
T Consensus       126 p~~~-------------~~~l~~l~-~v~~~h~~lFY~~g~~y~IskRltgI~yv~~~~~~~~~~~~~q~y~iLg~I~L~  191 (293)
T KOG0317|consen  126 PQAR-------------RNFLRGLF-AVLRAHKALFYINGSFYSISKRLTGIRYVLARTLKGHEANASQPYKILGYILLI  191 (293)
T ss_pred             cHHH-------------HHHhhhHH-HHHHHhhheEEecCchHHHHHhhccceEEEEecccccccccccceeeechhhHH
Confidence            0000             01122233 7899999999999999999999999999999732    3456789999999999


Q ss_pred             HHHHHHhhchhccccccccccccccccccccccCCCCCcccCCCCCCCCCCCCCCCccccCCCCcccCCCCCCccccccC
Q 017241          246 QLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCL  325 (375)
Q Consensus       246 ql~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~  325 (375)
                      |+.+....+........-.             +..+..+    .++.     +..+.   ....+++.......+|.+|+
T Consensus       192 ql~~slg~r~~~s~~q~~~-------------s~~e~~~----e~~~-----~~~~~---~~s~~~~~i~~a~~kC~LCL  246 (293)
T KOG0317|consen  192 QLLLSLGSRLYASFLQHKR-------------SSTESIE----ESKL-----NHSKL---EDSNSLSSIPEATRKCSLCL  246 (293)
T ss_pred             HHHHhhhhHHHHHHHhccc-------------ccccccc----cccc-----cccch---hhccCCccCCCCCCceEEEe
Confidence            9776655444311100000             0000000    0000     00000   00111223455679999999


Q ss_pred             CCCCCCeeeCCCCccchhhHHHHHhcCCCCCCccCCCCCCCceeccC
Q 017241          326 SNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYH  372 (375)
Q Consensus       326 ~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~l~~  372 (375)
                      +.+.+|.++||||+|||.||.+|+.++.+||+||..+++++++.|++
T Consensus       247 e~~~~pSaTpCGHiFCWsCI~~w~~ek~eCPlCR~~~~pskvi~Lr~  293 (293)
T KOG0317|consen  247 ENRSNPSATPCGHIFCWSCILEWCSEKAECPLCREKFQPSKVICLRH  293 (293)
T ss_pred             cCCCCCCcCcCcchHHHHHHHHHHccccCCCcccccCCCcceeeecC
Confidence            99999999999999999999999999999999999999999999875

>PF04757 Pex2_Pex12: Pex2 / Pex12 amino terminal region; InterPro: IPR006845 This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 3e-06
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 6e-05
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 7e-05
4a49_A84 Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Len 1e-04
2k4d_A83 E2-C-Cbl Recognition Is Necessary But Not Sufficien 1e-04
2ldr_A82 Solution Structure Of Helix-Ring Domain Of Cbl-B In 2e-04
4a4c_A391 Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Comp 4e-04
4a4b_A391 Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Za 4e-04
1fbv_A388 Structure Of A Cbl-Ubch7 Complex: Ring Domain Funct 4e-04
2y1m_A389 Structure Of Native C-Cbl Length = 389 4e-04
3vgo_A394 Crystal Structure Of The N-Terminal Fragment Of Cbl 5e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 6e-04
>pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 3/57 (5%)
Query: 314 AAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEK---PECPLCRAPITHSSL 367
           A   + +C +CL   ++P +T C H+FC  C+++  N+K    +CPLC+  IT  SL
Sbjct: 17  AMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSL 73
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|4A49|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Length = 84 Back     alignment and structure
>pdb|2K4D|A Chain A, E2-C-Cbl Recognition Is Necessary But Not Sufficient For Ubiquitination Activity Length = 83 Back     alignment and structure
>pdb|2LDR|A Chain A, Solution Structure Of Helix-Ring Domain Of Cbl-B In The Tyr363 Phosphorylated Form Length = 82 Back     alignment and structure
>pdb|4A4C|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 Back     alignment and structure
>pdb|4A4B|A Chain A, Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 Back     alignment and structure
>pdb|1FBV|A Chain A, Structure Of A Cbl-Ubch7 Complex: Ring Domain Function In Ubiquitin-Protein Ligases Length = 388 Back     alignment and structure
>pdb|2Y1M|A Chain A, Structure Of Native C-Cbl Length = 389 Back     alignment and structure
>pdb|3VGO|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Cbl-B Length = 394 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-23
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-21
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-20
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-19
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-19
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-19
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 5e-19
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 7e-18
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 6e-16
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-13
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 6e-13
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 9e-13
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-12
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-12
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-11
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-11
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-11
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 8e-11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 8e-11
2ysl_A73 Tripartite motif-containing protein 31; ring-type 9e-11
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-10
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 1e-10
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-10
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 4e-10
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 6e-10
1z6u_A150 NP95-like ring finger protein isoform B; structura 9e-10
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-09
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 4e-09
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-09
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-08
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-08
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 4e-08
2ect_A78 Ring finger protein 126; metal binding protein, st 6e-08
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 8e-08
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 1e-07
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-07
2ea5_A68 Cell growth regulator with ring finger domain prot 4e-07
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 4e-07
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 7e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 8e-07
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 1e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-06
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-06
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-06
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 4e-06
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 4e-06
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 4e-06
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 5e-06
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 1e-05
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-05
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 2e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-05
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 4e-05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 1e-04
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 4e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 4e-04
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 4e-04
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
 Score = 91.8 bits (228), Expect = 1e-23
 Identities = 20/66 (30%), Positives = 28/66 (42%)

Query: 306 STSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHS 365
           S S+  +  +  V +C +CL     P + PC HVFC+ C+         C LCR  I   
Sbjct: 3   SGSSGNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPED 62

Query: 366 SLVCLY 371
            L    
Sbjct: 63  FLDSGP 68
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query375
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.38
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.33
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.33
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.32
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.28
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.28
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.28
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.27
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.27
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.27
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.26
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.25
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.25
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.24
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.24
2ect_A78 Ring finger protein 126; metal binding protein, st 99.23
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.22
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.22
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.21
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.15
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.15
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.15
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.12
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.12
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.12
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.12
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.12
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.11
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.1
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.1
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.09
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.07
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.06
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.03
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.02
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.01
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.0
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.0
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.98
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.97
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.96
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.96
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.96
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.95
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.95
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.94
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.94
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.92
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.87
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.86
2ea5_A68 Cell growth regulator with ring finger domain prot 98.84
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.81
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.81
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.76
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.68
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.63
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.59
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.49
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.48
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.34
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.15
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.92
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.75
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.68
3nw0_A238 Non-structural maintenance of chromosomes element 96.29
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 95.42
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.46
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.45
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 90.05
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 84.86
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.38  E-value=9.6e-14  Score=103.01  Aligned_cols=56  Identities=32%  Similarity=0.835  Sum_probs=51.7

Q ss_pred             CCCccccccCCCCCCC-------eeeCCCCccchhhHHHHHhcCCCCCCccCCCCCCCceecc
Q 017241          316 PGVSKCTLCLSNRQDP-------TATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLY  371 (375)
Q Consensus       316 ~~~~~C~iC~~~~~~p-------~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~l~  371 (375)
                      .++..|+||++.+.+|       +.++|||.||..|+..|++.+..||.||+++..+++.++|
T Consensus         8 ~~~~~C~IC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~   70 (71)
T 3ng2_A            8 SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY   70 (71)
T ss_dssp             TTCCBCTTTCCBHHHHHTTTCCEEECTTSCEEEHHHHHHHHHHCSBCTTTCCBCCCCSCCCCC
T ss_pred             CCCCCCcccChhhhccccccCCeEeCCCCChHhHHHHHHHHHcCCCCCCCCCccChhheeecc
Confidence            4578999999998776       7889999999999999999889999999999999999987
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 375
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-15
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-14
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-13
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-13
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-12
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-09
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-09
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 5e-09
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 5e-08
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 5e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-06
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 1e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 3e-04
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

 Score = 66.5 bits (162), Expect = 7e-15
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 320 KCTLCLSNRQDP-TATPCGHVFCWNCIMEWCNEKPECPLCRAPIT 363
           +C +CL +  +   A PC H FC+ CI  W  + P CPLC+ P+ 
Sbjct: 7   RCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVE 51
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query375
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.4
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.27
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.27
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.26
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.24
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.22
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.13
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.12
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.1
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.09
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.01
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.94
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.81
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.81
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.52
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.82
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 93.5
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.40  E-value=4.4e-14  Score=98.45  Aligned_cols=53  Identities=13%  Similarity=0.343  Sum_probs=49.9

Q ss_pred             cccccCCCCCCCeeeC-CCCccchhhHHHHHhcCCCCCCccCCCCCCCceeccC
Q 017241          320 KCTLCLSNRQDPTATP-CGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYH  372 (375)
Q Consensus       320 ~C~iC~~~~~~p~~~~-CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~l~~  372 (375)
                      .|+||++.+.+|+.++ |||+||+.||.+|++.+..||.||+++..++++|+..
T Consensus         2 ~C~Ic~~~~~~Pv~~~~cGh~fc~~cI~~~l~~~~~CP~c~~~l~~~dLipik~   55 (56)
T d2baya1           2 LCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVP   55 (56)
T ss_dssp             CCTTTCSCCSSEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCC
T ss_pred             CCccCCchHHhcCccCCCCCcccHHHHHHHHhhccCCCccCCcCCHHhceeCCC
Confidence            6999999999999885 9999999999999998899999999999999999864
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure